NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090552

Metagenome / Metatranscriptome Family F090552

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090552
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 42 residues
Representative Sequence MKRVIIFALVLLGALAPVAGVAEAHWDSACQCDEVEAP
Number of Associated Samples 81
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 68.52 %
% of genes near scaffold ends (potentially truncated) 23.15 %
% of genes from short scaffolds (< 2000 bps) 75.00 %
Associated GOLD sequencing projects 71
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.630 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(16.667 % of family members)
Environment Ontology (ENVO) Unclassified
(26.852 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.926 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 40.91%    β-sheet: 0.00%    Coil/Unstructured: 59.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF04392ABC_sub_bind 8.33
PF06912DUF1275 7.41
PF00528BPD_transp_1 5.56
PF12911OppC_N 3.70
PF00072Response_reg 2.78
PF01734Patatin 2.78
PF02738MoCoBD_1 2.78
PF07366SnoaL 1.85
PF01266DAO 1.85
PF04909Amidohydro_2 1.85
PF13458Peripla_BP_6 1.85
PF02653BPD_transp_2 0.93
PF13365Trypsin_2 0.93
PF08240ADH_N 0.93
PF07883Cupin_2 0.93
PF03972MmgE_PrpD 0.93
PF02321OEP 0.93
PF00296Bac_luciferase 0.93
PF02417Chromate_transp 0.93
PF01970TctA 0.93
PF00248Aldo_ket_red 0.93
PF07758DUF1614 0.93
PF00041fn3 0.93
PF16576HlyD_D23 0.93
PF00507Oxidored_q4 0.93
PF13602ADH_zinc_N_2 0.93
PF14417MEDS 0.93
PF00583Acetyltransf_1 0.93
PF00873ACR_tran 0.93
PF11066DUF2867 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 8.33
COG3619Uncharacterized membrane protein YoaK, UPF0700 familyFunction unknown [S] 7.41
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 2.78
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 2.78
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 2.78
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.85
COG0838NADH:ubiquinone oxidoreductase subunit 3 (chain A)Energy production and conversion [C] 0.93
COG1784TctA family transporterGeneral function prediction only [R] 0.93
COG2059Chromate transport protein ChrAInorganic ion transport and metabolism [P] 0.93
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.93
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.93
COG3333TctA family transporterGeneral function prediction only [R] 0.93
COG4089Uncharacterized membrane proteinFunction unknown [S] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.63 %
UnclassifiedrootN/A20.37 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c0601779All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium563Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0871407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1123Open in IMG/M
3300000559|F14TC_103211562Not Available1073Open in IMG/M
3300000955|JGI1027J12803_104581615All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa1774Open in IMG/M
3300001431|F14TB_101468908All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium772Open in IMG/M
3300002908|JGI25382J43887_10016204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3901Open in IMG/M
3300005167|Ga0066672_10238484All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1168Open in IMG/M
3300005167|Ga0066672_10532914Not Available761Open in IMG/M
3300005171|Ga0066677_10034644All Organisms → cellular organisms → Bacteria2443Open in IMG/M
3300005171|Ga0066677_10172890All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300005177|Ga0066690_10033227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales3019Open in IMG/M
3300005186|Ga0066676_10556143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium778Open in IMG/M
3300005332|Ga0066388_106604977Not Available584Open in IMG/M
