NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090432

Metagenome / Metatranscriptome Family F090432

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090432
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 105 residues
Representative Sequence MGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMKEHFPVWWSSVSGNLHANGYSLPEMNEYDKSTSIQNSHTQFDK
Number of Associated Samples 95
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 33.64 %
% of genes near scaffold ends (potentially truncated) 34.26 %
% of genes from short scaffolds (< 2000 bps) 96.30 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.148 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater
(16.667 % of family members)
Environment Ontology (ENVO) Unclassified
(53.704 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(61.111 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 48.06%    β-sheet: 0.00%    Coil/Unstructured: 51.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF00005ABC_tran 0.93
PF01529DHHC 0.93
PF00224PK 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.07 %
UnclassifiedrootN/A0.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000130|SA_S2_NOR15_50mDRAFT_c10242186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae557Open in IMG/M
3300003909|JGI26087J52781_1031021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae568Open in IMG/M
3300005528|Ga0068872_10668698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae547Open in IMG/M
3300005662|Ga0078894_11694732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae519Open in IMG/M
3300005941|Ga0070743_10198924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae658Open in IMG/M
3300006641|Ga0075471_10357607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae737Open in IMG/M
3300006803|Ga0075467_10538405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae599Open in IMG/M
3300007177|Ga0102978_1294188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2683Open in IMG/M
3300007513|Ga0105019_1005334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida13904Open in IMG/M
3300007554|Ga0102820_1091366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae731Open in IMG/M
3300007667|Ga0102910_1053917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae921Open in IMG/M
3300008108|Ga0114341_10445023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae608Open in IMG/M
3300008111|Ga0114344_1251405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae510Open in IMG/M
3300008114|Ga0114347_1207878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae644Open in IMG/M
3300008262|Ga0114337_1086702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2223Open in IMG/M
3300008929|Ga0103732_1049237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae645Open in IMG/M
3300009002|Ga0102810_1096020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae925Open in IMG/M
3300009026|Ga0102829_1183891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae676Open in IMG/M
3300009050|Ga0102909_1169002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae524Open in IMG/M
3300009071|Ga0115566_10320155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae910Open in IMG/M
3300009071|Ga0115566_10647693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae589Open in IMG/M
3300009263|Ga0103872_1012669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae906Open in IMG/M
3300009434|Ga0115562_1168196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae805Open in IMG/M
3300009436|Ga0115008_10595597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae796Open in IMG/M
