| Basic Information | |
|---|---|
| Family ID | F090538 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRVTMLVRCLAMMRGGGETRHLAWARELAALGVDVDIITGI |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 62.04 % |
| % of genes near scaffold ends (potentially truncated) | 99.07 % |
| % of genes from short scaffolds (< 2000 bps) | 96.30 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.259 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.963 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.074 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.19% β-sheet: 14.49% Coil/Unstructured: 62.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00733 | Asn_synthase | 81.48 |
| PF04464 | Glyphos_transf | 7.41 |
| PF13537 | GATase_7 | 6.48 |
| PF01882 | DUF58 | 0.93 |
| PF08666 | SAF | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1887 | CDP-glycerol glycerophosphotransferase, TagB/SpsB family | Cell wall/membrane/envelope biogenesis [M] | 7.41 |
| COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c1989801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300001686|C688J18823_10131566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1726 | Open in IMG/M |
| 3300005179|Ga0066684_10276476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
| 3300005329|Ga0070683_100777890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300005332|Ga0066388_100080834 | All Organisms → cellular organisms → Bacteria | 3621 | Open in IMG/M |
| 3300005332|Ga0066388_101713619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1113 | Open in IMG/M |
| 3300005338|Ga0068868_100213574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1613 | Open in IMG/M |
| 3300005343|Ga0070687_101004272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300005364|Ga0070673_102124073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300005364|Ga0070673_102144672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300005529|Ga0070741_11664501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300005544|Ga0070686_101024967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300005568|Ga0066703_10159312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1358 | Open in IMG/M |
| 3300005616|Ga0068852_101952187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300005617|Ga0068859_100105261 | All Organisms → cellular organisms → Bacteria | 2881 | Open in IMG/M |
| 3300005719|Ga0068861_100721954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300005764|Ga0066903_101989601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1116 | Open in IMG/M |
| 3300005764|Ga0066903_102514385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300005829|Ga0074479_10543459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300005844|Ga0068862_102633291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300006059|Ga0075017_101220104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300006237|Ga0097621_100682850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300006580|Ga0074049_11396537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300006852|Ga0075433_11461855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300006853|Ga0075420_101839142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300006854|Ga0075425_101447854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300006871|Ga0075434_102471685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300006904|Ga0075424_102101717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300006914|Ga0075436_100749082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300009089|Ga0099828_10694950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300009156|Ga0111538_10444164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1644 | Open in IMG/M |