3300005336|Ga0070680_101715445Not Available544Open in IMG/M
3300005445|Ga0070708_101395643All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfolunaceae → Desulfoluna → Desulfoluna butyratoxydans653Open in IMG/M
3300005446|Ga0066686_10420793All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300005467|Ga0070706_100025641All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria5426Open in IMG/M
3300005467|Ga0070706_100960680All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300005467|Ga0070706_101099908All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium732Open in IMG/M
3300005467|Ga0070706_101506133All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium615Open in IMG/M
3300005536|Ga0070697_100689933Not Available901Open in IMG/M
3300005540|Ga0066697_10119716All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1543Open in IMG/M
3300005561|Ga0066699_10099650Not Available1913Open in IMG/M
3300005719|Ga0068861_100394571All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1226Open in IMG/M
3300006049|Ga0075417_10057377All Organisms → cellular organisms → Bacteria → Proteobacteria1697Open in IMG/M
3300006049|Ga0075417_10287123All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300006237|Ga0097621_100099601All Organisms → cellular organisms → Bacteria2443Open in IMG/M
3300006800|Ga0066660_10253234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1378Open in IMG/M
3300006800|Ga0066660_10373069Not Available1167Open in IMG/M
3300006844|Ga0075428_100928083All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300006844|Ga0075428_101867564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300006845|Ga0075421_100059433All Organisms → cellular organisms → Bacteria → Proteobacteria4833Open in IMG/M
3300006847|Ga0075431_101647605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium599Open in IMG/M
3300006852|Ga0075433_10376445All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1254Open in IMG/M
3300006854|Ga0075425_100925980All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300006871|Ga0075434_100230036All Organisms → cellular organisms → Bacteria1873Open in IMG/M
3300007076|Ga0075435_100183349All Organisms → cellular organisms → Bacteria1770Open in IMG/M
3300007258|Ga0099793_10074912All Organisms → cellular organisms → Bacteria1535Open in IMG/M
3300009012|Ga0066710_100559469All Organisms → cellular organisms → Bacteria → Proteobacteria1731Open in IMG/M
3300009094|Ga0111539_11665884All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300009100|Ga0075418_10278506All Organisms → cellular organisms → Bacteria1782Open in IMG/M
3300009137|Ga0066709_100067211All Organisms → cellular organisms → Bacteria4184Open in IMG/M
3300009137|Ga0066709_102955140Not Available625Open in IMG/M
3300009143|Ga0099792_10205608Not Available1123Open in IMG/M
3300009147|Ga0114129_10002283All Organisms → cellular organisms → Bacteria26550Open in IMG/M
3300009147|Ga0114129_10599571All Organisms → cellular organisms → Bacteria → Proteobacteria1427Open in IMG/M
3300009176|Ga0105242_10577169All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1082Open in IMG/M
3300009837|Ga0105058_1102085Not Available674Open in IMG/M
3300009837|Ga0105058_1181428Not Available521Open in IMG/M
3300010124|Ga0127498_1121476Not Available604Open in IMG/M
3300010358|Ga0126370_10847268All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium820Open in IMG/M
3300010360|Ga0126372_10008360All Organisms → cellular organisms → Bacteria5310Open in IMG/M
3300012199|Ga0137383_10967816All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300012202|Ga0137363_10096519All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2236Open in IMG/M
3300012203|Ga0137399_10066669All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2684Open in IMG/M
