| Basic Information | |
|---|---|
| Family ID | F090452 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 44 residues |
| Representative Sequence | DLYGNEVTDAVATYTFDQAGSLYELHSPQTELPRLGIPKS |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.96 % |
| % of genes near scaffold ends (potentially truncated) | 89.81 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.519 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.185 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.704 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.370 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 11.76% Coil/Unstructured: 88.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF07452 | CHRD | 52.78 |
| PF13442 | Cytochrome_CBB3 | 12.96 |
| PF16861 | Carbam_trans_C | 2.78 |
| PF04199 | Cyclase | 0.93 |
| PF13360 | PQQ_2 | 0.93 |
| PF00107 | ADH_zinc_N | 0.93 |
| PF01799 | Fer2_2 | 0.93 |
| PF00155 | Aminotran_1_2 | 0.93 |
| PF00702 | Hydrolase | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.52 % |
| Unclassified | root | N/A | 6.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105049292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300000789|JGI1027J11758_12395043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300001431|F14TB_101752019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300004156|Ga0062589_100349003 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300004479|Ga0062595_100464153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300004643|Ga0062591_101898301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300005179|Ga0066684_10519134 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005544|Ga0070686_100589242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 875 | Open in IMG/M |
| 3300005546|Ga0070696_100050950 | All Organisms → cellular organisms → Bacteria | 2879 | Open in IMG/M |
| 3300005546|Ga0070696_100835153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 760 | Open in IMG/M |
| 3300005549|Ga0070704_102147441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300005553|Ga0066695_10177276 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300005568|Ga0066703_10055412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2232 | Open in IMG/M |
| 3300005598|Ga0066706_11381530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300005719|Ga0068861_101259014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300005764|Ga0066903_104143329 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005842|Ga0068858_101250049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 730 | Open in IMG/M |
| 3300005844|Ga0068862_101940104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300005937|Ga0081455_10474762 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300006358|Ga0068871_100804057 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300006604|Ga0074060_12068194 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300006852|Ga0075433_10997163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300006854|Ga0075425_102082311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 634 | Open in IMG/M |
| 3300006854|Ga0075425_102182507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300006871|Ga0075434_102206901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300006904|Ga0075424_101914357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300009137|Ga0066709_100451066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1798 | Open in IMG/M |
| 3300009137|Ga0066709_101583242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300009137|Ga0066709_102152744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 770 | Open in IMG/M |