| 3300009156|Ga0111538_11220438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300010303|Ga0134082_10024962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2223 | Open in IMG/M |
| 3300010320|Ga0134109_10499704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300010358|Ga0126370_10998273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300010359|Ga0126376_11051720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300010397|Ga0134124_10258148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1606 | Open in IMG/M |
| 3300010400|Ga0134122_10410097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
| 3300010401|Ga0134121_10240197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1582 | Open in IMG/M |
| 3300010401|Ga0134121_11994658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300011444|Ga0137463_1196922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300012096|Ga0137389_10524982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300012207|Ga0137381_11249999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300012232|Ga0137435_1261039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300012353|Ga0137367_10637560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300012362|Ga0137361_10412057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
| 3300012925|Ga0137419_10003285 | All Organisms → cellular organisms → Bacteria | 7666 | Open in IMG/M |
| 3300012961|Ga0164302_11114180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300012971|Ga0126369_11107271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300012971|Ga0126369_12099917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300012987|Ga0164307_11783477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300013296|Ga0157374_11074686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300013296|Ga0157374_11516621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300013306|Ga0163162_11964899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300013308|Ga0157375_12895139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300013308|Ga0157375_13166915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300014968|Ga0157379_12496430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300014969|Ga0157376_12075878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300015077|Ga0173483_10656303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300015357|Ga0134072_10115351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300015372|Ga0132256_103812678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300018056|Ga0184623_10143465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300018422|Ga0190265_10246246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1831 | Open in IMG/M |
| 3300018476|Ga0190274_12823684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300019362|Ga0173479_10542179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300020580|Ga0210403_11130031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300021861|Ga0213853_11500581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300025862|Ga0209483_1305371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300025906|Ga0207699_11477994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300025922|Ga0207646_11215089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300025926|Ga0207659_10976355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300025935|Ga0207709_11124487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300025941|Ga0207711_10392548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