3300012205|Ga0137362_10037931All Organisms → cellular organisms → Bacteria3864Open in IMG/M
3300012211|Ga0137377_10020040All Organisms → cellular organisms → Bacteria → Proteobacteria5894Open in IMG/M
3300012361|Ga0137360_10042827All Organisms → cellular organisms → Bacteria3220Open in IMG/M
3300012390|Ga0134054_1067308Not Available520Open in IMG/M
3300012410|Ga0134060_1291899Not Available789Open in IMG/M
3300012685|Ga0137397_10006583All Organisms → cellular organisms → Bacteria8058Open in IMG/M
3300012685|Ga0137397_10916981All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300012918|Ga0137396_10001596All Organisms → cellular organisms → Bacteria12031Open in IMG/M
3300012922|Ga0137394_10262279All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1478Open in IMG/M
3300012922|Ga0137394_10280174All Organisms → cellular organisms → Bacteria1426Open in IMG/M
3300012944|Ga0137410_11525903All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300012975|Ga0134110_10153534Not Available952Open in IMG/M
3300013297|Ga0157378_10159557All Organisms → cellular organisms → Bacteria2108Open in IMG/M
3300015371|Ga0132258_11023946All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2087Open in IMG/M
3300017792|Ga0163161_10835103All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium776Open in IMG/M
3300020170|Ga0179594_10091747All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1083Open in IMG/M
3300025910|Ga0207684_10117844All Organisms → cellular organisms → Bacteria2275Open in IMG/M
3300025910|Ga0207684_10489827Not Available1054Open in IMG/M
3300025922|Ga0207646_10078985All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2942Open in IMG/M
3300025922|Ga0207646_11736872Not Available535Open in IMG/M
3300025934|Ga0207686_10468927All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium972Open in IMG/M
3300025972|Ga0207668_10388876All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1176Open in IMG/M
3300026118|Ga0207675_100554697All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1148Open in IMG/M
3300026297|Ga0209237_1080010All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300026309|Ga0209055_1002649All Organisms → cellular organisms → Bacteria11210Open in IMG/M
3300026315|Ga0209686_1145139All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300026324|Ga0209470_1305562Not Available587Open in IMG/M
3300026325|Ga0209152_10036952Not Available1686Open in IMG/M
3300026332|Ga0209803_1074635All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300026469|Ga0257169_1075979Not Available546Open in IMG/M
3300026537|Ga0209157_1235376All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300026540|Ga0209376_1418243All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300027577|Ga0209874_1084348All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium774Open in IMG/M
3300027873|Ga0209814_10341382All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium655Open in IMG/M
3300027903|Ga0209488_10320208Not Available1156Open in IMG/M
3300027909|Ga0209382_10107090All Organisms → cellular organisms → Bacteria3270Open in IMG/M
3300027909|Ga0209382_10499752All Organisms → cellular organisms → Bacteria1339Open in IMG/M
3300027909|Ga0209382_11467673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae681Open in IMG/M
3300028536|Ga0137415_10028469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5505Open in IMG/M
3300031720|Ga0307469_10068706All Organisms → cellular organisms → Bacteria2335Open in IMG/M
3300031720|Ga0307469_10126734All Organisms → cellular organisms → Bacteria1860Open in IMG/M
3300031720|Ga0307469_10841169All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300031720|Ga0307469_11786602All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium594Open in IMG/M
3300031720|Ga0307469_12373256Not Available518Open in IMG/M