3300009436|Ga0115008_10944895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae640Open in IMG/M
3300009441|Ga0115007_10371824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae933Open in IMG/M
3300009442|Ga0115563_1190626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae794Open in IMG/M
3300009505|Ga0115564_10262400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae876Open in IMG/M
3300009505|Ga0115564_10284136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae833Open in IMG/M
3300009508|Ga0115567_10474413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae763Open in IMG/M
3300009526|Ga0115004_10330953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum903Open in IMG/M
3300009593|Ga0115011_11789307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae554Open in IMG/M
3300009599|Ga0115103_1167225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae513Open in IMG/M
3300009599|Ga0115103_1797270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae653Open in IMG/M
3300009705|Ga0115000_10434490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum833Open in IMG/M
3300012412|Ga0138266_1136866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae677Open in IMG/M
3300012414|Ga0138264_1067817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae503Open in IMG/M
3300012504|Ga0129347_1236742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae676Open in IMG/M
3300012952|Ga0163180_11380310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae583Open in IMG/M
3300012965|Ga0129346_1053812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae619Open in IMG/M
3300012968|Ga0129337_1461297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae625Open in IMG/M
3300013014|Ga0164295_11383121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae546Open in IMG/M
3300016723|Ga0182085_1342662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae563Open in IMG/M
3300016732|Ga0182057_1021112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae540Open in IMG/M
3300017957|Ga0181571_10918110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae515Open in IMG/M
3300018413|Ga0181560_10309145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae738Open in IMG/M
3300018418|Ga0181567_10919696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae549Open in IMG/M
3300018426|Ga0181566_10601164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae764Open in IMG/M
3300018426|Ga0181566_10818759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae634Open in IMG/M
3300018758|Ga0193058_1066680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae570Open in IMG/M
3300018874|Ga0192977_1114714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae527Open in IMG/M
3300018980|Ga0192961_10163821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae675Open in IMG/M
3300019032|Ga0192869_10349994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae645Open in IMG/M
3300019048|Ga0192981_10186586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae813Open in IMG/M
3300019048|Ga0192981_10222772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae730Open in IMG/M
3300019048|Ga0192981_10370571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae516Open in IMG/M
3300019050|Ga0192966_10268046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae605Open in IMG/M
3300019103|Ga0192946_1040957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300019123|Ga0192980_1050157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae796Open in IMG/M
3300019266|Ga0182061_1409232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae556Open in IMG/M
3300019276|Ga0182067_1480803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae513Open in IMG/M
3300021336|Ga0210307_1067172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum701Open in IMG/M
3300021336|Ga0210307_1160942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae792Open in IMG/M
3300021378|Ga0213861_10349533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae742Open in IMG/M
3300021927|Ga0063103_1022255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae642Open in IMG/M
3300021962|Ga0222713_10120475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1850Open in IMG/M
3300021962|Ga0222713_10495978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae731Open in IMG/M
(restricted) 3300023276|Ga0233410_10289088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae534Open in IMG/M
3300025508|Ga0208148_1117170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae553Open in IMG/M
3300025690|Ga0209505_1137204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae661Open in IMG/M
3300025809|Ga0209199_1162292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae820Open in IMG/M
3300025849|Ga0209603_1186618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae805Open in IMG/M
3300027159|Ga0208020_1017762All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae1402Open in IMG/M
3300027188|Ga0208921_1036603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae731Open in IMG/M
3300027769|Ga0209770_10313794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae595Open in IMG/M
3300027810|Ga0209302_10208220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae933Open in IMG/M
3300031469|Ga0170819_12119531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae654Open in IMG/M
3300031522|Ga0307388_10673068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300031523|Ga0307492_10260538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae634Open in IMG/M
3300031569|Ga0307489_10276852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1075Open in IMG/M
3300031626|Ga0302121_10205748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae558Open in IMG/M
3300031710|Ga0307386_10742773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae527Open in IMG/M
3300031729|Ga0307391_10540153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300031729|Ga0307391_10908274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae508Open in IMG/M
3300031737|Ga0307387_10882013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae567Open in IMG/M
3300031743|Ga0307382_10392973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300031750|Ga0307389_10619765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum701Open in IMG/M
3300031758|Ga0315907_10673713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae791Open in IMG/M
3300032470|Ga0314670_10485721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae645Open in IMG/M
3300032470|Ga0314670_10514839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae624Open in IMG/M
3300032481|Ga0314668_10381702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum728Open in IMG/M
3300032518|Ga0314689_10519943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae621Open in IMG/M
3300032519|Ga0314676_10624833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300032519|Ga0314676_10712510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae585Open in IMG/M
3300032521|Ga0314680_10929042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae546Open in IMG/M
3300032615|Ga0314674_10551537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae592Open in IMG/M
3300032616|Ga0314671_10551805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae625Open in IMG/M
