Metagenome / Metatranscriptome Family F090378

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F090378
Family Type	Metagenome / Metatranscriptome
Number of Sequences	108
Average Sequence Length	40 residues
Representative Sequence	YVDTLTITIGAGLTGTESAASGGYKRATITAGTGNVSWA
Number of Associated Samples	93
Number of Associated Scaffolds	108

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	10.28 %
% of genes near scaffold ends (potentially truncated)	76.85 %
% of genes from short scaffolds (< 2000 bps)	83.33 %
Associated GOLD sequencing projects	84
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (46.296 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (30.556 % of family members)
Environment Ontology (ENVO)	Unclassified (75.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (55.556 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 37.31% Coil/Unstructured: 62.69%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.50
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 108 Family Scaffolds
PF01833	TIG	2.78
PF13539	Peptidase_M15_4	1.85
PF04860	Phage_portal	1.85
PF13362	Toprim_3	0.93
PF00041	fn3	0.93
PF05257	CHAP	0.93
PF00145	DNA_methylase	0.93
PF13884	Peptidase_S74	0.93
PF07691	PA14	0.93
PF14279	HNH_5	0.93
PF01844	HNH	0.93
PF04820	Trp_halogenase	0.93
PF05345	He_PIG	0.93

COG ID	Name	Functional Category	% Frequency in 108 Family Scaffolds
COG0270	DNA-cytosine methylase	Replication, recombination and repair [L]	0.93

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	53.70 %
Unclassified	root	N/A	46.30 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	50.00 %
Unclassified	root	N/A	46.30 %
cellular organisms	root	All Organisms → cellular organisms	3.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.30 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	37.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	12.04 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	3.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.30 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	37.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	12.04 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.85 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.30 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	37.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	12.04 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.93 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.30 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	37.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	12.04 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.93 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.30 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	35.19 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	12.04 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.93 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.30 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	35.19 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	12.04 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.93 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002277\|B570J29592_107369	Not Available	509	Open in IMG/M
3300002306\|B570J29618_1003812	Not Available	995	Open in IMG/M
3300004125\|Ga0066182_10138374	Not Available	599	Open in IMG/M
3300005527\|Ga0068876_10091687	All Organisms → Viruses → Predicted Viral	1817	Open in IMG/M
3300005527\|Ga0068876_10391167	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	776	Open in IMG/M
3300005581\|Ga0049081_10313037	Not Available	539	Open in IMG/M
3300005582\|Ga0049080_10048497	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1468	Open in IMG/M