| 3300025942|Ga0207689_11082169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300025944|Ga0207661_10736259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300025960|Ga0207651_11584788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300025986|Ga0207658_10256857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1487 | Open in IMG/M |
| 3300025986|Ga0207658_12032518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300026035|Ga0207703_11002868 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300026075|Ga0207708_10192441 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300026088|Ga0207641_11631402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300026089|Ga0207648_10303920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1431 | Open in IMG/M |
| 3300026304|Ga0209240_1081031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300026304|Ga0209240_1266305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300026309|Ga0209055_1287350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300026310|Ga0209239_1098907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300026527|Ga0209059_1051708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1805 | Open in IMG/M |
| 3300026540|Ga0209376_1123090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1285 | Open in IMG/M |
| 3300027821|Ga0209811_10072900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1203 | Open in IMG/M |
| 3300027907|Ga0207428_10721078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300027909|Ga0209382_11030206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300028379|Ga0268266_11029205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300028380|Ga0268265_12412740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300028792|Ga0307504_10237215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300028828|Ga0307312_10384740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300031226|Ga0307497_10504694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300031240|Ga0265320_10462051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300031544|Ga0318534_10078718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1872 | Open in IMG/M |
| 3300031740|Ga0307468_101055094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300032000|Ga0310903_10280039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300032002|Ga0307416_100567119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
| 3300032076|Ga0306924_11955316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300032180|Ga0307471_104218248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300032205|Ga0307472_102423966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300032211|Ga0310896_10598822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300032261|Ga0306920_100729960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1458 | Open in IMG/M |
| 3300032261|Ga0306920_104249691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300032954|Ga0335083_10900390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.63% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.78% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.85% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.93% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_19898012 | 3300000033 | Soil | VRVTMLLRCLGMMHGGGETRHLAWARXLXRAGXXVTXVTGRPLFGAT |
| C688J18823_101315662 | 3300001686 | Soil | VRVTMLVRCLAMMRGGGETRHLAWARELTSLGVHVRIVTG |
| Ga0066684_102764762 | 3300005179 | Soil | MRVTMLVRCLAMMRGGGETRHLAWMRELAALGVDVDVIAGEPW |