| 3300009147|Ga0114129_11343849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 884 | Open in IMG/M |
| 3300009553|Ga0105249_10468291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1301 | Open in IMG/M |
| 3300010042|Ga0126314_10946415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300010047|Ga0126382_12382002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300010362|Ga0126377_11728256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300010362|Ga0126377_12310650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300010397|Ga0134124_10084176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2740 | Open in IMG/M |
| 3300010399|Ga0134127_12516141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_9 | 594 | Open in IMG/M |
| 3300010401|Ga0134121_10216603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1662 | Open in IMG/M |
| 3300012096|Ga0137389_10160010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1850 | Open in IMG/M |
| 3300012200|Ga0137382_11334861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300012211|Ga0137377_11946127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300012212|Ga0150985_113686019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1096 | Open in IMG/M |
| 3300012469|Ga0150984_108496903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300012532|Ga0137373_10290055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1305 | Open in IMG/M |
| 3300012922|Ga0137394_11300392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300012925|Ga0137419_10869563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 741 | Open in IMG/M |
| 3300012960|Ga0164301_10058416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2028 | Open in IMG/M |
| 3300012961|Ga0164302_10684631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 757 | Open in IMG/M |
| 3300012989|Ga0164305_11198586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300015371|Ga0132258_10185090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5039 | Open in IMG/M |
| 3300015371|Ga0132258_11010917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2101 | Open in IMG/M |
| 3300015372|Ga0132256_101459389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300015372|Ga0132256_102339025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300015374|Ga0132255_101282675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1104 | Open in IMG/M |
| 3300015374|Ga0132255_101588492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300015374|Ga0132255_102878846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300015374|Ga0132255_105073606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 557 | Open in IMG/M |
| 3300017659|Ga0134083_10579105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300017792|Ga0163161_10306958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1251 | Open in IMG/M |
| 3300018032|Ga0187788_10248384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300018054|Ga0184621_10082281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1121 | Open in IMG/M |
| 3300018073|Ga0184624_10002485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5501 | Open in IMG/M |
| 3300019883|Ga0193725_1124777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 583 | Open in IMG/M |
| 3300021078|Ga0210381_10396505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300021560|Ga0126371_12501578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300025905|Ga0207685_10659837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300025907|Ga0207645_10207922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1289 | Open in IMG/M |
