Basic Information | |
---|---|
Family ID | F090381 |
Family Type | Metagenome |
Number of Sequences | 108 |
Average Sequence Length | 45 residues |
Representative Sequence | MNQWVEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIIK |
Number of Associated Samples | 80 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 77.78 % |
% of genes near scaffold ends (potentially truncated) | 22.22 % |
% of genes from short scaffolds (< 2000 bps) | 74.07 % |
Associated GOLD sequencing projects | 75 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (67.593 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.444 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.852 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.185 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.32% β-sheet: 18.92% Coil/Unstructured: 56.76% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF01327 | Pep_deformylase | 53.70 |
PF01503 | PRA-PH | 11.11 |
PF12850 | Metallophos_2 | 4.63 |
PF00303 | Thymidylat_synt | 2.78 |
PF13394 | Fer4_14 | 1.85 |
PF02463 | SMC_N | 1.85 |
PF13476 | AAA_23 | 1.85 |
PF07659 | DUF1599 | 0.93 |
PF04984 | Phage_sheath_1 | 0.93 |
PF00082 | Peptidase_S8 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 53.70 |
COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 2.78 |
COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 67.59 % |
All Organisms | root | All Organisms | 32.41 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.44% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 12.04% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 10.19% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.26% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 7.41% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.48% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.48% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.56% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.63% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.70% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.70% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.85% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.85% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.93% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.93% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.93% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.93% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012347 | Freshwater microbial communities from Fish Creek, Ontario, Canada - S48 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020544 | Freshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020564 | Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027220 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 (SPAdes) | Environmental | Open in IMG/M |
3300027244 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes) | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1091391063 | 3300002408 | Freshwater | MNQWIEEKDGKQYWYQQYSKSEMELLKKYHVAISRMTKLNFDRIIK* |
B570J29032_1092833832 | 3300002408 | Freshwater | MNQWIEEKEGKHYWCQHFSKDELILLKKYHTAINRMTKLDYSRIMK* |
B570J29032_1094213512 | 3300002408 | Freshwater | MNQWVEEKDGKQYWYQQYSKAEMELLKKYHIAISRLTKLNFDRIIK* |
B570J40625_1009038891 | 3300002835 | Freshwater | SMNQWVEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIIK* |
JGI25925J51416_100559792 | 3300003497 | Freshwater Lake | MNQWVEKKGDKWYWFQQYSKAELILLKKYHTAINRMTKLDYSRIIK* |
Ga0063233_102118271 | 3300003986 | Freshwater Lake | MNQWVEEKDGKQYWCQQYSKAEMELLKKYHTAINRMTKLDYSRIIK* |