3300005584\|Ga0049082_10205457	Not Available	673	Open in IMG/M
3300005805\|Ga0079957_1047972	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2640	Open in IMG/M
3300005805\|Ga0079957_1303267	Not Available	718	Open in IMG/M
3300005931\|Ga0075119_1115311	Not Available	575	Open in IMG/M
3300006484\|Ga0070744_10075545	Not Available	978	Open in IMG/M
3300006802\|Ga0070749_10452008	Not Available	704	Open in IMG/M
3300006810\|Ga0070754_10048133	Not Available	2270	Open in IMG/M
3300007974\|Ga0105747_1085462	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	971	Open in IMG/M
3300008116\|Ga0114350_1032040	All Organisms → Viruses → Predicted Viral	2070	Open in IMG/M
3300008120\|Ga0114355_1213478	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	606	Open in IMG/M
3300008262\|Ga0114337_1326287	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	534	Open in IMG/M
3300008262\|Ga0114337_1334110	Not Available	524	Open in IMG/M
3300009026\|Ga0102829_1304035	Not Available	531	Open in IMG/M
3300009085\|Ga0105103_10138585	All Organisms → Viruses → Predicted Viral	1281	Open in IMG/M
3300009155\|Ga0114968_10391631	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	760	Open in IMG/M
3300009159\|Ga0114978_10145289	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1532	Open in IMG/M
3300009160\|Ga0114981_10671351	Not Available	549	Open in IMG/M
3300009164\|Ga0114975_10546879	Not Available	621	Open in IMG/M
3300009165\|Ga0105102_10564260	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	625	Open in IMG/M
3300009185\|Ga0114971_10467502	Not Available	709	Open in IMG/M
3300012017\|Ga0153801_1001642	All Organisms → cellular organisms → Bacteria → Proteobacteria	4614	Open in IMG/M
3300012666\|Ga0157498_1000180	Not Available	12555	Open in IMG/M
3300012666\|Ga0157498_1029544	Not Available	849	Open in IMG/M
(restricted) 3300013122\|Ga0172374_1284263	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	587	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10473819	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	693	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10486989	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	820	Open in IMG/M
3300013372\|Ga0177922_10274295	Not Available	684	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10387389	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	807	Open in IMG/M
3300014811\|Ga0119960_1087251	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	559	Open in IMG/M
3300017723\|Ga0181362_1069230	Not Available	718	Open in IMG/M
3300017736\|Ga0181365_1070515	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	862	Open in IMG/M
3300017736\|Ga0181365_1127341	Not Available	609	Open in IMG/M
3300017777\|Ga0181357_1218270	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	674	Open in IMG/M
3300017777\|Ga0181357_1238944	Not Available	635	Open in IMG/M
3300017780\|Ga0181346_1127848	Not Available	968	Open in IMG/M
3300017784\|Ga0181348_1288871	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	553	Open in IMG/M
3300017784\|Ga0181348_1307783	Not Available	528	Open in IMG/M
3300017785\|Ga0181355_1258116	Not Available	666	Open in IMG/M
3300017788\|Ga0169931_10549001	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	799	Open in IMG/M
3300017968\|Ga0181587_11020582	Not Available	505	Open in IMG/M
3300019784\|Ga0181359_1116066	All Organisms → cellular organisms → Bacteria	963	Open in IMG/M
3300020151\|Ga0211736_10579605	Not Available	523	Open in IMG/M
3300020197\|Ga0194128_10515962	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	546	Open in IMG/M
3300020578\|Ga0194129_10353548	Not Available	794	Open in IMG/M
3300022407\|Ga0181351_1224940	Not Available	606	Open in IMG/M