3300031740|Ga0307468_100030852All Organisms → cellular organisms → Bacteria2552Open in IMG/M
3300031740|Ga0307468_100574735All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300031820|Ga0307473_10028709All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2393Open in IMG/M
3300031820|Ga0307473_10756979All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium688Open in IMG/M
3300032174|Ga0307470_10737195All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300032180|Ga0307471_100122808All Organisms → cellular organisms → Bacteria → Proteobacteria2424Open in IMG/M
3300032180|Ga0307471_101219036All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium916Open in IMG/M
3300032180|Ga0307471_101338670All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium878Open in IMG/M
3300032180|Ga0307471_103474101All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium558Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil16.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere16.67%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil12.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil4.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.70%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010124Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012390Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_060177923300000033SoilMKRIIMLALVLLGALAPVVVTSVAEAHWDDACQCNEIEAP*
ICChiseqgaiiDRAFT_087140723300000033SoilMKRFMIFALVLLGALAPVAGVAHVAEAHWDNACQCNEVEAP*
F14TC_10321156223300000559SoilMKRAIIFALVLFGALAPMAGIADAHWDTACQCDEIESP*
JGI1027J12803_10458161513300000955SoilMKRVIIFALVLLGALAPLAGVAEAHWDTACQCNDIEAP*
F14TB_10146890813300001431SoilMKRIIMLALVLLGALAPVVVTSVAEAHWDDACQCNEIE
JGI25382J43887_1001620443300002908Grasslands SoilMKRAIIFAALVLLGALAPFAGVAEAHWDNACQCNEVEAP*
Ga0066672_1023848423300005167SoilVVRDERGEIKMKRAIIFAALVLLGALAPFAGVAEAHWDNACQCNEVEAP*
Ga0066672_1053291423300005167SoilMKRVIMFALVLLGALAPVVVTSVAEAHWNDACQCNEVEAP*
Ga0066677_1003464433300005171SoilMRDLVSDRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP*
Ga0066677_1017289023300005171SoilVVRDERGEIKMKRAIIFAALVLLGALAPFASVAEAHWDDACQCNEVEAP*
Ga0066690_1003322753300005177SoilGGDQMKQVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP*
Ga0066676_1055614333300005186SoilGRGEIKMKRVIIFALVLLGALAPFAGVAEAHWDNACQCNEVEAP*
Ga0066388_10660497733300005332Tropical Forest SoilMKRFMIFTLVLLGALAPVVGVAHFAEAGWDTACQCNVVEAP*
Ga0070680_10171544513300005336Corn RhizosphereMKRVIMFALVLLAALAPAVVTSVAEAHWDDACHCNEIEAP
Ga0070708_10139564323300005445Corn, Switchgrass And Miscanthus RhizosphereMRDGRGEFKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP*
Ga0066686_1042079313300005446SoilVVRDERGEIKMKRAIIFAALVLLGALAPFAGVAEAHWDDACQCNEVEAP*
Ga0070706_10002564163300005467Corn, Switchgrass And Miscanthus RhizosphereMRDLVSDRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP*
Ga0070706_10096068013300005467Corn, Switchgrass And Miscanthus RhizosphereMRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP*
Ga0070706_10109990813300005467Corn, Switchgrass And Miscanthus RhizosphereMKRVIMFALVLLGALAPVVVTSVAEAHWDDACQCNEVEAP*
Ga0070706_10150613323300005467Corn, Switchgrass And Miscanthus RhizosphereMKRVIIFAALVLLGALAPVAGVAEAHPDTTCQCNEIEAP*
Ga0070697_10068993313300005536Corn, Switchgrass And Miscanthus RhizosphereRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP*
Ga0066697_1011971623300005540SoilMKQVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP*
Ga0066699_1009965023300005561SoilMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP*
Ga0068861_10039457133300005719Switchgrass RhizosphereMMKRAIILALVLFGALAPMAGIADAHWDTACQCEEIESP*
Ga0075417_1005737723300006049Populus RhizosphereMKRVIMFALVLLTALGPVAGLARVAEAHWDSACQCNETEAP*