| Ga0070683_1007778901 | 3300005329 | Corn Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWARELTALGVDVRIIAG |
| Ga0066388_1000808344 | 3300005332 | Tropical Forest Soil | MLLRCLGMMHGGGETRHLAWARELQRAGDEVTIVTGRPLLA |
| Ga0066388_1017136191 | 3300005332 | Tropical Forest Soil | MMLRCLGMMRGGGETRHIAWMRELDAMGVDVEVITGGPLFGAMRY |
| Ga0068868_1002135741 | 3300005338 | Miscanthus Rhizosphere | MVLRCLTMMHGGGETRHLAWARELRAAGDDVTMITGRPLLARPRHA |
| Ga0070687_1010042722 | 3300005343 | Switchgrass Rhizosphere | VRVTILLRCLSMMHGGGETRHLAWARELQRAGDDVTIVTGRPLFA |
| Ga0070673_1021240732 | 3300005364 | Switchgrass Rhizosphere | MRVTMLVRCLAMMHGGGETRHLAWMKELAALGVEVDVIAGRPLV |
| Ga0070673_1021446721 | 3300005364 | Switchgrass Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWMRELDALGVEVDVITGQPL |
| Ga0070741_116645011 | 3300005529 | Surface Soil | MRVTMLVRCLAMMRGGGETRHLAWARELAALGVEV |
| Ga0070686_1010249671 | 3300005544 | Switchgrass Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWMRELANLGVDVDVITGQPL |
| Ga0066703_101593121 | 3300005568 | Soil | MRVTMLVRCLAMMRGGGETRHLAWAHELGGLGIDVDIVTGA |
| Ga0068852_1019521871 | 3300005616 | Corn Rhizosphere | MMLRCLGMMRGGGETRHLAWMRELTAMGVDVEVITGG |
| Ga0068859_1001052611 | 3300005617 | Switchgrass Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWARELAALGVDVDII |
| Ga0068861_1007219542 | 3300005719 | Switchgrass Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWMRELTALGVDVDVITGEPLWLGGL |
| Ga0066903_1019896012 | 3300005764 | Tropical Forest Soil | VRVTMLVRCLSMMHGGGETRHLAWARALRSAGDEVTIITGRPLFAPARYQTDDG |
| Ga0066903_1025143851 | 3300005764 | Tropical Forest Soil | MFVRCLAMMRGGGETRHLAWARELIAAGVDVDIVTGRPFLLGRP |
| Ga0074479_105434591 | 3300005829 | Sediment (Intertidal) | MLLRCLGMMRGGGETRHMAWMRELTGMGVEVEVITGGPLFGDMRY |
| Ga0068862_1026332911 | 3300005844 | Switchgrass Rhizosphere | MRVTYLMRCLAMMRGGGETQHLAWMRALVRAGVEVQIIS |
| Ga0075017_1012201042 | 3300006059 | Watersheds | MLLRCLGMMRGGGETRHMAWMRELDAMGVEVEVITGGPLFG |
| Ga0097621_1006828501 | 3300006237 | Miscanthus Rhizosphere | MRVSMLVRCLAMMWGGGETRHLEWARELTALGVEVEIITGVPLS |
| Ga0074049_113965371 | 3300006580 | Soil | MRVTMLVRCLAMMRGGGETRHLAWARELSALGVDVEIVLGVPLVSGRGRY |
| Ga0075433_114618551 | 3300006852 | Populus Rhizosphere | MLVRCLAMMRGGGETRHLAWARELAALGVEVDIIAGRPLLFGG |
| Ga0075420_1018391422 | 3300006853 | Populus Rhizosphere | VRVTILLRCLSMMHGGGETRHLAWARELRRAGDEVTIVTGRPLFAP |
| Ga0075425_1014478542 | 3300006854 | Populus Rhizosphere | VRVTMLLRCLGMMHGGGETRHLAWARELRRAGDEVTIITGR |
| Ga0075434_1024716851 | 3300006871 | Populus Rhizosphere | VRVTMLVRCLAMMRGGGETRHLAWARELRALGVDVDII |
| Ga0075424_1021017172 | 3300006904 | Populus Rhizosphere | VRITFVLRCLTMMHGGGETRHLAWARELRAAGDDVT |
| Ga0075436_1007490821 | 3300006914 | Populus Rhizosphere | MRVTMLVRCLAMMHGGGETRHLAWARELASLGVEVDIIAGRPL |
| Ga0099828_106949501 | 3300009089 | Vadose Zone Soil | MRVTMLVRCLAMMRGGGETRHLAWAKELTALGVDVE |
| Ga0111538_104441641 | 3300009156 | Populus Rhizosphere | VRVTILLRCLSMMHGGGETRHLAWARELQRAGDEVTIVTGRPL |
| Ga0111538_112204382 | 3300009156 | Populus Rhizosphere | VRVTYLMRCLAMMRGGGETQHLAWMRALAKLGVEID |
| Ga0134082_100249621 | 3300010303 | Grasslands Soil | MRVTMLVRCLAMMRGGGETRHLAWARELAALGADV |
| Ga0134109_104997041 | 3300010320 | Grasslands Soil | MRVTMLVLCLAMMRGGGETRHLAWMRELDALGVEVDVIAGRPLM |
| Ga0126370_109982731 | 3300010358 | Tropical Forest Soil | MMLRCLGMMRGGGETRHIAWMREFDAMGVDVEVIT |
| Ga0126376_110517201 | 3300010359 | Tropical Forest Soil | MKVTYFMRCLAMMRGGGETQHLAWIRALRGMGVEIDIITGRP |
| Ga0134124_102581481 | 3300010397 | Terrestrial Soil | MRVTMLVRCLAMMRGGGETRHLAWARELHALGVDVEIIT |