3300024346\|Ga0244775_10513144	Not Available	978	Open in IMG/M
3300024480\|Ga0255223_1044802	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	749	Open in IMG/M
3300025438\|Ga0208770_1078729	Not Available	575	Open in IMG/M
3300025853\|Ga0208645_1107755	Not Available	1139	Open in IMG/M
3300027153\|Ga0255083_1002800	Not Available	4267	Open in IMG/M
3300027581\|Ga0209651_1131133	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	689	Open in IMG/M
3300027608\|Ga0208974_1043463	All Organisms → Viruses → Predicted Viral	1313	Open in IMG/M
3300027631\|Ga0208133_1044294	Not Available	1085	Open in IMG/M
3300027656\|Ga0209357_1042644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1460	Open in IMG/M
3300027659\|Ga0208975_1098339	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	852	Open in IMG/M
3300027679\|Ga0209769_1005118	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4947	Open in IMG/M
3300027688\|Ga0209553_1161018	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	756	Open in IMG/M
3300027689\|Ga0209551_1004829	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4888	Open in IMG/M
3300027746\|Ga0209597_1343884	Not Available	559	Open in IMG/M
3300027772\|Ga0209768_10442449	Not Available	506	Open in IMG/M
3300027816\|Ga0209990_10057760	All Organisms → Viruses → Predicted Viral	1960	Open in IMG/M
3300027969\|Ga0209191_1286474	Not Available	615	Open in IMG/M
3300028025\|Ga0247723_1066494	Not Available	982	Open in IMG/M
(restricted) 3300028553\|Ga0247839_1220503	Not Available	760	Open in IMG/M
(restricted) 3300028557\|Ga0247832_1155078	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	875	Open in IMG/M
3300031224\|Ga0307982_1064903	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1350	Open in IMG/M
3300031857\|Ga0315909_10882155	Not Available	554	Open in IMG/M
3300032342\|Ga0315286_11864512	Not Available	563	Open in IMG/M
3300032462\|Ga0335396_10251071	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1158	Open in IMG/M
3300033233\|Ga0334722_10883495	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	631	Open in IMG/M
3300033978\|Ga0334977_0009317	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5608	Open in IMG/M
3300033979\|Ga0334978_0126194	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1287	Open in IMG/M
3300033981\|Ga0334982_0030823	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3060	Open in IMG/M
3300033981\|Ga0334982_0154979	All Organisms → Viruses → Predicted Viral	1164	Open in IMG/M
3300033981\|Ga0334982_0178012	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1065	Open in IMG/M
3300033994\|Ga0334996_0001568	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	15455	Open in IMG/M
3300033996\|Ga0334979_0107187	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1732	Open in IMG/M
3300033996\|Ga0334979_0411252	Not Available	746	Open in IMG/M
3300034019\|Ga0334998_0085756	All Organisms → Viruses → Predicted Viral	2120	Open in IMG/M
3300034023\|Ga0335021_0066778	All Organisms → Viruses → Predicted Viral	2141	Open in IMG/M
3300034050\|Ga0335023_0620125	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	547	Open in IMG/M
3300034062\|Ga0334995_0171609	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1541	Open in IMG/M
3300034062\|Ga0334995_0174945	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1522	Open in IMG/M
3300034073\|Ga0310130_0053141	Not Available	1210	Open in IMG/M
3300034073\|Ga0310130_0251279	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	557	Open in IMG/M
3300034093\|Ga0335012_0047647	All Organisms → Viruses → Predicted Viral	2486	Open in IMG/M
3300034093\|Ga0335012_0250035	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	919	Open in IMG/M