Ga0075417_1028712323300006049Populus RhizosphereMKRVMIMFALVLLGALAPVVGVAHVAEAHWDSACRCDATEAP*
Ga0097621_10009960143300006237Miscanthus RhizosphereVREKEGGEIKMKRVIMFALVLLAALAPAVVTSVAEAHWDDACHCNEIEAP*
Ga0066660_1025323423300006800SoilMRDLVSDRDGRGEIKMKRAIIFAALVLLGALAPFAGVAEAHWDNACQCNEVEAP*
Ga0066660_1037306913300006800SoilDQMKQVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP*
Ga0075428_10092808313300006844Populus RhizosphereMKRFMIFALVLLGALAPVAGVAHVAEAHWDSACQCDTLEAP*
Ga0075428_10186756423300006844Populus RhizosphereMKRVIMFALVLLAALGPVAGLARVAEAHWDSACQCNETEAP*
Ga0075421_10005943373300006845Populus RhizosphereMKRFIIFALVLLGALAPVAGVAHVAEAHWDSACQCDTLEAP*
Ga0075431_10164760513300006847Populus RhizosphereMKRFMIFALVLLGALAPVAGVAHVAEAHWDSACQC
Ga0075433_1037644513300006852Populus RhizosphereMKRAIIFALVLFGALAPVVGVAEAHWDTTCQCNEIEAP*
Ga0075425_10092598033300006854Populus RhizosphereMKRVIIFAALVLLGALAPVAGVAKAHPDTTCQCNEIEAP
Ga0075434_10023003613300006871Populus RhizosphereSVMKRAIIFALVLFGALAPVVGVAEAHWDTTCQCNEIEAP*
Ga0075435_10018334913300007076Populus RhizosphereGVRSVMKRAIIFALVLFGALAPVVGVAEAHWDTTCQCNEIEAP*
Ga0099793_1007491213300007258Vadose Zone SoilMRERRGEIKMKRVIIFALVLLGALAPVAGVAEAHWDSACQCNEVEAP*
Ga0066710_10055946923300009012Grasslands SoilMKRVIIFALVLLGALAPVAGVAEAHWNDACQCNEVEAP
Ga0111539_1166588413300009094Populus RhizosphereKRVIMFALVLLTALGPVAGLARVAEAHWDSACQCNETEAP*
Ga0075418_1027850613300009100Populus RhizosphereMKRFMIFALVLLGALAPVAGVTHVAEAHWDSACQCE
Ga0066709_10006721123300009137Grasslands SoilMKRVIIFALVLLGALAPVAGVAEAHWNDACQCNEVEAP*
Ga0066709_10295514013300009137Grasslands SoilVVRDERGEIKMKRAIIFAALALLGALAPFAGVAEAHWVDACQCNEVEAP*
Ga0099792_1020560823300009143Vadose Zone SoilMKRVIIFFALVLLGALAPLAGVAEAHWDDACQCNEVEAP*
Ga0114129_10002283263300009147Populus RhizosphereMIMFALVLLGALAPVVGVAHVAEAHWDSACRCDATEAP*
Ga0114129_1059957133300009147Populus RhizosphereMKRIIMLALVLLGALAPVVVTSVAEAQWDDACQCNEIEAP*
Ga0105242_1057716933300009176Miscanthus RhizosphereMKRAIIFALVLLGALAPVVGVAQAHWDTACSCDEIESP*
Ga0105058_110208513300009837Groundwater SandMKRFMIFALVLLGALAPVAGVAHVAEAHWDSACQCDAVEAP*
Ga0105058_118142813300009837Groundwater SandMKKVIIFALVLFGALAPVVGVAEAHWDTACQCNEIE
Ga0127498_112147613300010124Grasslands SoilRDLVSDRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP*
Ga0126370_1084726813300010358Tropical Forest SoilRFMIFTLVLLGALAPVVGVAHFAEAGWDTACQCNVVEAP*
Ga0126372_1000836013300010360Tropical Forest SoilNVEREVSQMKRFMIFTLVLLGALAPVVGVAHFAEAGWDTACQCNVVEAP*
Ga0137383_1096781623300012199Vadose Zone SoilVVRDERGEIKMKRAIIFAALALLGALAPFAGVAEAHWDDACQCNEVEAP*
Ga0137363_1009651913300012202Vadose Zone SoilMKRVIIFALVLLGALAPVVGVAEAHWDNACQCNEVEAP*
Ga0137399_1006666923300012203Vadose Zone SoilMRERRGEIKMKRVIIFALVLLGALAPVAGVAEAHWDSACQCDEVEAP*
Ga0137362_1003793133300012205Vadose Zone SoilMKRVIIFALVLLGALAPLAGVAEAHWDSACQCNEVEAP*
Ga0137377_1002004053300012211Vadose Zone SoilMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP*
Ga0137360_1004282733300012361Vadose Zone SoilMKRVIIFALVLLGALAPLAGVAEAHWDSACQCNEV*
Ga0134054_106730813300012390Grasslands SoilSDRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP*
Ga0134060_129189913300012410Grasslands SoilIDRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP*
Ga0137397_1000658343300012685Vadose Zone SoilMKRFMIFALVLLGALAPVAGVAHVAEAHWDSACQCNEVEAP*
Ga0137397_1091698123300012685Vadose Zone SoilMMKRAMIFALVLLGALAPVVGVAEAHWDSACQCNEFESP*
Ga0137396_10001596163300012918Vadose Zone SoilMRERRGEIKMKRVIIFALVLLGALAPVAGVAEAHWDSACQYDEVEAP*
Ga0137394_1026227923300012922Vadose Zone SoilMKRVIMFALVLLGALAPVVVTSVAEAHWDSACQCNEIEAP*
Ga0137394_1028017423300012922Vadose Zone SoilMKRAIIFAFLLLAALAPMVGVAEAYWDTACQCNEVEAP*
Ga0137410_1152590313300012944Vadose Zone SoilMMKRAIIFALVLLGALAPVVGVAEARWDDACQCNQIEAP*
Ga0134110_1015353423300012975Grasslands SoilMRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP*
Ga0157378_1015955743300013297Miscanthus RhizosphereMMKRAIIFALVLFGALAPVVGVAEAHWDTTCECNEIEAP*
Ga0132258_1102394613300015371Arabidopsis RhizosphereIILALVLFGALAPMAGIADAHWDTACQCEEIESP*
Ga0163161_1083510313300017792Switchgrass RhizosphereMMKRAIILALVLFGALAPMASIADAHWDTACQCEEIESP
Ga0179594_1009174713300020170Vadose Zone SoilMKRVIIFALVLLGALAPLAGVAEAHWDSACQCNEVEAP
Ga0207684_1011784433300025910Corn, Switchgrass And Miscanthus RhizosphereMKRAIIFAALVLLGALAPFAGVAEAHWDNACQCNEVEAP
Ga0207684_1048982713300025910Corn, Switchgrass And Miscanthus RhizosphereMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP
Ga0207646_1007898553300025922Corn, Switchgrass And Miscanthus RhizosphereMRDGRGEIKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDETEAP
Ga0207646_1173687213300025922Corn, Switchgrass And Miscanthus RhizosphereMKRIIIFALVLLGAIAPVASVAEAHWDDACHCNEIEAPERRYSDLI
Ga0207686_1046892733300025934Miscanthus RhizosphereMKRAIIFALVLLGALAPVVGVAQAHWDTACSCDEIESP
Ga0207668_1038887623300025972Switchgrass RhizosphereMMKRAIILALVLFGALAPMAGIADAHWDTACQCEEIESP
Ga0207675_10055469723300026118Switchgrass RhizosphereMMKRAIIFALVLFGALAPMAGIADAHWDTACQCDEIESP
Ga0209237_108001013300026297Grasslands SoilVVRDERGEIKMKRAIIFAALVLLGALAPFAGVAEAHWDNACQCNEVEAP
Ga0209055_1002649133300026309SoilMKQVIIFALVLLGALAPVASVAEAHWDDACHCDEVEAP
Ga0209686_114513923300026315SoilVVRDERGEIKMKRAIIFAALVLLGALAPFASVAEAHWDDACQCNEVEAP
Ga0209470_130556213300026324SoilMKQVIIFALVLLGALAPVASVAEAHWDDACHCDEVE
Ga0209152_1003695233300026325SoilMKRVIIFALVLLGALAPVASVAEAHWDDACHCDETEAP
Ga0209803_107463533300026332SoilMRDGRGEFKMKRVIIFALVLLGALAPVASVAEAHWDDACHCDEIEAP
Ga0257169_107597923300026469SoilMKRVIIFALVLLGALAPVVGVADAHWDDACQCNEVEAP
Ga0209157_123537623300026537SoilVVRDERGEIKMKRAIIFAALVLLGALAPFAGVAEAHWDDACQCNEVEAP
Ga0209376_141824323300026540SoilVVRDERGEIKMKRAIIFAALVLLGALTPFAGVAEAHWDNACQCNEVEAP
Ga0209874_108434823300027577Groundwater SandMKRFMIFALVLLGALAPVAGVAHVAEAHWDSACQCDAVEAP
Ga0209814_1034138213300027873Populus RhizosphereMKRVMIMFALVLLGALAPVVGVAHVAEAHWDSACRCDATEAP
Ga0209488_1032020823300027903Vadose Zone SoilMKRVIIFFALVLLGALAPLAGVAEAHWDDACQCNEVEAP
Ga0209382_1010709023300027909Populus RhizosphereMKRVIMFALVILGALAPVVVTSVAEAHWDDACQCNEIEAP
Ga0209382_1049975223300027909Populus RhizosphereMKRVIMFALVLLAALGPVAGLARVAEAHWDSACQCNETEAP
Ga0209382_1146767313300027909Populus RhizosphereMKRFIIFALVLLGALAPVAGVAHVAEAHWDSACQCDTLEAP
Ga0137415_1002846973300028536Vadose Zone SoilMKRVIIFALVLLGALAPVAGVAEAHWDSACQCDEVEAP
Ga0307469_1006870623300031720Hardwood Forest SoilMKRFMIFALVLLGALAPVAAVTHVAEARWDSACQCNEVEAP
Ga0307469_1012673423300031720Hardwood Forest SoilMRETEIERGEIKMKRVIIFALVLLGALAPLAGVAEAHWDTACQCNDIEAP
Ga0307469_1084116923300031720Hardwood Forest SoilMMKRAIIFALVLFGALAPVVGIAEAHWDTTCQCNEIEAP
Ga0307469_1178660213300031720Hardwood Forest SoilMMKRAIIFALVLFGALAPMAGIADAHWDTACQCDEIEAP
Ga0307469_1237325623300031720Hardwood Forest SoilMMKRAIILALVLFGALAPMAGIADAHWDTACQCDEIESP
Ga0307468_10003085223300031740Hardwood Forest SoilMMKRAIIFALVLFGALAPVVGVAEAHWDTTCQCNEIEAP
Ga0307468_10057473523300031740Hardwood Forest SoilVRERKKKEGGEIKMKRIIMLALVLFGALAPVVVTSVAEAHWDDACQCNEIEAP
Ga0307473_1002870913300031820Hardwood Forest SoilMKRVIIFALVLLGALAPLAGVAEAHWDTACQCNDIEAP
Ga0307473_1075697913300031820Hardwood Forest SoilPMMKRAIIFALVLFGALAPMAGIADAHWDTACQCDEIEAP
Ga0307470_1073719523300032174Hardwood Forest SoilMKRAIIFALVLFGALAPVVGVAEAHWDTTCQCNEIEAP
Ga0307471_10012280833300032180Hardwood Forest SoilMKRFMIFALVLLGALAPVAGVVHVAEAHWDSACQCETFEAP
Ga0307471_10121903633300032180Hardwood Forest SoilMKRFMIFALVLLGALAPVAGVVHVAEAHWDSSCQCDQVEAP
Ga0307471_10133867023300032180Hardwood Forest SoilMKRVIMFALVLLGALAPVVVTSVAEAHWDDACQCNEVEAP
Ga0307471_10347410113300032180Hardwood Forest SoilMKRVIVFALVLLGALAPVVVTSVAEAHWNDACQCNEVEAP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.