3300032650|Ga0314673_10377524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300032651|Ga0314685_10445091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum716Open in IMG/M
3300032666|Ga0314678_10469511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae567Open in IMG/M
3300032708|Ga0314669_10678641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae565Open in IMG/M
3300032724|Ga0314695_1246374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum685Open in IMG/M
3300032746|Ga0314701_10427017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae599Open in IMG/M
3300032747|Ga0314712_10450782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae609Open in IMG/M
3300032747|Ga0314712_10505002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300032752|Ga0314700_10530814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum625Open in IMG/M
3300034167|Ga0335017_0487590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae654Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater16.67%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.81%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine11.11%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine9.26%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine8.33%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh8.33%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.48%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.70%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.85%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.85%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.85%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.93%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.93%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.93%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.93%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.93%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.93%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.93%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.93%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.93%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.93%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300003909Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_DNAEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018758Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782363-ERR1712059)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019276Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SA_S2_NOR15_50mDRAFT_1024218613300000130MarineMGPIVKSATHGWMLRFPVALTIATFLGVQASAWERQNKAFHDLVSQPAPHGSYLRKSMREHFPVWWSDVSSNLHSNGYSLPEMNEYDKSTT
JGI26087J52781_103102123300003909MarineMCFPLMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMREHFPVWWSSVSANLYANGYSLPEMNEYDKS
Ga0068872_1066869823300005528Freshwater LakeKSALHGWMLRFPVAMTFATFLGVQASNWQRPSKTFHEIMSQPAPHGSYLRRSIKEHFPVWWNDVSGQLHTNGYSLPEMPQYDKSTEI*
Ga0078894_1169473213300005662Freshwater LakeVAHVLFGWALTYPLMGPIVKSSLHGWMLRFPVAMTFATFLGVQASNWQRPSKTFHEIMSQPAPHGSYLRRSLKEHFPVWWNDVSGQLHTNGYSLPEMPQYDK*
Ga0070743_1019892423300005941EstuarineMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMREHFPVWWSSVSANLYANGYSLPEMNEYDKSTSIQNSHTQFDK*
Ga0075504_139174513300006383AqueousMGPIVRSATHGWLLRFPISVSIALFFGVQAANWQRPSDAFHELMAQPAPHGSYLRRSLREHFPVWWYNVSKQMHAQGLSLPEMNEYD
Ga0075471_1035760713300006641AqueousMFRLPIAVTFAQFLGVQASAWERPNDIFTNIMAQPAPHGSYLRKTVKEHFPVWWNNVSADLHLSGHNLPEMNEYDKSIHIQNDHTKFDKTIL*
Ga0075467_1053840523300006803AqueousGWGLTFPFMGPIVKSATHGWYLRLPVALTFASFLGVQASSWERPSKAFHDLMAQPAPHGSYLRRSVKEHFPVWWNSVSANLHSNGHSLPEMNEYDKSTTIQNTHTKFNNQLL*
Ga0102978_129418863300007177Freshwater LakeMGPIVRSSAHGWYLRFPVTLTIATFMSVQASNWQRPNKIFHEIVSQPAPHGSYLRRTLKEHFPVWWHETSGQLHANGLSLPEMHEYDKAVLMPKSYNNFNT*
Ga0105019_1005334143300007513MarineMRPIVRGAFHGWTLRVSVALTFSAFLGVQASAWERSSTTFHDLASQPAPLGSYLRRTLREHFPVWWSSVSALHANEYSLPEMNECDKGTIIQKPHTGFDAKILRREPNRIVIARRPSR*
Ga0102820_109136613300007554EstuarineMTFPMMGPIVRSATHGWMLRLPVALSFATFLGVQASTWERPNNTFHDLVCQPAPHGSYVRKTLKEHFPVWWNSVSANLHKNGYSLPEMNEYDKATQIQNSHTAFDSTIM*
Ga0102910_105391723300007667EstuarineMCFPLMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMREHFPVWWSSVSANLYANGYSLPEMNEYDKSTSIQNSHTQFDK*
Ga0114341_1044502313300008108Freshwater, PlanktonMLRLPFALSFGTFLGVQASTWERPNKTFHELVSQPAPHGSYLRKSIREHFPVWWNQVSEDLYKCGYNLPEMNEYDKATTIQVSHTQFDNQIL*
Ga0114344_125140513300008111Freshwater, PlanktonMLRLPFALSFGTFLGVQASTWERPNKTFHELVSQPAPHGSYLRKSIREHFPVWWNQVSEDLYKCGYNLPEMNEYDKATTIQVSHTQF
Ga0114347_120787813300008114Freshwater, PlanktonMLRLPFALSFGTFLGVQASTWERPNKTFHELVSQPAPHGSYLRKSIREHFPVWWNQVSEDLYKCGYNLPEMNEYDKATTIQVS
Ga0114337_108670213300008262Freshwater, PlanktonALTYPLMGPIVKSALHGWMLRFPVAMTFATFLGVQASNWQRPSKTFHEIMSQPAPHGSYLRRSIKEHFPVWWNDVSGQLHTNGYSLPEMPQYDKSTEI*
Ga0103732_104923713300008929Ice Edge, Mcmurdo Sound, AntarcticaMLVGWGLCFPLMGPIVRSATHGWMLRLPVALTFGTFLSVQASAWERPNSTFHDVVTQPAPHGSYLRRTLKEHFPVWWANISADLNDNGYSLPEMNEYDKSTTIQRTHTQFDNQII*
Ga0102810_109602013300009002EstuarineMGPVVRNSTHGWMLRLPAALSIATFLGVQASAWERPNKTFHEIMAQPAPHGSYLRRSLKEHFPIWWNNVSSDLHTNGHSLPEMNEYDKSIAIQNTHTRFDTTIM*
Ga0102829_118389113300009026EstuarineLAHTAVGWALSVLLMGPVVRNSTHGWMLRLPAALSIATFLGVQASAWERPNKTFHEIMAQPAPHGSYLRRSLKEHFPIWWNNVSSDLHTNGHSLPEMNEYDKSIAIQNTHTRFDTTIM*
Ga0102909_116900213300009050EstuarineMCFPLMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMTEHFPVWWSSVSANLYANGYSLPEMNEYDKSTSIQNSHTQFDK*
Ga0115566_1032015523300009071Pelagic MarineMCFPLMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMKEHFPVWWSSVSGNLHANGYSLPEMNEYDKSTSIQNSHTQFDK*
Ga0115566_1064769313300009071Pelagic MarineMGPIVKNMAHGMMLRLPVALTFASFLGVQASAWERPNKCFHDIVSQPAPHGSYMRRTLKEHFPVWWNEISKDLHQAGYSLPEMNEYDKSTVIQKSHTVFDNMVL*
Ga0103872_101266913300009263Surface Ocean WaterMGPIVKSATHGWMLRLPVALTIATFLGVQASAWERPNKAFHDLVSQPAPHGSYLRKSMREHFPVWWSQVSANLHANGYSLPEMNEYDKSTTI*
Ga0115562_116819623300009434Pelagic MarineMLVFPLMGPIVKGAAHGWMLRLPPTLTVATFLGVQAAAWERPSKTFHDIVTQPAPHGSYLRRSIKEHFPIWWNSISTDLHGNGYSLPEMNEYDKSTTIQNSHTQFDSAIL*
Ga0115008_1059559723300009436MarineLQELSGQFAAHTLIGYMLVFPLMGPIVKGAAHGWMLRLPPTLTIATFLGVQAAAWERPSKTFHDLVSQPAPHGSYLRRSLKEHFPVWWNSISADLNNNGYSLPEMNEYDKSTDIQKSHTQFDSQIL*
Ga0115008_1094489513300009436MarineMLKLPATVTFATFLGVQASAWERPSKTFHELVSQPAPHGSYVRKSLKEHFPVWWSSVSGNLHKNGYSLPEMNEYDKSTKIQNSHTEFDSLIL*
Ga0115007_1037182423300009441MarineMAHSVFGYLAAYVTMGGLVRGHAYSRHLRLPVAMTYATFLAVQASAWERPNKTFHDLVSQPAPHGSYYRKTLKEHFPVWWHEISDNLYKNGYNLPEMAEYDKSTEIQRSHSQFDDQVL*
Ga0115563_119062623300009442Pelagic MarineMLKLPATVTFATFLGVQASAWERPSKTFHELVSQPAPHGSYVRKSLKEHFPVWWSSVSGNLHKNGYSLPEMNEYDKSTKIQNTHTEFDSQIL*
Ga0115564_1026240013300009505Pelagic MarineMGPLVKSAAHSWMLKLPATVTFATFLGVQASAWERPSKTFHELVSQPAPHGSYVRKSLKEHFPVWWSSVSGNLHQNGYSLPEMNEYDKSTKIQNTHTEFDSQIL*
Ga0115564_1028413613300009505Pelagic MarineMGPLVKSAAHSWMLKLPATVTFATFLGVQASAWERPSKTFHELVSQPAPHGSYVRKSLKEHFPVWWSSVSGNLHKNGYSLPEMNEYDKSTKIQNTHTEFDSQIL*
Ga0115567_1047441313300009508Pelagic MarineMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMKEHFPVWWSSVSGNLHANGYSLPEMNEYDKSTSIQNSHTQFDK*
Ga0115004_1033095333300009526MarineMGPLVRGPAIGWTQRLPVALTIGTFLGVQAAAWERPSTAFHELVSQPAPHGSYLRRTVKEHFPVWWAQVSADLHADGYSLPEMNEYDKSTTIQRSHTQFDNQVL*
Ga0115011_1178930713300009593MarineMFGYGASIVLMGPVIKSATHGWMLRLPSTLVIATFMGVQAANWQRPSKPFHELMSQPAPHGSYLRRSIKEHFPVWWQDTSANLHVNGYSLPQMNEYDKSTSIPKGHTHFDSSRF*
Ga0115103_116722513300009599MarineMGPIVKGAAHGWMLRLPPTLTIATFFGVQAAAWERPSKTFHDLVSQPAPHGSYLRRSLKEHFPVWWNSISSDLNNNGYSLPEMNEYDKSTDIQKSHTQFDSQIL*
Ga0115103_179727013300009599MarineMLVFPLMGPIVKGAAHGWMLRLPPTLTVATFLGVQAAAWERPSKTFHDIVTQPAPHGSYLRRSLKEHFPVWWNSISTDLHANGYSLPEMNEYDKSTTIQNSHTQFDAAIL*
Ga0115000_1043449023300009705MarineVAHSIAGWGLAYLFMGPIVRGPAIGWTQRLPVALTIATFLGVQAAAWERPSTAFHELVSQPAPHGSYLRRTVREHFPVWWAKVSADLHADGYSLPEMNEYDKSTTIQRSHTQFDSQVL*
Ga0138266_113686613300012412Polar MarineMGPIVKGAAHGWMLRLPPTLTIATFLGVQAAAWERPTKTFHDLVSQPAPHGSYLRRSIKEHFPVWWNDISANLNKSGYSLPEMNEYDKSTTIQSSHTQFDSQIL*
Ga0138264_106781713300012414Polar MarineMGPIVKGAAHGWMLRLPPTLTIATFLGVQAAAWERPIKTFHDLVSQPAPHGSYLRRSIKEHFPVWWNDISANLNKSGYSLPEMNEYDKSTTIQSSHTQFDSQIL*
Ga0129347_123674223300012504AqueousMGPIVKSATHGWMLRLPVAITFATFLGVQASDWERPNKTFHELISQPAPHGSYLRKSLREHFPVWWNNCSANLHANGYNLPEMAEYDKSIVIQNTHTEFDSQIL*
Ga0163180_1138031013300012952SeawaterMGGMVRGHAYARHLRLPVALTYATFLSVQAAAWERPNKTFHDLVSQPAPHGSYFRKTLREHFPVWWHSVSANLYKNGYNLPEMPEYDKSTEIQRSHTQFDDQIL*
Ga0129346_105381213300012965AqueousMGPIVKSATHGWMLRLPVAITFATFLGVQASDWERPNRTFHELISQPAPHGSYLRKSLREHFPVWWNNCSANLHANGYNLPEMAEYDKSIVIQNTHTEFDSQIL*
Ga0129337_146129723300012968AqueousMTFPMMGPIVRSATHGWMLRLPVALSFATFLGVQASTWERPNNTFHDLVCQPAPHGSYVRMTLKEHFPVWWNSVSANLHKNGYSLPEMNEYDKATQIQNSHTAFDSTIM*
Ga0164295_1138312113300013014FreshwaterSLHGWMLRFPVAMTFATFLGVQASNWQRPSKTFHEIMSQPAPHGSYLRRSLKEHFPVWWNDVSGQLHTNGYSLPEMPQYDKSVEIQKTHTRFDPSFY*
Ga0182085_134266223300016723Salt MarshMCFPLMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMKEHFPVWWSSVSSNLHANGYSLPEMNEYD
Ga0182057_102111213300016732Salt MarshYEVLKMKALYHKQLQELSGQFAAHSLVGWFICYPLAGPIVKGPHAGWMLRLPFALTFATFLGVQASSWERSNNVFHELISQPAPHGSYLRRSCKEHFPVWWAKVSADLHASGYSLPEMNEYDKATEIQRSHTQFDAQIL
Ga0181571_1091811013300017957Salt MarshMGPIVKSATHGWMLRLPVAITFATFLGVQASDWERPNKTFHELISQPAPHGSYLRKSLREHFPVWWNNCSANLHANGYNLPEMAEYDKSIVIQNTHTEFDS
Ga0181560_1030914513300018413Salt MarshMGPIVKNMAHGMMLRLPVALTFASFLGVQASAWERPNKCFHDIVSQPAPHGSYMRKTLKEHFPVWWNEVSKDLHQAGYSLPEMNEYDKSTVIQKSHTVFDNMVL
Ga0181567_1091969613300018418Salt MarshHKQLQELSGQFAAHSLVGWFICYPLAGPIVKGPHAGWMLRLPFALTFATFLGVQASSWERSNNVFHELISQPAPHGSYLRRSCKEHFPVWWAKVSADLHASGYSLPEMNEYDKATEIQRSHTQFDAQIL
Ga0181566_1060116423300018426Salt MarshMGPIVKSATHGWMLRLPVAITFATFLGVQASDWERPNKTFHELISQPAPHGSYLRKSLREHFPVWWNNCSANLHANGYNLPEMAEYDKSIVIQNTHTEFDSQIL
Ga0181566_1081875913300018426Salt MarshMCFPLMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMKEHFPVWWSSVSSNLHANGYSLPEMNEYDKSTSIQNSHTQFDK
Ga0193058_106668013300018758MarineMFGYGASIVLMGPVIKSATHGWMLRMPSTLVIATFMGVQASNWQRPSKPFHELMRQPAPHGSYLRRSIKEHFPVWWQDTSANLHVNGYSLPQMNEYDKSTSIP
Ga0192977_111471413300018874MarineMGPLVKSAAHSWMLKLPATVTFATFLGVQASAWERPSKTFHELVSQPAPHGSYVRKSLKEHFPVWWSSVSGNLHKNGYSLPEMNEYDKSTKIQNSHTEFDSLIL
Ga0192961_1016382113300018980MarineMGPIIKGASHNWMLRLPPTLTIATFLGVQAAAWERPSKCFHDIVSQPAPHGSYLRRSLKEHFPIWWNSISANLNENGYSLPEMNEYDKSTTIQSSHTQFDSQIL
Ga0192869_1034999423300019032MarineMGKFVKSAAHGWMLRLPPTLTIATFLGVQAAAWERPSKTFHELVSQPAPHGSYLRRSIKEHFPVWWNSISNNLHSNGYSLPEMNEYDKSTSIQNSHTKFD
Ga0192981_1018658623300019048MarineMVKGHAYSRHLRLPVAMTFGTFFACQASSWERPSKAFHDLVSQPAPHGSYFRKSLRENFPVWWHEISTSLHTNGYNLPEMNEYDKSTEIQKSHTQFDS
Ga0192981_1022277223300019048MarineMLCYPLMGPIVKGAAHGWMLRLPPTLTIATFLGVQAAAWERPTKTFHDLVSQPAPHGSYLRRSIKEHFPVWWNDISANLNKSGYSLPEMNEYDKSTTIQSSHTQFDSQIL
Ga0192981_1037057113300019048MarineMAGWFLCFPLMGPLVKSAAHSWMLKLPATVTFATFLGVQASAWERPSKTFHELVSQPAPHGSYVRKSLKEHFPVWWSSVSGNLHKNGYSLPEMNEYDKST
Ga0192966_1026804623300019050MarineMCFPLMGPVVKSAAHGWMLRLAPAISIATFLGVQASAWERPSKTFHELVSQPAPHGSYLRKSLKEHFPVWWNSVSSNLDANGYSLPEMNEYDKSTSIQNTHTEFDSKIM
Ga0192946_104095713300019103MarineVAHSIAGWGLAYLFLGPIVRGPAIGWTQRLPVALTIATFLGVQAAAWERPSTAFHELVSQPAPHGSYLRRTVREHFPVWWAQVSADLHADGYSLPEMNEYDKSTTIQRSHTQFDSQVL
Ga0192980_105015713300019123MarineMGGMVKGHAYSRHLRLPVAMTFGTFFACQASSWERPSKAFHDLVSQPAPHGSYFRKSLRENFPVWWHEISTSLHTNGYNLPEMNEYDKSTEIQKSHTQFDS
Ga0182061_140923223300019266Salt MarshMCFPLMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMKEHFPVWWSSVSSNLHANGYSLPEMNE
Ga0182067_148080313300019276Salt MarshMCFPLMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMKEHFPVWWSSVSSNLHANGYSLPEMNEYDKS
Ga0210307_106717213300021336EstuarineMVGWALVFPIMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERPNKAFHDLMSQPAPHGSYLRKTMREHFPVWWSDVSANLHSNGYSLPEMNEYDKSTLIQNSHTQFDK
Ga0210307_116094223300021336EstuarineMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMREHFPVWWSSVSANLYANGYSLPEMNEYDKSTSIQNSHTQFDK
Ga0213861_1034953313300021378SeawaterMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMKEHFPVWWSSVSGNLHANGYSLPEMNEYDKSTSIQNSHTQFDK
Ga0063103_102225523300021927MarineMGPIVKGAAHGWMLRLPPTLTIATFLGVQAAAWERPSKTFHDLVSQPAPHGSYLRRSIKEHFPIWWNSISGELNENGYSLPEMNEYDKSTTIQNSHTQFDSSIL
Ga0222713_1012047523300021962Estuarine WaterMGPIVKSATHGWYLRLPVALTFATFLGVQASAWERPSKAFHDLMAQPAPHGSYLRRTVKEHFPVWWNSVSSNLHSNGYSLPEMNEYDKSTMIQNNHTAFNNKLQ
Ga0222713_1049597813300021962Estuarine WaterMMGPIVRSATHGWMLRLPVALSFATFLGVQASTWERPNNTFHDLVCQPAPHGSYVRKTLKEHFPVWWNSVSANLHKNGYSLPEMNEYDKATQIQNSHTAFDSTIM
(restricted) Ga0233410_1028908813300023276SeawaterGPIVRGATNGWMLRFPFALSFATFLGVQASAWERPSQAFHDLVSQPAPHGSYLRRTLREHFPVWWSSVSSSLHTSGYSLPEMNEYDKATTIQKSHTQFDSQIL
Ga0208148_111717013300025508AqueousIGWGLTFPFMGPIVKSATHGWYLRLPVALTFASFLGVQASSWERPSKAFHDLMAQPAPHGSYLRRSVKEHFPVWWNSVSANLHSNGHSLPEMNEYDKSTTIQNTHTKFNNQLL
Ga0209505_113720413300025690Pelagic MarineMCFPLMGPIVKSATHGWMLRFPVALTIATFLGVQASSWERQNKAFHDLVSQPAPHGSYLRKSMKEHFPVWWSSVSGNLHANGYSLPEMNEYDKSTSIQNSH
Ga0209199_116229223300025809Pelagic MarineMGPLVKSAAHSWMLKLPATVTFATFLGVQASAWERPSKTFHELVSQPAPHGSYVRKSLKEHFPVWWSSVSGNLHQNGYSLPEMNEYDKSTKIQNTHTEFDSQIL
Ga0209603_118661823300025849Pelagic MarineMGPIVKGAAHGWMLRLPPTLTVATFLGVQAAAWERPSKTFHDIVTQPAPHGSYLRRSIKEHFPIWWNSISTDLHGNGYSLPEMNEYDKSTTIQNSHTQFDSAIL
Ga0208020_101776223300027159EstuarineMGPVVRNSTHGWMLRLPAALSIATFLGVQASAWERPNKTFHEIMAQPAPHGSYLRRSLKEHFPIWWNNVSSDLHTNGHSLPEMNEYDKSIAIQNTHTRFDTTIM
Ga0208921_103660323300027188EstuarineMTFPMMGPIVRSATHGWMLRLPVALSFATFLGVQASTWERPNNTFHDLVCQPAPHGSYVRKTLKEHFPVWWNSVSANLHKNGYSLPEMNEYDKATQIQNSHTAFDSTIM
Ga0209770_1031379413300027769Freshwater LakeGLTYPLMGPIVKSHMHGWMLRFPVAMTVATFLGVQASNWQRPSKVFHEIMSQPAPHGSYLRRSIKEHFPVWWNDVSAQLDMNGYSLPEMPQYDKTTEIPKTHTRFDPSFY
Ga0209302_1020822023300027810MarineMAHSVFGYLAAYVTMGGLVRGHAYSRHLRLPVAMTYATFLAVQASAWERPNKTFHDLVSQPAPHGSYYRKTLKEHFPVWWHEISDNLYKNGYNLPEMAEYDKSTEIQRSHS
Ga0170819_1211953113300031469Forest SoilMGYGISFFAMGPIIRASHHGYWLRFPTAIAIATFLGVNGSIRKRPNQTFHEIMAQPAPHGSYLRRSLKEHFPVWWNDVSRDLNENGYSLPEMNEYDKRTEIQMTHTTFDDSFY
Ga0307388_1067306823300031522MarineMGAKVKGHAYSRHMRLPVAFSFATFLAVQSSSWERPNRTFHDLVSQPAPHGSYYRKTLRENFPVWWHTVSANLYENGYNLPEMNEYDKSTEIQKSNTQFDNSIL
Ga0307492_1026053823300031523Sea-Ice BrineLQELSGQFVAHTLVGYLLAYPLMGPIVKGAAHGWMLRLPPTLTIATFLGVQAAAWERPSKTFHDLVSQPAPHGSYLRRSIKEHFPIWWNAISGDLHSNGYSLPEMNEYDKSTTIQTSHTQFDGQIL
Ga0307489_1027685233300031569Sackhole BrineMVGWALCFPLMGPIVKSATHGWFLRFPVALTIATFLGVQASSWERPNKTFHDLMSQPAPHGSYLRKSMKEHFPVWWNEVSANLHFNGYSLPEMNEYDKSISIQSSHTQFDK
Ga0302121_1020574813300031626MarineMLVFPLMGPIVKGAAHGWMLRLPPTLTIATFLGVQAAAWERPSKTFHDLVSQPAPHGSYLRRSLKEHFPVWWNSISADLNNNGYSLPEMNEYDKSTDIQKSHTQFDSQIL
Ga0307386_1074277313300031710MarineMLCYPLMGPIVKGAAHGWMLRLPPTLTIATFLGVQAAAWERPSKTFHDLVSQPAPHGSYLRRSLKEHFPVWWNSISSDLNNNGYSLPEMNEYDK
Ga0307391_1054015313300031729MarineVAHSIAGWGLAYLFLGPIVRGPAIGWTQRLPVALTIATFLGVQAAAWERPSTAFHELVSQPAPHGSYLRRTVREHFPVWWAQVSADLHADGYSLPEMNEYDNSTTIQRSHTQFDSQVL
Ga0307391_1090827423300031729MarineMVGWAFCFLFMGKVVKSSVHGWMLRGPPAVCFATFLGVQAAAWERPGTVWNDIMTQPAPHGTYVRKSVKEHFPVWWNNISADLHTSGHSLPEMNEYDKSTTIQRSHTEFDATIA
Ga0307387_1088201323300031737MarineMGAKVKGHAYSRHMRLPVAFSFATFLAVQSSSWERPNRTFHDLVSQPAPHGSYFRKSLRENFPVWWHTVSANLYENGYNLPEMNEYDKS
Ga0307382_1039297313300031743MarineVAHSIAGWGLAYLFLGPIVRGPAIGWTQRLPVALTIATFLGVQAAAWERPSTAFHELVSQPAPHGSYLRRTVREHFPVWWAQVSADLHADGYSLPEMNEYDKSTTIQRSHTQFDS
Ga0307389_1061976523300031750MarineMGAKVKGHAYSRHMRLPVAFSFATFLAVQSSSWERPNRTFHDLVSQPAPHGSYFRKSLRENFPVWWHTVSANLYENGYNLPEMNEYDKSTEIQKSNTQFDNSIL
Ga0315907_1067371313300031758FreshwaterMLRLPFALSFGTFLGVQASTWERPNKTFHELVSQPAPHGSYLRKSIREHFPVWWNQVSEDLYKCGYNLPEMNEYDKATTIQVSHTQFDNQIL
Ga0314670_1048572113300032470SeawaterMAGWGLAYLFMGPLVRGPAIGWTQRLPVALTIATFLGVQAAAWERPSTAFHELVSQPAPHGSYLRKTVREHFPVWWAQVSADLHADGYSLPEMNEYDKSTTIQRSHTQFDSQVL
Ga0314670_1051483933300032470SeawaterMAGWFLCFPLMGPLVKSAAHSWMLKLPATVTFATFLGVQASAWERPSKTFHELVSQPAPHGSYVRKSLKEHFPVWWSSVSGNLHKNGYSLPEMNEYDKSTKIQNSHTEFDSLI
Ga0314668_1038170213300032481SeawaterVAHSMAGWGLAYLFMGPLVRGPAIGWTQRLPVALTIATFLGVQAAAWERPSTAFHELVSQPAPHGSYLRKTVREHFPVWWAQVSADLHADGYSLPEMNEYDKSTTIQRSHTQFDSQVL
Ga0314689_1051994323300032518SeawaterMGPIVKGAAHGWMLRLPPTLTVATFLGVQAAAWERPSKTFHDIVTQPAPHGSYLRRSIKEHFPIWWNSISTDLHGNGYSLPEMNEYDKSTTIQNSHTQFDS
Ga0314676_1062483323300032519SeawaterMAGWGLAYLFMGPLVRGPAIGWTQRLPVALTIATFLGVQAAAWERPSTAFHELVSQPAPHGSYLRKTVREHFPVWWAQVSADLHADGYSLPEMNEYDKSTTIQRSHTQFD
Ga0314676_1071251023300032519SeawaterMAGWLLCFPLMGPLVKSAAHSWMLKLPATVTFATFLGVQASAWERPSKTFHELVSQPAPHGSYVRKSLKEHFPVWWSSVSGNLHKNGYSLPEMNEYDKS
Ga0314680_1092904223300032521SeawaterMAGWFLCFPLMGPLVKSAAHSWMLKLPATVTFATFLGVQASAWERPSKTFHELVSQPAPHGSYVRKSLKEHFPVWWSSVSENLHKNGYSLPEMNEYDKSTKIQNSHTEFDSLIL
Ga0314674_1055153723300032615SeawaterMLKLPATVTFATFLGVQASAWERPSKTFHELVSQPAPHGSYVRKSLKEHFPVWWSSVSGNLHKNGYSLPEMNEYDKSTKIQNSHTEFDSLIL
Ga0314671_1055180513300032616SeawaterMAGWFLCFPLMGPLVKSAAHSWMLKLPATVTFATFLGVQASAWERPSKTFHELVSQPAPHGSYVRKSLKEHFPVWWSSVSGNLHKNGYSLPEMNEYDKSTKIQNSHTEFDSLIL
Ga0314673_1037752423300032650SeawaterVAHSMAGWGLAYLFMGPLVRGPAIGWTQRLPVALTIATFLGVQAAAWERPSTAFHELVSQPAPHGSYLRKTVREHFPVWWAQVSADLHADGYSLPEMNEYDKSTTIQRSHTQFDYQVL
Ga0314685_1044509123300032651SeawaterVAHSMAGWGLAYLFMGPLVRGPAIGWTQRLPVALTIATFLGVQAAAWERPSTAFHELVSQPAPHGSYLRKTVREHFPVWWAQVSAYLHADGYSLPEMNEYDKSTTIQRSHTQFDSQVL
Ga0314678_1046951113300032666SeawaterMAGWFLCFPLMGPLVKSAAHSWMLKLPATVTFATFLGVQASAWERPSKTFHELVSQPAPHGSYVRKSLKEHFPVWWSSVSGNLHKNGYSLPEMNEYDKSTKIQNTHTEFDSQIL
Ga0314669_1067864113300032708SeawaterMLVFPLMGPILKGAAHGWMLRLPPTLTVATFLGVQAAAWERPSKTFHDIVTQPAPHGSYLRRSIKEHFPIWWNSISTDLHGNGYSLPEMNEYDK
Ga0314695_124637413300032724SeawaterMGPLVRGPAIGWTQRLPVALTIATFLGVQAAAWERPSTAFHELVSQPAPHGSYLRKTVREHFPVWWAQVSADLHADGYSLPEMNEYDKSTTIQRSHTQFDSQVL
Ga0314701_1042701713300032746SeawaterMLVFPLMGPIVKGAAHGWMLRLPPTLTVATFLGVQAAAWERPSKTFHDIVTQPAPHGSYLRRSIKEHFPIWWNSISTDLHGNGYSLPEMNEYDKSTTIQNSHTQFD
Ga0314712_1045078223300032747SeawaterMGPIVKGAAHGWMLRLPPTLTVATFLGVQAAAWERPSKTFHDIVTQPAPHGSYLRRSIKEHFPIWWNSISTDLHGNGYSLPEMNEYDKSTTIQNSHTQFD
Ga0314712_1050500223300032747SeawaterVAHSMAGWGLAYLFMGPLVRGPAIGWTQRLPVALTIATFLGVQAAAWERPSTAFHELVSQPAPHGSYLRKTVREHFPVWWAQVSADLHADGYSLP
Ga0314700_1053081423300032752SeawaterMGPLVRGPAIGWTQRLPVALTIATFLGVQAAAWERPSTAFHELVSQPAPHGSYLRRTVKEHFPVWWAQVSADLHADGYSLPEMNEYDKSTTIQRSHT
Ga0335017_0487590_381_6533300034167FreshwaterMGPIVRSSAHGWYLRFPVTLTIATFMSVQASNWQRPNRIYHEIVSQPAPHGSYLRRSLKEHFPVWWHETSAQLNANGINLPEMHEYDKAVL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.