Ga0065861_11743833 | 3300004448 | Marine | MNQWVEEKDGKQYWYQQYSKAEMELLKKYHEAISRMTKLNFDRIMK* |
Ga0070374_104306192 | 3300005517 | Freshwater Lake | MNQWIEEKDGKQYWCQYFSKDELILLKKYHTAINRMTKLDYSRIIK* |
Ga0068876_100068146 | 3300005527 | Freshwater Lake | MNQWVQKKDDKWYWCQEYSKDEMALLRKYHVTISRMTKLNFDRIVK* |
Ga0068876_101607273 | 3300005527 | Freshwater Lake | MNQWVQKKDDKWYWFQQYSKDEMALLRKYHVAMSRMTKLNFDRIIK* |
Ga0049081_101075532 | 3300005581 | Freshwater Lentic | MNQWVEIRDGKSYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIIK* |
Ga0049081_101191162 | 3300005581 | Freshwater Lentic | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHIAISRLTKLNFDRIIK* |
Ga0049081_101392912 | 3300005581 | Freshwater Lentic | MNQWVEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIIK* |
Ga0049080_100749802 | 3300005582 | Freshwater Lentic | MNQWIEEKDGKQYWCQRYSKAEMELLKKYHVAMSRMTKLNFDRIVK* |
Ga0049082_100232241 | 3300005584 | Freshwater Lentic | SMNQWIEEKDGKQYWCQYFSKDELILLKKYHTAINRMTKLDYSRIIK* |
Ga0049082_100761881 | 3300005584 | Freshwater Lentic | MNQWVEEKDGKQYWYQQYSKAEMKLLKKYHVAISRMTKLNFDRIVK* |
Ga0078894_101757452 | 3300005662 | Freshwater Lake | MNQWVQKKDDKWYWYQQYSKDEMALLRKYRVAISRLTKLNFDRIMK* |
Ga0078894_103039453 | 3300005662 | Freshwater Lake | VNQWVEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIMK* |
Ga0078894_105978203 | 3300005662 | Freshwater Lake | MTQWIEAIDGKQYWCQHFPKDELVLLKKYHSAINRLTKLDYSRIIKWDHA* |
Ga0078894_112579092 | 3300005662 | Freshwater Lake | MNQWVEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIMK* |
Ga0070743_102247812 | 3300005941 | Estuarine | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHVAISRLTKLNFDRIVK* |
Ga0070744_100674313 | 3300006484 | Estuarine | MNQWVEKKDGKYYWYQQFPKNEMKLLKRYHVAMGRMTKLDYSRIIK* |
Ga0070744_100882082 | 3300006484 | Estuarine | MTQWIEEKDGKQYWCQQYSKAEMELLKKYHTAMSRMTKLDYSRIIK* |
Ga0075471_1000046811 | 3300006641 | Aqueous | MNQWVQKKDDKWYWYQEYSKEEVTLLRKYHVAISRMTKLNFDRIVK* |
Ga0102879_10470653 | 3300007549 | Estuarine | MNQWIEEKDGKQYWYQQYSKAEMELLRKYHVAISRMTKLNFDRIVK* |
Ga0102880_10430582 | 3300007550 | Estuarine | MNQWVEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIVK* |
Ga0102828_10982992 | 3300007559 | Estuarine | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHVAISRLTKLNFDRIIK* |
Ga0102917_13037641 | 3300007590 | Estuarine | MNQWVEEKDGKQYWYQQYSKAEMELLKKYHVAISRLTKLNFDRIVK* |
Ga0102919_12411792 | 3300007597 | Estuarine | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHVAISRLTKLNFDR |
Ga0102920_10243652 | 3300007600 | Estuarine | MNQWVEEKDGKQYWYQQYSKAEMELLKKYRVAISRLTKLNFDRIIK* |
Ga0102896_10010211 | 3300007618 | Estuarine | MNQWIEEKDGKQYWYQQYSKAEMELLKKYRVAISRLTKLNFDRIIK* |
Ga0102871_10430601 | 3300007620 | Estuarine | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHVAISRLTKLNFDRI |
Ga0102903_10554192 | 3300007630 | Estuarine | MNQWIEEKDGKQYWCQQYSKAEMELLKKYHTAMSRMTKLDYSRIIK* |
Ga0102867_11530442 | 3300007716 | Estuarine | MNQWVEEKDGKQYWYQQYSKAEMELLKKYHVAISIMTKLNFDRIIK* |
Ga0108970_113073572 | 3300008055 | Estuary | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIIK* |
Ga0114340_10461849 | 3300008107 | Freshwater, Plankton | QWIQKKDDKWYWYQQYSKAEMELLKKYHAAISRMTKLNFDRIIK* |
Ga0114340_10582233 | 3300008107 | Freshwater, Plankton | MNQWVEKKDSKWYWYQQFSRDEMALLRKYHTAISRMTKLNFDRIVK* |
Ga0114340_12298282 | 3300008107 | Freshwater, Plankton | MNQWVQKKDDKWYWFQQYSKDEMALLRKYHVAISRMTKLNFDRIIK* |
Ga0114343_11931262 | 3300008110 | Freshwater, Plankton | MNQWIEEKDGKQYWYQQYSKAEMELLKKYRVAISRMTKLNFDRIMK* |
Ga0114344_11676432 | 3300008111 | Freshwater, Plankton | KKDDKWYWFQQYSKDEMALLRKYHVAISRMTKLNFDRIIK* |
Ga0114346_11053484 | 3300008113 | Freshwater, Plankton | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIMK* |
Ga0114346_11927962 | 3300008113 | Freshwater, Plankton | MNQWVQKKDDKWYWYQEYSKEEMALLRKYHVAMSRMTKLNFDRIVK* |
Ga0114350_11638361 | 3300008116 | Freshwater, Plankton | NQWVQKKDDKWYWCQEYSKDEMALLRKYHVAISRMTKLNFDRIVK* |
Ga0114351_11879751 | 3300008117 | Freshwater, Plankton | KDSKWYWYQQFSRDEMALLRKYHTAISRMTKLNFDRIVK* |
Ga0114355_11441413 | 3300008120 | Freshwater, Plankton | MNQWVQKKDDKWYWCQEYSKDEMALLRKYHVAISRMTKLNFDRIVK* |
Ga0114364_11549802 | 3300008267 | Freshwater, Plankton | VNQWVEEKDGKQYWYQQYSKAEMELLKKYRVAISRMTKLNFDRIMK* |
Ga0102909_10659873 | 3300009050 | Estuarine | EEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIIK* |
Ga0114978_108807852 | 3300009159 | Freshwater Lake | MNQWVEKKDGKYYWYQQFPKNEMKLLKRYRVTIGRMTKLDYSRIIK* |
Ga0114966_102180662 | 3300009161 | Freshwater Lake | MIQWIEEKDGKQYWFQSFSKDELVLLKRYHTAINRMTKLDYSRIIK* |
Ga0114970_1000238914 | 3300009163 | Freshwater Lake | MTQWIEDMDGKQYWCQHFPKDELVLLKKYHSAINRLTKLDYSRIIKWDHA* |
Ga0114970_105623691 | 3300009163 | Freshwater Lake | MTQWVQAIDGKQYWCQSFSKDELVLLKKYHNAISRLTKLD |
Ga0114979_108163581 | 3300009180 | Freshwater Lake | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHVAISRLTKLNFDRIMK* |
Ga0133913_105046092 | 3300010885 | Freshwater Lake | MNQWIEEKDGKQYWCQHFSKDELMLLKKYHTAISRLTKLDYSRIIK* |
Ga0139557_10068312 | 3300011010 | Freshwater | MTQWVEEKDGKQYWCQSFSKDELVLLKKYHTAINRMTKLNYSRIIR* |
Ga0151620_10159652 | 3300011268 | Freshwater | VNQWIEAKEGKWYWFQQFSKAEMELLKKYRVQIGRMTNTNFDRIMK* |
Ga0151620_10393002 | 3300011268 | Freshwater | MNQWVEEKDGKQYWYQQYSKDEMALLRKYRVAISRMTKLNFDRIMK* |
Ga0157142_10083552 | 3300012347 | Freshwater | MNQWVETRDGKSYLYQQFPKAEMELLKKYHKVIGRMLKIDFSRIMK* |
Ga0164293_106919202 | 3300013004 | Freshwater | MNQWIEEKDGKQYWYQQYSKAEMELLRKYHVAISRMTKLNFDRIIK* |
Ga0164292_106214922 | 3300013005 | Freshwater | MNQWVEEKDGKQYWYQQYSKAEMELLRKYHVAISRMTKLNFDRIVK* |
Ga0181358_11350011 | 3300017774 | Freshwater Lake | MNQWVEKKDGKYYWYQQFPKNEMKLLKRYRVTIGRMTKLDYSRIIK |
Ga0181358_11698761 | 3300017774 | Freshwater Lake | DCSMNQWIEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIVK |
Ga0181348_12913002 | 3300017784 | Freshwater Lake | QYWCQQYSKAEMELLKKYHTAINRMTKLDYSRIIK |
Ga0181359_10007267 | 3300019784 | Freshwater Lake | MNQWVEKKGDKWYWFQQYSKAELILLKKYHTAINRMTKLDYSRIIK |
Ga0181359_10056849 | 3300019784 | Freshwater Lake | MNQWIEEKDGKQYWYQQYSKAEMELLRKYHVAISRMTKLNFDRIIK |
Ga0181359_10416462 | 3300019784 | Freshwater Lake | MNQWIEEKDGKQYWCQYFSKDELILLKKYHTAINRMTKLDYSRIIK |
Ga0181359_10701563 | 3300019784 | Freshwater Lake | MNQWVEEKDGKQYWCQQYSKAEMELLKKYHTAINRMTKLDYSRIIK |
Ga0181359_11732183 | 3300019784 | Freshwater Lake | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIVK |
Ga0207193_12321712 | 3300020048 | Freshwater Lake Sediment | VNQWVEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIMK |
Ga0211732_100708211 | 3300020141 | Freshwater | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHTAISRMTKLNFDRIMK |
Ga0211736_106783352 | 3300020151 | Freshwater | MNQWIEEKDGKQYWYQQYSKTEMELLKKYHVPISRMTKLNFDRIIK |
Ga0211734_107904142 | 3300020159 | Freshwater | MNQWVEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIVK |
Ga0211733_110860812 | 3300020160 | Freshwater | MNQWVEEKDGKQYWYQQYSKDEMALLRKYRAAISRMTKLNFDRIMK |
Ga0211731_104740852 | 3300020205 | Freshwater | MNQWVEEKDGKQYWYQQYSKAEMKLLKKYHTAISRMTKLNFDRIMK |