| 3300025911|Ga0207654_10256982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1173 | Open in IMG/M |
| 3300025922|Ga0207646_11246854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300025934|Ga0207686_11037624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300025941|Ga0207711_10224063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. Leaf231 | 1721 | Open in IMG/M |
| 3300025945|Ga0207679_10862314 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300026295|Ga0209234_1025041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2264 | Open in IMG/M |
| 3300026542|Ga0209805_1052462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2028 | Open in IMG/M |
| 3300027873|Ga0209814_10449667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300028380|Ga0268265_12153942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300028381|Ga0268264_11433176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300028714|Ga0307309_10201252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300028792|Ga0307504_10354151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300028819|Ga0307296_10100648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_9 | 1549 | Open in IMG/M |
| 3300028824|Ga0307310_10119804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1189 | Open in IMG/M |
| 3300031474|Ga0170818_109148803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300031562|Ga0310886_10497464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 735 | Open in IMG/M |
| 3300031720|Ga0307469_10018814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3688 | Open in IMG/M |
| 3300031764|Ga0318535_10561526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300031781|Ga0318547_10706077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300031858|Ga0310892_11216228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300031908|Ga0310900_11309201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 606 | Open in IMG/M |
| 3300031910|Ga0306923_11870606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300032012|Ga0310902_10177066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1232 | Open in IMG/M |
| 3300032013|Ga0310906_10827301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 656 | Open in IMG/M |
| 3300032075|Ga0310890_11223917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 612 | Open in IMG/M |
| 3300032076|Ga0306924_10263870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1978 | Open in IMG/M |
| 3300032174|Ga0307470_10733276 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300032205|Ga0307472_102226760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300032211|Ga0310896_10508440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 661 | Open in IMG/M |
| 3300032211|Ga0310896_10889703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300032421|Ga0310812_10213561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_9 | 840 | Open in IMG/M |
| 3300032421|Ga0310812_10251817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300033412|Ga0310810_10118588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3126 | Open in IMG/M |
| 3300034115|Ga0364945_0264628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 6.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.85% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1050492923 | 3300000364 | Soil | DGFADVLGNPVSAAVAKYKFDSVGSLYEVHSPQTELPRLGSPKS* |
| JGI1027J11758_123950431 | 3300000789 | Soil | PDREEGPADLLGNPVTDAVARYKFDATGSLYELHSPQTEVPKLRPPKT* |
| F14TB_1017520191 | 3300001431 | Soil | DLYGNEVSDAVARYTLDPAGSLYELHSPQTELTRLGSPKS* |
| Ga0063455_1002340443 | 3300004153 | Soil | RIADEDVDAYGNEVTTAVAEYSLDGAGDLYELHSPQTELPRLGSPES* |