| Ga0134122_104100971 | 3300010400 | Terrestrial Soil | VRVTMLVRCLAMMRGGGETRHLAWAHELSALGVEVDII |
| Ga0134121_102401971 | 3300010401 | Terrestrial Soil | MRVIMLVRCLAMMRGGGETRHLAWARELSALGVDVEVITGVPLLGAA |
| Ga0134121_119946582 | 3300010401 | Terrestrial Soil | MLVRCLAMMRGGGETRHLAWARELTALGVDVEMITGAPL |
| Ga0137463_11969222 | 3300011444 | Soil | MRVTMLVRCLAMMRGGGETRHLAWARELGALGVDVEI |
| Ga0137389_105249822 | 3300012096 | Vadose Zone Soil | VRVTMLVRCLAMMRGGGETRHLAWARELTALGVSVEIIAGRPLLFGG |
| Ga0137381_112499991 | 3300012207 | Vadose Zone Soil | MLVRCLAMMRGGGETRHLAWARELAAMGVDVDIITGAPLF |
| Ga0137435_12610391 | 3300012232 | Soil | VALVRVTYLMRCLGMMRGGGETQHLAWMRTLKGMGVEIEVISGRP |
| Ga0137367_106375601 | 3300012353 | Vadose Zone Soil | MRVTMLVRCLAMMRGGGEMRHLAWARELTSMGVRVEIIAGRPLLV |
| Ga0137361_104120571 | 3300012362 | Vadose Zone Soil | MRVTMLVRCLAMMRGGGETRHLAWARELAALGADVDIIAGRPLLL |
| Ga0137419_100032851 | 3300012925 | Vadose Zone Soil | VRVTMLVRCLAMMRGGGETRHLAWARELTALGVSVEIIAGR |
| Ga0164302_111141802 | 3300012961 | Soil | VRVTILLRCLSMMHGGGETRHLAWARELQRAGDEVTIVTGRPLFAP |
| Ga0126369_111072712 | 3300012971 | Tropical Forest Soil | MLLRCLGMMHGGGETRHLAWARELQRAGDEVTIVTGRPLFAHARQPLD |
| Ga0126369_120999172 | 3300012971 | Tropical Forest Soil | VRVTMFVRCLAMMRGGGETRHLAWAHELTALGVEVDIITGAPLFGE |
| Ga0164307_117834771 | 3300012987 | Soil | MMRGGGETRHLAWARELTALGVDVRIVTGVPLVSGEVRYPID |
| Ga0157374_110746861 | 3300013296 | Miscanthus Rhizosphere | MMLRCLGMMRGGGETRHLAWMRELRARGVDVEVISG* |
| Ga0157374_115166211 | 3300013296 | Miscanthus Rhizosphere | MRVTMRVRCLAMMLGGGGTRHLAWMKELAALGVEVDVIAGRPLV |
| Ga0163162_119648992 | 3300013306 | Switchgrass Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWARELTALGVDIEIIAG |
| Ga0157375_128951392 | 3300013308 | Miscanthus Rhizosphere | VRVTMLVRCLSMMHGGGETRHLAWAQALRLAGHAVTIITG |
| Ga0157375_131669151 | 3300013308 | Miscanthus Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWARELTALGVDVDFITGRPLLFGQ |
| Ga0157379_124964301 | 3300014968 | Switchgrass Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWMRELGALGVEVDVITGQPLMLG |
| Ga0157376_120758781 | 3300014969 | Miscanthus Rhizosphere | MRVTMLVRCLAMMHGGGETRHLAWMKELAALGVDVDVIA |
| Ga0173483_106563032 | 3300015077 | Soil | MRVTMLVRCLAMMRGGGETRHLAWMRELTALGVEVDVIT |
| Ga0134072_101153511 | 3300015357 | Grasslands Soil | MRVTMLVRCLAMMRGGGETRHLAWAHELGGLGIDVDIVTGAPL |
| Ga0132256_1038126781 | 3300015372 | Arabidopsis Rhizosphere | MRVTILLRCLSMMHGGGETRHLAWARELQRAGDEVTIVTGRPLF |
| Ga0184623_101434652 | 3300018056 | Groundwater Sediment | MRVTMLVRCLAMMRGGGETRHLAWARERTSLGVDVHVIA |
| Ga0190265_102462461 | 3300018422 | Soil | VRVTYLMRCLAMMRGGGETQHLAWMRALTRLGVEIEVI |
| Ga0190274_128236842 | 3300018476 | Soil | MRVAMLVRCLAMMRGGGETRHLAWARELGALGVDVEIVTGRPLLGAHRYA |
| Ga0173479_105421791 | 3300019362 | Soil | MRVTMLVRCLAMMRGGGETRHLAWMRELTAMGVEVDVITGQPLLLGGARF |
| Ga0210403_111300312 | 3300020580 | Soil | MRVTMLVRCLAMMRGGGETRHLAWMRELESLGVEVD |
| Ga0213853_115005812 | 3300021861 | Watersheds | MRVTMLLRCLAMMRGGGETRHLAWARELTALGVEVD |
| Ga0209483_13053712 | 3300025862 | Arctic Peat Soil | VCSQRDSVRVTMMLRCLGMMRGGGETRHLAWIRELDAMGVDVEVITG |
| Ga0207699_114779942 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVTMLLRCLAMMRGGGETRHMAWMRELAAMGVEVEVITGGPLFGQMRYS |
| Ga0207646_112150892 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTMLVRCLAMMRGGGETRHLAWARELTALGVEVEIIAG |
| Ga0207659_109763551 | 3300025926 | Miscanthus Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWMRELTALGVEVDVI |
| Ga0207709_111244872 | 3300025935 | Miscanthus Rhizosphere | VTILLRCLSMMHGGGETRHLAWARELQRAGDEVTIVTGR |