3300034095\|Ga0335022_0110875	All Organisms → Viruses → Predicted Viral	1739	Open in IMG/M
3300034101\|Ga0335027_0699236	Not Available	602	Open in IMG/M
3300034102\|Ga0335029_0206918	Not Available	1298	Open in IMG/M
3300034103\|Ga0335030_0001586	Not Available	18657	Open in IMG/M
3300034103\|Ga0335030_0505138	Not Available	761	Open in IMG/M
3300034104\|Ga0335031_0283438	All Organisms → Viruses → Predicted Viral	1085	Open in IMG/M
3300034117\|Ga0335033_0436462	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	639	Open in IMG/M
3300034118\|Ga0335053_0723419	Not Available	557	Open in IMG/M
3300034120\|Ga0335056_0106660	All Organisms → Viruses → Predicted Viral	1716	Open in IMG/M
3300034200\|Ga0335065_0397204	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	847	Open in IMG/M
3300034355\|Ga0335039_0060791	All Organisms → Viruses → Predicted Viral	2255	Open in IMG/M
3300034374\|Ga0348335_016588	Not Available	3721	Open in IMG/M
3300034418\|Ga0348337_102167	Not Available	931	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	97.22%
Terrestrial	Environmental → Terrestrial	2.78%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	84.26%
Marine	Environmental → Aquatic → Marine	10.19%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	2.78%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	2.78%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	50.93%
Lentic	Environmental → Aquatic → Freshwater → Lentic	26.85%
Coastal	Environmental → Aquatic → Marine → Coastal	5.56%
Unclassified	Environmental → Aquatic → Marine → Unclassified	2.78%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	2.78%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	2.78%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.85%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	1.85%
River	Environmental → Aquatic → Freshwater → River	1.85%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.85%
Ice	Environmental → Aquatic → Freshwater → Ice	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	49.07%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	25.00%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	5.56%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	2.78%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	2.78%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	2.78%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.85%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	1.85%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.85%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	1.85%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	1.85%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	0.93%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.93%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.93%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	30.56%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	20.37%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	6.48%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	4.63%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	4.63%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	3.70%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	2.78%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	2.78%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.85%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	1.85%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.85%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	1.85%
Freshwater, Surface Ice	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice	1.85%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	1.85%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	1.85%