Ga0208091_10152532 | 3300020506 | Freshwater | MNQWVEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIIK |
Ga0207941_10293522 | 3300020539 | Freshwater | MNQWIEEKDGKQYWYQQYSKSEMELLKKYHVAISRMTKLNFDRIIK |
Ga0207937_10597132 | 3300020544 | Freshwater | MNQWVEEKDGKQYWYQQYSKAEMELLKKYHIAISRLTKLNFDRIIK |
Ga0208719_10384451 | 3300020564 | Freshwater | GKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIIK |
Ga0222714_100115792 | 3300021961 | Estuarine Water | MNQWIEEKDGKQYWCQHFLKNELILLKKYHTAINRMTKLDYSRIIK |
Ga0222714_101206533 | 3300021961 | Estuarine Water | MNQWVQKKDDKWYWYQQYSKEEMALLRKYHVAISRMTKLNFDRIIK |
Ga0222714_106543701 | 3300021961 | Estuarine Water | VNQWIEAKEGKWYWFQQFSKAEMELLKKYRVQIGRMTNTNFDRIMK |
Ga0214921_100195993 | 3300023174 | Freshwater | MNQWVEEKDGKQYWYQQYSKAEMELLKKYYVAISRMTKLNFDRIMK |
Ga0244775_100018722 | 3300024346 | Estuarine | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHVAISRLTKLNFDRIVK |
Ga0244775_101379942 | 3300024346 | Estuarine | MTQWIEEKDGKQYWCQQYSKAEMELLKKYHTAMSRMTKLDYSRIIK |
Ga0244775_101566842 | 3300024346 | Estuarine | MNQWVEKKDGKYYWYQQFPKNEMKLLKRYHVAMGRMTKLDYSRIIK |
Ga0208784_10142494 | 3300025732 | Aqueous | MNQWVQKKDDKWYWYQEYSKEEVTLLRKYHVAISRMTKLNFDRIVK |
Ga0208927_10223861 | 3300027220 | Estuarine | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHVAISRLTKLNFDRIIK |
Ga0208173_10681272 | 3300027244 | Estuarine | NQWIEEKDGKQYWYQQYSKAEMELLKKYHVAISRLTKLNFDRIVK |
Ga0209651_100392210 | 3300027581 | Freshwater Lake | DGKQYWCQQYSKAEMELLKKYHTAINRMTKLDYSRIIK |
Ga0208974_10170392 | 3300027608 | Freshwater Lentic | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHIAISRLTKLNFDRIIK |
Ga0208974_11427862 | 3300027608 | Freshwater Lentic | MNQWVEIRDGKSYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIIK |
Ga0209356_10078861 | 3300027644 | Freshwater Lake | MNQWVEKKGDKWYWFQQYSKAELILLKKYHTAINRMTKLDYSR |
Ga0209596_10750632 | 3300027754 | Freshwater Lake | MIQWIEEKDGKQYWFQSFSKDELVLLKRYHTAINRMTKLDYSRIIK |
Ga0209444_102107562 | 3300027756 | Freshwater Lake | MNQWVEKKDGKQYWCQQYSKAEMELLKKYHTAINRMTKLDYSRIIK |
Ga0209990_100116933 | 3300027816 | Freshwater Lake | MNQWVQKKDDKWYWCQEYSKDEMALLRKYHVTISRMTKLNFDRIVK |
Ga0315907_100791362 | 3300031758 | Freshwater | MNQWVQKKDDKWYWFQQYSKDEMALLRKYHVAISRMTKLNFDRIIK |
Ga0315907_101140993 | 3300031758 | Freshwater | MNQWIEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIMK |
Ga0315907_111992191 | 3300031758 | Freshwater | MNQWVQKKDDKWYWFQQYSKDEMALLRKYHVAMSRMTKLNFD |
Ga0315899_109369863 | 3300031784 | Freshwater | MNQWVEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIMK |
Ga0315900_110448481 | 3300031787 | Freshwater | MNQWVEKKDSKWYWYQQFSRDEMALLRKYHTAISRMTKLNFDRIVK |
Ga0315904_106152711 | 3300031951 | Freshwater | MNQWIEEKDGKQYWYQRYSKAEMKLLKKYHIAISRMTKLNFDRIIK |
Ga0315905_105597591 | 3300032092 | Freshwater | MNQWVEEKDGKQYWYQQYSKAEMELLKKYHVAISRMTKLNFD |
Ga0334992_0052418_2209_2316 | 3300033992 | Freshwater | QYWYQQYSKAEMELLKKYHVAISRMTKLNFDRIIK |
Ga0334996_0007892_3465_3605 | 3300033994 | Freshwater | MNQWIEEKDGKQYWCQQYSKAEMELLKKYHVAISRMTKLNFDRIIK |
Ga0334991_0012339_3139_3279 | 3300034013 | Freshwater | MNQWVQKKDDKWYWYQEYSKEEMALLRKYHVAISRMTKLNFDRIMK |
Ga0335005_0681108_401_541 | 3300034022 | Freshwater | MNQWIEEKDGKQYWYQQYSKAEMELLRKYHVAISRMTKLNFDRIVK |
Ga0335020_0006198_49_189 | 3300034082 | Freshwater | MNQWIQEIEGKLYWCQRFSKAEFILLKKYHIAFSRLTKLDYSRILK |
Ga0335031_0013426_5471_5611 | 3300034104 | Freshwater | MTQWIEEKDGKHYWCQRFSKDEIVLLKKYHTAINRLTKLDYTRVIL |
Ga0335031_0140833_298_438 | 3300034104 | Freshwater | MNQWVQKKDDKWYWYQEYSKEEMALLRKYHVAMSRMTKLNFDRIIK |
⦗Top⦘ |