| Ga0062589_1003490031 | 3300004156 | Soil | DPDREEGPADLFGNPVTDAVARYKFDATGSLYELHSPQTEVPKLRPPKT* |
| Ga0062595_1004641533 | 3300004479 | Soil | DVAQSVVDLYGNEVSDAIATYSLDQAGSLYELHSPQTELPRLGAPKS* |
| Ga0062591_1018983011 | 3300004643 | Soil | DLYGNEVTDAVATYTFDQAGSLYELHSPQTELPRLGIPKS* |
| Ga0066684_105191342 | 3300005179 | Soil | MDVYGNQVTAAVATYEFDATGTLYELHSPQTEIPRLGSPKS* |
| Ga0070676_105519541 | 3300005328 | Miscanthus Rhizosphere | GDDASGFTDLYGNEVTDAVATYTFDQSGSLYELHSPQTELPRLGIPKS* |
| Ga0070698_1003673034 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DPRADRGSGFTDDEDEVTDVYGNGITAAVASYKYDATGTLYELHSPQTELPRLAAPKS* |
| Ga0070698_1018406052 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | SGDRGSDLTEDEVMDVYGNEVTAAVATYKVDAAGTLYELHSPQTELPRLAAPKS* |
| Ga0070686_1005892423 | 3300005544 | Switchgrass Rhizosphere | PVEGAPIEDAATDMYGNRVTPAVATYQLDAAGTLYELHSPQTQLPRLGSPKS* |
| Ga0070696_1000509501 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | FTDLYGNEVTDAIATYTFDQSGSLYELHSPQTELPRLGIPKS* |
| Ga0070696_1008351531 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GAVVDLYGNEVTDAIATYSIDPAGSVYELHSPQTEVPRLGSPKS* |
| Ga0070704_1021474412 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PNDAFTDLYGNEVSDAIATYKFDQSGSLYELHSPQTELPRLGIPKS* |
| Ga0066695_101772761 | 3300005553 | Soil | GDDMPENLDLYGNEVTDAVAKYRFDASGSLYELHSPQTEVPKLAPPKT* |
| Ga0066703_100554121 | 3300005568 | Soil | TDDNEGTVDLFGNEVTDAVAKYKTDATGSLYELHSPQTELPRLGSPKT* |
| Ga0066706_113815301 | 3300005598 | Soil | LYGNEVTDAVAKYRFDASGSLYELHSPQTEVPKLAPPKT* |
| Ga0068861_1012590142 | 3300005719 | Switchgrass Rhizosphere | SNDAFTDLYGNEVNDALATYTLDQAGSLYELHSPQTELPRLGIPKS* |
| Ga0066903_1041433293 | 3300005764 | Tropical Forest Soil | DISGNEVTPAVATYSIDALGSPYELHSPQTELPRLGSPKS* |
| Ga0068858_1012500493 | 3300005842 | Switchgrass Rhizosphere | VDLYGNEVSDAIATYSLDPAGSLYELHSPQTELPRLAEPKS* |
| Ga0068862_1019401041 | 3300005844 | Switchgrass Rhizosphere | MDTEDDVDAYGNEVTPAVAEYSLDPAGSPYERHSPQTELPRLGSPKS* |
| Ga0081455_104747623 | 3300005937 | Tabebuia Heterophylla Rhizosphere | AAVDLVGNKVNAAVAKYKFDAAGSLYELHSPQTEVPRLRSPKT* |
| Ga0068871_1008040573 | 3300006358 | Miscanthus Rhizosphere | EPNEDEAIDMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS* |
| Ga0074060_120681941 | 3300006604 | Soil | GGEPNEDEAMDMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS* |
| Ga0075433_109971633 | 3300006852 | Populus Rhizosphere | NEVTDAIATYGVDPAGSLYELHSPQTELPRLGSPKS* |
| Ga0075425_1020823111 | 3300006854 | Populus Rhizosphere | ATDVYGNRVTPAVATYQLDAAGMPYELHSPQTQLPRLGSPKS* |
| Ga0075425_1021825071 | 3300006854 | Populus Rhizosphere | GNRVTDAVAKYKFDATGTLYESHSPQTELPRLAPPKT* |
| Ga0075434_1022069012 | 3300006871 | Populus Rhizosphere | DLLGNPVSDAIAKYKLDPAGGLYELHSPQTELPRLAAPKS* |
| Ga0075424_1019143571 | 3300006904 | Populus Rhizosphere | EVTDAVAKYRFDASGSLYELHSPQTEVPKLAPPKT* |
| Ga0066709_1004510661 | 3300009137 | Grasslands Soil | INDAVAKYQYDAAGLVYELHSPETEVPKLAPPKT* |
| Ga0066709_1015832421 | 3300009137 | Grasslands Soil | DDALGLYGNEVIDAVATYSLDPTGSLYELHSPQTELPRLASPKS* |
| Ga0066709_1021527443 | 3300009137 | Grasslands Soil | VYGNEVTAAVATYEIDATGSLYELHSPQTQLPRLGSPKS* |
| Ga0114129_113438491 | 3300009147 | Populus Rhizosphere | IDLYGNGVSPAVATYSLDALGSLYEEHSPQTELPRLGSPKT* |
| Ga0105249_104682913 | 3300009553 | Switchgrass Rhizosphere | GDSNDAFTDLYGNEVNDALATYTFDQAGSLYELHSPQTELPRLGIPKS* |
| Ga0126314_109464151 | 3300010042 | Serpentine Soil | AGQPGDGFTDVYGNEINDAVATYTLDPSGSLYELHSPQTELPRLGIPKS* |
| Ga0126382_123820021 | 3300010047 | Tropical Forest Soil | TVDRYGNEVIDAVATYSLDPTGSLYEMHSPQTELPRLPSPKS* |
| Ga0126377_117282561 | 3300010362 | Tropical Forest Soil | GDGPVDLQDNEVTDAVATYKLDATGSLYETHSPQTELPRLGSPKS* |
| Ga0126377_123106501 | 3300010362 | Tropical Forest Soil | YWFEVNDAISTYTFFPGGSLYELHSPQTEVPRLGSPKS* |
| Ga0134124_100841763 | 3300010397 | Terrestrial Soil | VTPAVATYQLDAAGMPYELHSPQTQVPRLGSPKS* |
| Ga0134127_125161411 | 3300010399 | Terrestrial Soil | GSADLYGNEVIEAVATFKLDEAGSLYEVHSPQTELPQLGSPQG* |
| Ga0134121_102166031 | 3300010401 | Terrestrial Soil | NEVTPAVAEYSLDPAGSPYELHSPQTELPRLGSPKS* |
| Ga0137389_101600104 | 3300012096 | Vadose Zone Soil | DATDVYGNEVTAAVAKYKFDATGTLYELHSPQTELPRLASPKS* |
| Ga0137382_113348611 | 3300012200 | Vadose Zone Soil | DLYGNEVTDAVAKYRFDATGSLYELHSPQTEVPKLAPPKT* |
| Ga0137377_119461272 | 3300012211 | Vadose Zone Soil | EVTDAVAKYRFDATGSLYELHSPQTEVPKLAPPKT* |
| Ga0150985_1136860191 | 3300012212 | Avena Fatua Rhizosphere | DLYGNEVSDAIATYSLDPTGSLYELHSPQTELPRLAEPKS* |
| Ga0150984_1084969033 | 3300012469 | Avena Fatua Rhizosphere | LYGNEVSDAIATYSLDPTGSLYELHSPQTELPRLAEPKS* |
| Ga0137373_102900553 | 3300012532 | Vadose Zone Soil | GNEITPAVAKYSFDATGSLYELHSPQTELPRLGSPKS* |
| Ga0137394_113003922 | 3300012922 | Vadose Zone Soil | EVTDAMAEYTIDPAGSLYELHSPQTELPRLGIPKS* |
| Ga0137419_108695631 | 3300012925 | Vadose Zone Soil | NEVTVAVAKYRLDATGAQYELHSPQTELPRRAPPRS* |
| Ga0164301_100584161 | 3300012960 | Soil | MYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS* |
| Ga0164302_106846312 | 3300012961 | Soil | EALDMYGNRVTPAVATYQLDAAGTLYELHSPQTQLPRLGSPKS* |
| Ga0164305_111985862 | 3300012989 | Soil | YGNEVSDAIATYSLDPTGSLYELHSPQTELPRLGEPKS* |
| Ga0132258_101850904 | 3300015371 | Arabidopsis Rhizosphere | VSGQEQGDADGPVDLLGNEVTDAVAKYKFDATGSLYETHSPQTELPRLSSPKS* |
| Ga0132258_110109171 | 3300015371 | Arabidopsis Rhizosphere | TPDAEGPVDLYGNEVTDAVAKYKFDATGSLYETHSPQTELPRLASPKS* |
| Ga0132258_126825551 | 3300015371 | Arabidopsis Rhizosphere | VADVPPSHHTRFDPKDTAVDLYGNEVDDAIATYSIDPAGSPYEVHSPQTELPRLGSPKS* |
| Ga0132256_1014593893 | 3300015372 | Arabidopsis Rhizosphere | IRDAEEDFLVDLYGNEVTPAVATYTFDDLGTLYEVHSPQTEVPRLGSPKS* |
| Ga0132256_1023390252 | 3300015372 | Arabidopsis Rhizosphere | VSGQEQGDADGPVDLLGNEVTDAVAKYKFDATGSLYETHSPQTELPRLASPKS* |
| Ga0132255_1012826753 | 3300015374 | Arabidopsis Rhizosphere | ADVLIDLYGNDVSPAVATYSFDALGSLYEEHSPQTELPRLGSPKT* |
| Ga0132255_1015884921 | 3300015374 | Arabidopsis Rhizosphere | IDRYGNRVTPAVATYQLDAAGTLYELHSPQTQLPRLGSPKS* |
| Ga0132255_1028788461 | 3300015374 | Arabidopsis Rhizosphere | DVSPAVAEYSVDPLGSPYEVHSPQTELPRLASPQS* |
| Ga0132255_1050736061 | 3300015374 | Arabidopsis Rhizosphere | DLFGNPVTDAVARYKCDATGSLYELHSPQTEVPKLRPPKT* |
| Ga0134083_105791052 | 3300017659 | Grasslands Soil | VTPTSRDGAPDDAVDAYGNEVTDAVAQYTLDGAGTLYELHSPQVELPRLGSPKS |
| Ga0163161_103069583 | 3300017792 | Switchgrass Rhizosphere | DLYGNEVTDAVATYTFDQSGSLYELHSPQTELPRLGIPKS |
| Ga0187788_102483841 | 3300018032 | Tropical Peatland | SGTENGDSDVDLLGNPVADAVAKYEFDTTGSLYELHSPQTELPRLADPKG |
| Ga0184621_100822813 | 3300018054 | Groundwater Sediment | DDPTDVYGNEVTAAVAKYKFDATGTLYELHSPQTELPRLASPKS |
| Ga0184624_100024851 | 3300018073 | Groundwater Sediment | EDEATDVYGNRVTPAVATYQLDAAGALYELHSPQTQLPRLGSPKS |
| Ga0193725_11247772 | 3300019883 | Soil | NEVTAAVATYKFDATGMLYELHSPQTELPRLASPKS |
| Ga0210381_103965051 | 3300021078 | Groundwater Sediment | FDEADGVLDLYGNEVSDAVARYTLDPAGSLYELHSPQTELPRLGSPKS |
| Ga0126371_125015781 | 3300021560 | Tropical Forest Soil | SPDEPTSTVDLFGNDVSDAVAEYRLDATGSLYEVHSPQTEIPKLASPKS |
| Ga0207685_106598371 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TDLFGNPVTDAVARYKFDATGSLYELHSPQTEVPRLRPPKT |
| Ga0207645_102079223 | 3300025907 | Miscanthus Rhizosphere | GDDASGFTDLYGNEVTDAVATYTFDQSGSLYELHSPQTELPRLGIPKS |
| Ga0207654_102569823 | 3300025911 | Corn Rhizosphere | YGNEVSDAIATYSLDPAGSLYELHSPQTELPRLAEPKS |
| Ga0207646_112468541 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VDLYGNEVTDAIATYSIDPAGSLYELHSPQTEVPRLGSPKS |
| Ga0207686_110376242 | 3300025934 | Miscanthus Rhizosphere | MGNEVTDAVAKYKLDATGSLYETHSPQTELPRLGS |
| Ga0207669_114324631 | 3300025937 | Miscanthus Rhizosphere | SEPGDDASGFTDLYGNEVTDAVATYTFDQSGSLYELHSPQTELPRLGIPKS |
| Ga0207711_102240631 | 3300025941 | Switchgrass Rhizosphere | LYGNEVSDAIATYSLDPAGSLYELHSPQTELPRLAEPKS |
| Ga0207679_108623141 | 3300025945 | Corn Rhizosphere | YGNEVSAAVAKYKLDGRGALYELHSPQTELPQLAPPRS |
| Ga0207677_122874251 | 3300026023 | Miscanthus Rhizosphere | RSDRPDEAAGFTDLYGNEVTDAVATYTFDRSGSLYELHSPQTELPRLGIPKS |
| Ga0209234_10250411 | 3300026295 | Grasslands Soil | NEGTVDLFGNEVTDAVAKYKTDATGSLYELHSPQTELPRLGSPKT |
| Ga0209805_10524623 | 3300026542 | Soil | RPGDEGGVVDLYGNEVSDAIATYSIDPAGSLYELHSPQTEVPRLGSPKS |
| Ga0209814_104496671 | 3300027873 | Populus Rhizosphere | VYGNEVSSAVAQYKLDATGTMYELHSPQTELPRLGSPKS |
| Ga0268265_121539422 | 3300028380 | Switchgrass Rhizosphere | LYGNEVSDAVATYTFDQSGSLYELHSPQTELPRLGIPKS |
| Ga0268264_114331762 | 3300028381 | Switchgrass Rhizosphere | PIDMYGNEVSDAVAKYKLDATGALYELHSPQTEVPRLGAPKG |
| Ga0307309_102012522 | 3300028714 | Soil | DLGRDLTEDEVMDVYGNGITAAVATYKYDATGTLYELHSPQTELPRLASPKS |
| Ga0307504_103541511 | 3300028792 | Soil | APRDEPGGATDLYGNEVTDAVARYTLDPAGSLYELHSPQTELPHLGIPKS |
| Ga0307296_101006481 | 3300028819 | Soil | DLYGNEVSDAVARFKLDDAGSLYEVHSPQTELPRLASPIS |
| Ga0307310_101198041 | 3300028824 | Soil | VDLYGNEVSDAVARYTLDPAGSLYELHSPQTELTRLGSPKS |
| Ga0170818_1091488031 | 3300031474 | Forest Soil | PAPAQLNLTPRDETTDEGAVDLYGNETTDAVARYKLDAEGSLYELHSPRTELPRLGSPKS |
| Ga0310886_104974643 | 3300031562 | Soil | AIDMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS |
| Ga0307469_100188141 | 3300031720 | Hardwood Forest Soil | LYGNVVTDAIATYSIDPAGSLYELHSPQTEVPRLDSPKS |
| Ga0318535_105615262 | 3300031764 | Soil | LYGNDVSDAVAKYSLDATGVLYEVHSPQTEIPRLASPKS |
| Ga0318547_107060772 | 3300031781 | Soil | VDLYGNDVSDAVAKYSLDATGVLYEVHSPQTEIPRLASPKS |
| Ga0310892_112162281 | 3300031858 | Soil | SQPPSAGDDADDADADVLGNPVSDAVAKYKFDATGSLYELHSPQTELPRLADPKS |
| Ga0310900_113092011 | 3300031908 | Soil | DPDREEGPADLFGNPVTDAVARYKFDATGSLYELHSPQTEVPKLRPPKT |
| Ga0306923_118706061 | 3300031910 | Soil | MIDLYGNDVTAAVAKYSIDATGSLYEVHSPQTEIPKLGSPKT |
| Ga0310902_101770663 | 3300032012 | Soil | DMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS |
| Ga0310906_108273012 | 3300032013 | Soil | DEAIDMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS |
| Ga0310890_112239171 | 3300032075 | Soil | EDEAIDMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS |
| Ga0306924_102638701 | 3300032076 | Soil | DTDRDGMIDLYGNDVTAAVAKYSIDATGSLYEVHSPQTEIPKLGSPKT |
| Ga0307470_107332762 | 3300032174 | Hardwood Forest Soil | EIDLYGNDVSDAVAKYKLDSDGSLYELHSPQTQLPHLGSSKT |
| Ga0307472_1022267602 | 3300032205 | Hardwood Forest Soil | LYGNEVTDAVATYTFDKSGSLYELHSPQTELPRLGIPKS |
| Ga0310896_105084401 | 3300032211 | Soil | EAIDMYGNRVTPAVATYQLDDAGTLYELHSPQTQLPRLGSPKS |
| Ga0310896_108897031 | 3300032211 | Soil | DPDPEEGPADLFGNPVTDAVARYKCDATGSLYELHSPQTEVPKLRPPKT |
| Ga0310812_102135612 | 3300032421 | Soil | GSSDLFGNEISDAVARYTLDETGALYEVHSPETELPRLTSPVG |
| Ga0310812_102518173 | 3300032421 | Soil | DEVIDVYGNRVTPAVATYQLDAAGTLYELHSPQTQLPRLGSPKS |
| Ga0310810_101185881 | 3300033412 | Soil | AVDGAVDLYGNEVNDAFATYSLDPGGSLYEVHSPQTELPRLGSPKS |
| Ga0364945_0264628_390_530 | 3300034115 | Sediment | GASGFTDLYGNEITDAIATYTFDRSGSLYELHSPQTEIPRLGSPKS |
| ⦗Top⦘ |