Saline Lake	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake	1.85%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	1.85%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.93%
Aquatic	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic	0.93%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	0.93%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.93%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.93%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.93%
Saline Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water	0.93%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002277	Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion	Environmental	Open in IMG/M
3300002306	Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion	Environmental	Open in IMG/M
3300004125	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300005931	Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006810	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008120	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA	Environmental	Open in IMG/M
3300008262	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA	Environmental	Open in IMG/M
3300009026	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575	Environmental	Open in IMG/M
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009185	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG	Environmental	Open in IMG/M
3300012017	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m	Environmental	Open in IMG/M
3300012666	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2	Environmental	Open in IMG/M
3300013122 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m	Environmental	Open in IMG/M
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental	Open in IMG/M
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300014720 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m	Environmental	Open in IMG/M
3300014811	Aquatic viral communities from ballast water - Michigan State University - AB_ballast water	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017788	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L	Environmental	Open in IMG/M
3300017968	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020197	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m	Environmental	Open in IMG/M
3300020578	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024480	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025438	Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes)	Environmental	Open in IMG/M
3300025853	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)	Environmental	Open in IMG/M
3300027153	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h	Environmental	Open in IMG/M
3300027581	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027631	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)	Environmental	Open in IMG/M
3300027656	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027679	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)	Environmental	Open in IMG/M
3300027688	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)	Environmental	Open in IMG/M
3300027689	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027746	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027772	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027816	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028553 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m	Environmental	Open in IMG/M
3300028557 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m	Environmental	Open in IMG/M