| Ga0207711_103925481 | 3300025941 | Switchgrass Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWMRELAALGVDVDVITGAPLWLG |
| Ga0207689_110821691 | 3300025942 | Miscanthus Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWMRELDALGVEVDVITGQPLMIGG |
| Ga0207661_107362592 | 3300025944 | Corn Rhizosphere | MILRCLAMMRGGGETRHMAWMRELAAMGVDVDVITGGPLFGDMRY |
| Ga0207651_115847883 | 3300025960 | Switchgrass Rhizosphere | VRVTMLVRCLAMMRGGGETRHLAWARELTALGVDVEIIA |
| Ga0207658_102568571 | 3300025986 | Switchgrass Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWARELAALGVDVDIITGI |
| Ga0207658_120325182 | 3300025986 | Switchgrass Rhizosphere | VTMLVRCLAMMHGGGETRHLAWMKELAALGVEVDVIAGRPLVLG |
| Ga0207703_110028683 | 3300026035 | Switchgrass Rhizosphere | VRVTMLVRCLAMMRGGGETRHLAWARELTMLGVHVDIITGAPLVGAAR |
| Ga0207708_101924411 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWAQELSAMGVEVEIITGGPLL |
| Ga0207641_116314021 | 3300026088 | Switchgrass Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWARELGALGVDVEIITGVPLV |
| Ga0207648_103039201 | 3300026089 | Miscanthus Rhizosphere | MRVTMLVRCLAMMRGGGETRHLAWARELTALGVDVDF |
| Ga0209240_10810313 | 3300026304 | Grasslands Soil | MRVTMFIRCLAMMRGGGETRHLAWIRELSLLGVEVDVV |
| Ga0209240_12663051 | 3300026304 | Grasslands Soil | VTMLVRCLAMMRGGGETRHLAWARELAALGVDVDVITGVPLVSGEAR |
| Ga0209055_12873502 | 3300026309 | Soil | MLVRCLAMMRGGGETRHLAWAHELGGLGIDVDIVT |
| Ga0209239_10989071 | 3300026310 | Grasslands Soil | MLVRCLAMMRGGGETRHLAWAHELGGLGIDVDIVTGAPLLGQPRYPL |
| Ga0209059_10517082 | 3300026527 | Soil | MLVRCLAMMRGGGETRHLAWAHELGGLGIDVDIVTGAP |
| Ga0209376_11230901 | 3300026540 | Soil | VRVTMLVRCLAMMRGGGETRHLAWARELQSLGVSVELV |
| Ga0209811_100729002 | 3300027821 | Surface Soil | MLVRCLAMMRGGGETRHLAWARELAAMGVDVDIIAGRPLLFGGP |
| Ga0207428_107210781 | 3300027907 | Populus Rhizosphere | VRVTILLRCLSMMHGGGETRHLAWARELRRAGDEVTIVTGRPLFAPARF |
| Ga0209382_110302062 | 3300027909 | Populus Rhizosphere | VRVTILLRCLSMMHGGGETRHLAWARELQRAGDEVTIVTGRPLF |
| Ga0268266_110292052 | 3300028379 | Switchgrass Rhizosphere | MRVTYLMRCLAMMRGGGETQHLAWMRGLRAQGVEI |
| Ga0268265_124127402 | 3300028380 | Switchgrass Rhizosphere | VRVTYLMRCLAMMRGGGETQHLAWMRALIGMGIEIDII |
| Ga0307504_102372151 | 3300028792 | Soil | MRVTMLVRCLAMMRGGGETRHLAWMRELSALGIDVDVITGRPLLVGRLRH |
| Ga0307312_103847401 | 3300028828 | Soil | MRVTMLVRCLAMMRGGGETRHLAWMKELAALGVEVDVITGRPL |
| Ga0307497_105046942 | 3300031226 | Soil | MRVTMLVRCLAMMHGGGETRHLAWMKDLAALGADVDVIAGRPLL |
| Ga0265320_104620512 | 3300031240 | Rhizosphere | VTMMLRCLGMMRGGGETRHLAWIHELEAMGVDVEVITGGP |
| Ga0318534_100787181 | 3300031544 | Soil | VRVTMLVRCLSMMHGGGETRHLAWARALRSAGDEVTIIT |
| Ga0307468_1010550942 | 3300031740 | Hardwood Forest Soil | VTILLRCLSMMHGGGETRHLAWARELQRAGDEVTIVTGRPLFAPAR |
| Ga0310903_102800392 | 3300032000 | Soil | MLVRCLAMMRGGGETRHLAWARELVAAGVNVDIIT |
| Ga0307416_1005671191 | 3300032002 | Rhizosphere | VRVTMLLRCLGMMHGGGETRHLAWARELQRAGDEV |
| Ga0306924_119553162 | 3300032076 | Soil | MRVTMLVRCLAMMRGGGETRHLAWARELTRLGIDVELVAGRPL |
| Ga0307471_1042182481 | 3300032180 | Hardwood Forest Soil | MLVRCLAMMRGGGETRHLAWARELTALGVDVEIITGAPLFGEARY |
| Ga0307472_1024239661 | 3300032205 | Hardwood Forest Soil | MRVTMLVRCLAMMRGGGETRHLAWARELVALGVDVDI |
| Ga0310896_105988222 | 3300032211 | Soil | VRVTMLLRCLGMMHGGGETRHLAWARELQRAGDRVTI |
| Ga0306920_1007299602 | 3300032261 | Soil | MLVRCLAMMRGGGETRHLAWAHELSALGVDVDILAGRPLLFGG |
| Ga0306920_1042496911 | 3300032261 | Soil | MMLRCVAMMRGGGETQHLAWIRELLAMGVDVELITG |
| Ga0335083_109003901 | 3300032954 | Soil | MMLRCLGMMRGGGETRHIAWMRELDAMGVDVEVITGGPLFGAMRYAVR |
| ⦗Top⦘ |