3300031224	Marine microbial communities from Ellis Fjord, Antarctic Ocean - #989	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300032342	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0	Environmental	Open in IMG/M
3300032462	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)	Environmental	Open in IMG/M
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033979	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034019	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049	Environmental	Open in IMG/M
3300034023	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090	Environmental	Open in IMG/M
3300034050	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034073	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL	Environmental	Open in IMG/M
3300034093	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072	Environmental	Open in IMG/M
3300034095	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034103	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034117	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124	Environmental	Open in IMG/M
3300034118	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165	Environmental	Open in IMG/M
3300034120	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172	Environmental	Open in IMG/M
3300034200	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190	Environmental	Open in IMG/M
3300034355	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135	Environmental	Open in IMG/M
3300034374	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)	Environmental	Open in IMG/M
3300034418	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J29592_1073691	3300002277	Freshwater	VILRYSDSKTITIGAGLTGTESAASGGYKRATXTAGXGNVSWA*
B570J29618_10038124	3300002306	Freshwater	IKYPDNFTITFGGGVTGTESAASGGFKRATITAATAGNVSWA*
Ga0066182_101383741	3300004125	Freshwater Lake	SGVVILRYPDSRTITFGAGVTGTESAASGGYKRATITAATAGNVSWS*
Ga0068876_100916871	3300005527	Freshwater Lake	RYPDNKTITIGAGLTGTESSASGGYKRATITAGTGNVSWA*
Ga0068876_103911671	3300005527	Freshwater Lake	KYPATRTITIGAGLTGTTAAPSGGFKVTTITAGSGTVSFA*
Ga0049081_103130372	3300005581	Freshwater Lentic	RYPDTRTITFGVGLTGSESAASGGYKRATITVGSGNVSWA*
Ga0049080_100484971	3300005582	Freshwater Lentic	ILRYPDTKTITIGAGLTGTESSPSGGYKRATITQGTGNVSFA*
Ga0049082_102054571	3300005584	Freshwater Lentic	YTITITGATGTTPAPSGGYKFTAITSGTGNVSFA*
Ga0079957_10479721	3300005805	Lake	LRYPDTRTITIGAGLTGTESAASGGYKRATITAGSGNVSWA*
Ga0079957_13032671	3300005805	Lake	TITIGAGLTGTESSASGGYKRATITAGTGNVSWA*
Ga0075119_11153111	3300005931	Saline Lake	PDSKTITIGVGLTGSTSPSGGYNITTITAGTGTVRFA*
Ga0070744_100755453	3300006484	Estuarine	VILRYSDTRTITIGAGLTGTESSASGGYKRAIITAGSGNVSWA*
Ga0070749_104520083	3300006802	Aqueous	TRTITIGAGLTGTESSASGGYKRATITAGTGNVSWA*
Ga0070754_100481337	3300006810	Aqueous	YPDSRTISFGAGVTGTESAASGGFKRATITAATAGTVSWS*
Ga0105747_10854623	3300007974	Estuary Water	YPDTRTISFGAGVTGTESAASGGYKRATITAATAGTVSFT*
Ga0114350_10320401	3300008116	Freshwater, Plankton	VIIRYPDTRTITIGAGLTGTESSASGGYKRATITAGTGNVSFA*
Ga0114355_12134781	3300008120	Freshwater, Plankton	PDTRTITFGAGVTGTESAASGGFKRATITAGTGNVSWS*
Ga0114337_13262872	3300008262	Freshwater, Plankton	YADTLTITIGAGLTGTESSASGGYKRATLTAGSGNVSWA*
Ga0114337_13341101	3300008262	Freshwater, Plankton	TISFGAGLTGTEGAASGGYKIATITAGTGNVSWS*
Ga0102829_13040352	3300009026	Estuarine	RTISFGAGVTGTESAASGGYKRATITAATAGTVSFT*
Ga0105103_101385851	3300009085	Freshwater Sediment	RTITIGAGLTGTESSASGGFKRATITAGTGNVSWA*
Ga0114968_103916311	3300009155	Freshwater Lake	TITIGAGLTGTESAASGGYKRTTITAGTGNVSWA*
Ga0114978_101452897	3300009159	Freshwater Lake	DTRTITIGAGLTGSTPAPSGGFKVTTITAGTGNVSFA*
Ga0114981_106713512	3300009160	Freshwater Lake	DTRTITIGAGLTGTTSSASGGYKRTTLTAGTGNVSWA*
Ga0114975_105468791	3300009164	Freshwater Lake	KYADTKTITIGAGLTGTESSASGGFKRATITAGTGNVSWA*
Ga0105102_105642603	3300009165	Freshwater Sediment	GIIILRYPDYYTISFGGGVTGTESSASGGYKRATITAATSGTVSWS*
Ga0114971_104675023	3300009185	Freshwater Lake	DSKTITIGAGLTGTVSAASGGYKRATITAGTGNVSWS*
Ga0153801_10016421	3300012017	Freshwater	TITIGAGLTGTESSASGGYKRATITAGSGNVSWT*
Ga0157498_100018026	3300012666	Freshwater, Surface Ice	TRTISFGAGVTGTESSASGGFKRATITAATAGNVSWS*
Ga0157498_10295441	3300012666	Freshwater, Surface Ice	VILRYPDTRTITFGAGLTGTESSASGGYKRATITAGSGNVSWA*
(restricted) Ga0172374_12842633	3300013122	Freshwater	RYPDSKTITIGSGLTGTESAASGGYKRATITAGTGNVSWT*
(restricted) Ga0172367_104738192	3300013126	Freshwater	VILRYADTLTITIGAGLTGSESSASGGYKRATITAGSGNVSWS*
(restricted) Ga0172372_104869891	3300013132	Freshwater	TITFGVGLTGTESGASGGYKRATITAGSGNVSWA*
Ga0177922_102742951	3300013372	Freshwater	TDARTITIGAGLTGTESAASGGYKRATITAGSGNVSWA*
(restricted) Ga0172376_103873894	3300014720	Freshwater	YADSLTITFGVGLTGTESSASGGYKRATITAGSGNVSWT*
Ga0119960_10872512	3300014811	Aquatic	FPVTIGSGLTGTTAAPSGGYKVSTITAGTGNVSWT*
Ga0181362_10692301	3300017723	Freshwater Lake	ILIKYPTTVTISIGAGLTGSTATVSGFSVTTITAGSGNVSWT
Ga0181365_10705151	3300017736	Freshwater Lake	PDNYTITIGAGLTGTESAASGGYKRATITAGSGNVSFA
Ga0181365_11273413	3300017736	Freshwater Lake	RYVDTKTISFGAGVTGTESGASGGYKRATITAGTGNVSWT
Ga0181365_11442843	3300017736	Freshwater Lake	TNTKTITIGSGLTGSTAADGSSTVATITAGTGLVSWA
Ga0181357_12182701	3300017777	Freshwater Lake	ILRYPDSLTITFGAGVTGTESGASGGYKRATITAATAGNVSWA
Ga0181357_12389443	3300017777	Freshwater Lake	YTMTIGVGLTGTTASPSGGFKVTTFTAGTGNISWN
Ga0181346_11278482	3300017780	Freshwater Lake	VILRYTDARTIVIGAGLTGTESAASGGYKRATITAGTGNVSWT
Ga0181348_12888712	3300017784	Freshwater Lake	GAISRYADTLTITFRAGETGTESAASGGYKRATITAATAGNVSWA
Ga0181348_13077832	3300017784	Freshwater Lake	KGVIFLKYADTRTITFGAGLTGTESAPSGGFKVAQITSGTGTVSFA
Ga0181355_12581163	3300017785	Freshwater Lake	YVDTLTITIGAGLTGTESAASGGYKRATITAGTGNVSWA
Ga0169931_105490013	3300017788	Freshwater	GSGVIILRYPDTRTISFGAGVTGTESAASGGYKRATITAATSGNVSWS
Ga0181587_110205821	3300017968	Salt Marsh	RTITIGAGLTGTETDRGDGFKYATITAGSGNVSFT
Ga0181359_11160663	3300019784	Freshwater Lake	GVVILRYNQSFTISIGSGLTGTESAASGGYKRATITAGSGNVSWTLS
Ga0211736_105796053	3300020151	Freshwater	KTITIGAGLTGTESAASGGYKRATITAGTGNVSWA
Ga0194128_105159622	3300020197	Freshwater Lake	ILRYADTLTITIGAGLTGTESAASGGYKRATITAGSGNVSWAA
Ga0194129_103535482	3300020578	Freshwater Lake	SDTLTITFGAGLTGTESAASGGYKRATITAGSGTVSW
Ga0181351_12249401	3300022407	Freshwater Lake	IIKYPDTLTVTFGAGVTGTESAASGGFKRATITAATAGTVSWS
Ga0244775_105131441	3300024346	Estuarine	VILRYSDTRTITIGAGLTGTESSASGGYKRAIITAGSGNVSWA
Ga0255223_10448021	3300024480	Freshwater	ATITIGAGLSGSTGAASGGFKTTTITSGSGNVSWA
Ga0208770_10787293	3300025438	Saline Lake	PDSKTITIGVGLTGSTSPSGGYNITTITAGTGTVRFA
Ga0208645_11077554	3300025853	Aqueous	YPDSRTISFGAGVTGTESAASGGFKRATITAATAGTVSWS
Ga0255083_10028005	3300027153	Freshwater	SKTITIGAGLTGTTAAPSGGFKTTTLTAGTGNVSWS
Ga0209651_11311333	3300027581	Freshwater Lake	VDTLTITIGAGLTGTESAASGGYKRATITAGTGNVSWA
Ga0208974_10434631	3300027608	Freshwater Lentic	RYPDTNTITIGAGLTGSESAPSGGYKRATITQGTGNVSFA
Ga0208133_10442941	3300027631	Estuarine	VVILRYSDTRTITIGAGLTGTESSASGGYKRAIITAGSGNVSWA
Ga0209357_10426443	3300027656	Freshwater Lake	SGVVILRYPDSRTITFGAGVTGTESAASGGYKRATITAATAGNVSWS
Ga0208975_10983393	3300027659	Freshwater Lentic	LRYADTKTITIGAGLTGTESAASGGFKRATITAGTGNVSWS
Ga0209769_10051181	3300027679	Freshwater Lake	ILRYLDTKTITIGAGLTGTTSGASGGYKRTTLTAGTGNVSWT
Ga0209553_11610181	3300027688	Freshwater Lake	YSDSKTITIGAGLTGTTSGASGGYKRTTLTAGTGNVSWA
Ga0209551_10048291	3300027689	Freshwater Lake	LDTKTITIGAGLTGTTSGASGGYKRTTLTAGTGNVSWT
Ga0209597_13438841	3300027746	Freshwater Lake	DSKTITIGAGLTGTVSAASGGYKRATITAGTGNVSWS
Ga0209768_104424492	3300027772	Freshwater Lake	YPDTQTITIGAGLTGTESAASGGYKRATLTAGTGNVSW
Ga0209990_100577601	3300027816	Freshwater Lake	RYPDNKTITIGAGLTGTESSASGGYKRATITAGTGNVSWA
Ga0209191_12864741	3300027969	Freshwater Lake	TKTITIGAGLTGTESAASGGYKRATITAGTGNVSWA
Ga0247723_10664941	3300028025	Deep Subsurface Sediment	VILRYPDTKTITIGAGLTGTESAASGGYKRATITAGSGNVSWS
(restricted) Ga0247839_12205033	3300028553	Freshwater	VIIKYPDTKTITIGAGLTGTEGAPSGGFKIATITAGSGNVSFS
(restricted) Ga0247832_11550783	3300028557	Freshwater	TRTITIGAGLTGTESAASGGYKRATITAGTGNVSWA
Ga0307982_10649031	3300031224	Saline Water	PDTKTITLGAGLTGTTPAASGGFKVTTITAGTGNVSFA
Ga0315909_108821551	3300031857	Freshwater	LRYPAARTISFGAGVTGTESAASGGYKRATITAATAGTVSWS
Ga0315286_118645123	3300032342	Sediment	TKTITIGAGLTGTTSSPSGGYKRTTLTAGTGNVSWS
Ga0335396_102510714	3300032462	Freshwater	ILRYPDTRTITFGAGVTGTESSASGGFKRATITAGTGNVSWA
Ga0334722_108834953	3300033233	Sediment	TLTITIGAGLTGTTSAPSGGLKRTTFTAGTGNVSWA
Ga0334977_0009317_1301_1426	3300033978	Freshwater	MRYADTLTITIGAGLTGTESSASGGYKRATITAGTGNVSWA
Ga0334978_0126194_122_247	3300033979	Freshwater	MRYPDTRTITIGAGLTGTESAASGGFKRATITAGTGNVSWS
Ga0334982_0030823_332_442	3300033981	Freshwater	MTISFGAGVTGTESAASGGYKRATITAATAGNVSWS
Ga0334982_0154979_320_445	3300033981	Freshwater	MRYADTLTITIGAGLTGTESAASGGYKRATITAGTGNVSWA
Ga0334982_0178012_957_1064	3300033981	Freshwater	MYADSLTITIGAGLTGTESAASGGYKRATITAGTG
Ga0334996_0001568_7983_8114	3300033994	Freshwater	MVLRYADTRTITFGAGLTGTESSASGGYKRATITAGTGNVSWA
Ga0334979_0107187_1621_1731	3300033996	Freshwater	MLKYPDTGTITIGAGLTGSTAAPSGGFKVTTITAGT
Ga0334979_0411252_479_604	3300033996	Freshwater	MRYADSLTITIGAGLTGTESAASGGFKRATITAGTGNVSWN
Ga0334998_0085756_1945_2070	3300034019	Freshwater	MRYSDIYTITIGAGLTGTESSASGGYKRATITAGTGNVSWA
Ga0335021_0066778_1557_1682	3300034023	Freshwater	MRYPDNVTITIGAGLTGTESSASGGYKRATITAGSGNVSWT
Ga0335023_0620125_391_516	3300034050	Freshwater	LRYPDTKTITFGAGLTGTESAASGGYKRATITAGTGNVSWA
Ga0334995_0171609_25_150	3300034062	Freshwater	MRYPDTRTITFGSGLTGTESAASGGYKSATITAGTGNVSWA
Ga0334995_0174945_907_1032	3300034062	Freshwater	MRYPDSRTITIGAGLTGTESAASGGFKRATITAGTGNVSWT
Ga0310130_0053141_388_513	3300034073	Fracking Water	MRYPDTRTITIGAGLTGTESAASGGYKRATITAGTGNVSWT
Ga0310130_0251279_118_243	3300034073	Fracking Water	MRYPDTRTITIGAGLTGTESSASGGYKRATITAGTGNVSWS
Ga0335012_0047647_2_142	3300034093	Freshwater	GVIILRYSDTRTITIGAGVTGTESSPSGGYKRATITAATAGNVSWA
Ga0335012_0250035_3_110	3300034093	Freshwater	RTITIGAGLTGTESAASGGYKRATITAGAGNVSWA
Ga0335022_0110875_165_290	3300034095	Freshwater	MRYADSLTITIGAGLTGTESASSGGYKRATITDGTGNVSWA
Ga0335027_0699236_164_292	3300034101	Freshwater	MRYPDTRTISFGVGVTGTESAASGGYKRATITAATAGTVSWA
Ga0335029_0206918_139_264	3300034102	Freshwater	MRYADTRTITIGAGLTGTESAASGGYKRATITAGTGNVSWS
Ga0335030_0001586_9937_10071	3300034103	Freshwater	MVILRYADNKAITIGAGLTGTESPASGGYKRATITAGSGNVSWA
Ga0335030_0505138_580_705	3300034103	Freshwater	MRYSDANTITFGAGLTGTESAASGGYKRATITAGTGNVSWS
Ga0335031_0283438_3_119	3300034104	Freshwater	ADSFTITIGAGLTGTESAASGGYKRATITAGSGNVSWA
Ga0335033_0436462_200_325	3300034117	Freshwater	LRYADTRTITIGAGLTGTESAASGGYKRATITAGTGNVSFA
Ga0335053_0723419_415_540	3300034118	Freshwater	MRYADTLTITIGSGLTGTESAASGGYKRATITAGSGFVSWA
Ga0335056_0106660_210_320	3300034120	Freshwater	MTISFGAGVTGTESSPSGGYKRATITAATAGNVSWS
Ga0335065_0397204_729_845	3300034200	Freshwater	PDTATITFGAGVTGTESSASGGYKRATITAGSGNVSWT
Ga0335039_0060791_847_972	3300034355	Freshwater	MRYPDTRTITIGAGLTGTESSASGGYKRATITAGTGNVSWV
Ga0348335_016588_383_511	3300034374	Aqueous	MRYPDSRTISFGAGVTGTESAASGGFKRATITAATAGTVSWS
Ga0348337_102167_158_289	3300034418	Aqueous	MILRYVDSLTITIGAGLTGTESSASGGYKRATITAGSGNVSWA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters