NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090357

Metagenome / Metatranscriptome Family F090357

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090357
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 213 residues
Representative Sequence RERLAGTLAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Number of Associated Samples 100
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.86 %
% of genes near scaffold ends (potentially truncated) 97.22 %
% of genes from short scaffolds (< 2000 bps) 84.26 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.222 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(35.185 % of family members)
Environment Ontology (ENVO) Unclassified
(41.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(48.148 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.87%    β-sheet: 20.09%    Coil/Unstructured: 28.04%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF01431Peptidase_M13 25.00
PF05649Peptidase_M13_N 8.33
PF02738MoCoBD_1 1.85
PF07992Pyr_redox_2 0.93
PF08240ADH_N 0.93
PF13419HAD_2 0.93
PF14226DIOX_N 0.93
PF06966DUF1295 0.93
PF05960DUF885 0.93
PF10604Polyketide_cyc2 0.93
PF08281Sigma70_r4_2 0.93
PF06271RDD 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 33.33
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.93
COG2020Protein-S-isoprenylcysteine O-methyltransferase Ste14Posttranslational modification, protein turnover, chaperones [O] 0.93
COG3752Steroid 5-alpha reductase family enzymeGeneral function prediction only [R] 0.93
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.22 %
UnclassifiedrootN/A2.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16769090All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1801Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_14451759All Organisms → cellular organisms → Bacteria1926Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101703576All Organisms → cellular organisms → Bacteria2208Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105013020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium642Open in IMG/M
3300002076|JGI24749J21850_1020366All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium936Open in IMG/M
3300002077|JGI24744J21845_10101289All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium532Open in IMG/M
3300002126|JGI24035J26624_1044308All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Maridesulfovibrio → Maridesulfovibrio hydrothermalis501Open in IMG/M
3300002459|JGI24751J29686_10066112All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium744Open in IMG/M
3300005164|Ga0066815_10077611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium593Open in IMG/M
3300005293|Ga0065715_11167686All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium505Open in IMG/M
3300005295|Ga0065707_10850472All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium582Open in IMG/M
3300005330|Ga0070690_100000904All Organisms → cellular organisms → Bacteria15110Open in IMG/M
3300005332|Ga0066388_100331921All Organisms → cellular organisms → Bacteria2167Open in IMG/M
3300005332|Ga0066388_106105949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium608Open in IMG/M
3300005344|Ga0070661_100591731All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → Corallococcus coralloides896Open in IMG/M
3300005355|Ga0070671_100040282All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium3880Open in IMG/M
3300005356|Ga0070674_101223967All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium667Open in IMG/M
3300005438|Ga0070701_11279450All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium523Open in IMG/M
3300005545|Ga0070695_100377217All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1069Open in IMG/M
3300005546|Ga0070696_100061145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2634Open in IMG/M
3300005618|Ga0068864_100001726All Organisms → cellular organisms → Bacteria17967Open in IMG/M
3300005834|Ga0068851_10525012All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium713Open in IMG/M
3300005844|Ga0068862_100681015All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium994Open in IMG/M
3300006575|Ga0074053_11787026All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium704Open in IMG/M
3300009792|Ga0126374_10236113All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1183Open in IMG/M
3300010360|Ga0126372_12056965All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium618Open in IMG/M
3300010361|Ga0126378_11322831All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium815Open in IMG/M
3300010361|Ga0126378_13007614All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium537Open in IMG/M
3300010376|Ga0126381_100196375All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2693Open in IMG/M
3300010401|Ga0134121_10405186All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1233Open in IMG/M
3300010403|Ga0134123_10862535All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium907Open in IMG/M
3300012960|Ga0164301_11023185All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium651Open in IMG/M
3300012984|Ga0164309_10960283All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium701Open in IMG/M
3300013307|Ga0157372_10469236All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1467Open in IMG/M
3300014745|Ga0157377_10002145All Organisms → cellular organisms → Bacteria8668Open in IMG/M
3300014969|Ga0157376_10224331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1742Open in IMG/M
3300015372|Ga0132256_101030217All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium938Open in IMG/M
3300015372|Ga0132256_101062208All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium925Open in IMG/M
3300016319|Ga0182033_10148879All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1803Open in IMG/M
3300020082|Ga0206353_10570875All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium693Open in IMG/M
3300021445|Ga0182009_10447383All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium674Open in IMG/M
3300025913|Ga0207695_10234969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1736Open in IMG/M
3300025916|Ga0207663_11616916All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium521Open in IMG/M
3300025917|Ga0207660_10494486All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium992Open in IMG/M
3300025921|Ga0207652_11242383All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium647Open in IMG/M
3300025972|Ga0207668_11837641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium546Open in IMG/M
3300026023|Ga0207677_10002489All Organisms → cellular organisms → Bacteria9670Open in IMG/M
3300027907|Ga0207428_11024390All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium579Open in IMG/M
3300031546|Ga0318538_10231251All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium991Open in IMG/M
3300031547|Ga0310887_10582746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium683Open in IMG/M
3300031561|Ga0318528_10523156All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium637Open in IMG/M
3300031680|Ga0318574_10926715All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium510Open in IMG/M
3300031681|Ga0318572_10787442All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium565Open in IMG/M
3300031681|Ga0318572_10839046All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium546Open in IMG/M
3300031719|Ga0306917_11590187All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium502Open in IMG/M
3300031720|Ga0307469_10827361All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium852Open in IMG/M
3300031723|Ga0318493_10272622All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium908Open in IMG/M
3300031724|Ga0318500_10509320All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium605Open in IMG/M
3300031740|Ga0307468_101103492All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium707Open in IMG/M
3300031751|Ga0318494_10055467All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2106Open in IMG/M
3300031764|Ga0318535_10101504All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1260Open in IMG/M
3300031768|Ga0318509_10223355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1050Open in IMG/M
3300031769|Ga0318526_10274662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium690Open in IMG/M
3300031770|Ga0318521_10120927All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1463Open in IMG/M
3300031777|Ga0318543_10525848All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium530Open in IMG/M
3300031793|Ga0318548_10109614All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1328Open in IMG/M
3300031795|Ga0318557_10470431All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium578Open in IMG/M
3300031796|Ga0318576_10328813All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium722Open in IMG/M
3300031798|Ga0318523_10199740All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium999Open in IMG/M
3300031805|Ga0318497_10579411All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium629Open in IMG/M
3300031832|Ga0318499_10186717All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium809Open in IMG/M
3300031835|Ga0318517_10458171All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium575Open in IMG/M
3300031846|Ga0318512_10102246All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1348Open in IMG/M
3300031854|Ga0310904_11167209All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium554Open in IMG/M
3300031858|Ga0310892_10087053All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1673Open in IMG/M
3300031858|Ga0310892_10941124All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium606Open in IMG/M
3300031890|Ga0306925_10863176All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium934Open in IMG/M
3300031894|Ga0318522_10069649All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1271Open in IMG/M
3300031896|Ga0318551_10338085All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium851Open in IMG/M
3300031897|Ga0318520_10424584All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium815Open in IMG/M
3300031954|Ga0306926_12665970All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium544Open in IMG/M
3300032001|Ga0306922_11218771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium765Open in IMG/M
3300032008|Ga0318562_10115096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1534Open in IMG/M
3300032009|Ga0318563_10289197All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium886Open in IMG/M
3300032012|Ga0310902_10527132All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium774Open in IMG/M
3300032025|Ga0318507_10185975All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium895Open in IMG/M
3300032041|Ga0318549_10513678All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium539Open in IMG/M
3300032043|Ga0318556_10210324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1013Open in IMG/M
3300032052|Ga0318506_10099716All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1240Open in IMG/M
3300032054|Ga0318570_10140202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1078Open in IMG/M
3300032055|Ga0318575_10425975All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium674Open in IMG/M
3300032064|Ga0318510_10020665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2094Open in IMG/M
3300032066|Ga0318514_10083902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1595Open in IMG/M
3300032068|Ga0318553_10118806All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1358Open in IMG/M
3300032076|Ga0306924_11391580All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium749Open in IMG/M
3300032090|Ga0318518_10085648All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1556Open in IMG/M
3300032261|Ga0306920_100254446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2620Open in IMG/M
3300032782|Ga0335082_10030301All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis5744Open in IMG/M
3300032828|Ga0335080_10072034All Organisms → cellular organisms → Bacteria3832Open in IMG/M
3300032892|Ga0335081_11525821All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium738Open in IMG/M
3300033004|Ga0335084_10831190All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium937Open in IMG/M
3300033004|Ga0335084_12170579All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium538Open in IMG/M
3300033290|Ga0318519_10452881All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium769Open in IMG/M
3300034820|Ga0373959_0139355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium606Open in IMG/M
3300034820|Ga0373959_0168787All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium563Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil35.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.63%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.70%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere3.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.85%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002076Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3Host-AssociatedOpen in IMG/M
3300002077Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3Host-AssociatedOpen in IMG/M
3300002126Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5Host-AssociatedOpen in IMG/M
3300002459Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6Host-AssociatedOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_040003802088090014SoilMQHFGYISQEWTGAATAPLDDMLERERLAGALAAALAEEVEAPLQQLLGLMGVVADEVGALADSNPELELQECGRVLAIAMLLARTAHQPIHELREFLRPVASSPGPVDAGACLESALRLAGSQVKRSCAVRTEPMLSALVHADEPRLRHALIRVLLETARGPGPSYARVGDLLLSMTTDDRRLELVITRTDRCPTPQGDLATCEALVHRA
ICChiseqgaiiFebDRAFT_1445175933300000363SoilERERLAGALASALAEEIEAPLEQLLGLIGVVADEVGALADTDPTLELEECGRVLASAMLLARRAHLPIHDLREFLRPVPYSPGPVDAGECMRGALRLVSSQVKRSCGIRTDIMPATLVQADEPRLRHALARVLLEIARGPGMAHARLGDLLVSVTREVSVLEMVITRTDRCPLPQGDLGTCERLVREAGGLLRVESGIGPGFRVRIALPLVHLRD*
INPhiseqgaiiFebDRAFT_10170357663300000364SoilAGALAAALAEEVEAPLQQLLGLMGVVADEVGALADSNPELELQECGRVLAIAMLLARTAHQPIHELREFLRPVASSPGPVDAGACLESALRLAGSQVKRSCAVRTEPMLSALVHADEPRLRHALIRVLLETARGPGPSYARVGDLLLSMTTDDRRLELVITRTDRCPTPQGDLATCEALVHRAGGTFRVEPWVGTGFRVRISLPLLQME*
INPhiseqgaiiFebDRAFT_10501302013300000364SoilAAERERIAGVLAAALTEEVEAPLEQLLGLIGIVADEVGALADTDPSLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDAGECVRSALRLVGSEVKRSCGIRTELLPMXLVQAXXPRLRHALVKVLLETARGPGMSYARLGDLLVSMTREVSVLELTITRIDRCRMRGDLETCERLVREAGGLLRVEPHVGHGFRVRIALPLVQL
JGI1027J12803_10082143913300000955SoilQECGRVLAIAMLLARTAHQPIHELREFLRPVASSPGPVDAGACLESALRLAGSQVKRSCAVRTEPMLSALVHADEPRLRHALIRVLLETARGPGPSYARVGDLLLSMTTDDRRLELVITRTDRCPTPQGDLATCEALVHRAGGTFRVEPWVGTGFRVRISLPLLQME*
JGI24749J21850_102036623300002076Corn, Switchgrass And Miscanthus RhizosphereAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD*
JGI24744J21845_1010128913300002077Corn, Switchgrass And Miscanthus RhizosphereEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRV
JGI24035J26624_104430813300002126Corn, Switchgrass And Miscanthus RhizosphereLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAG
JGI24751J29686_1006611213300002459Corn, Switchgrass And Miscanthus RhizosphereVRWQLSTGHGLRSYTTRLLPFADGGESTEYFGYVNQDWTGAHEVELDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRV
Ga0066815_1007761113300005164SoilHFGYINQDWTGAQDVALDDAAERERIAGALATALTEEIEAPLEQLLGLIGVVADEVGALADTDPALELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDAGECMRSALRLVSSEVKRSCGVRTEVLPTMLVQADEPRLRHALVRVLLETARGPGVAYARLGDLVVSVSREVSVLELVLTRTDRCPVPQG
Ga0065715_1116768613300005293Miscanthus RhizosphereEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRG
Ga0065707_1085047213300005295Switchgrass RhizosphereERLAGALASALAEEIEAPLEQLLGLIGIVADEVGALADTDPTLELEECGRVLASAMLLARRAHLPIHDLREFLRPVPYSPGPVDASECMRSALRLVSSQVKRSCGIRTEILPATLVQADEPRLRHALARVLLETARGPGMAHARLGDLLVSMTREVSVLELVITRTDRCPVPQGDLGTCERLVREAGGLLRVES
Ga0070690_10000090413300005330Switchgrass RhizosphereAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD*
Ga0066388_10033192113300005332Tropical Forest SoilALASALAEEIEAPLEQLLGLIGVVADEVGALADTDPTLELEECGRVLASAMLLARRAHLPIHDLREFLRPVPYSPGPVDASECMRSALRLVSSQVKRSCGIRTDVLPAMLVQADEPRLRHALARVLLETARGPGMSHARLGDLLVSVTREISVLELVITRTDRCPAPEGDLGTCERLVREAGGLLRVESGLGPGFRVRIALPLVHLRG*
Ga0066388_10610594913300005332Tropical Forest SoilERLAGALASALAEEVEAPLEQLLGLIGVVADEVGALADMDPALELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVEASECMRSALRLVSSEVKRSCGVRTEILPATFVQADEARLRHALIRTLLETARGPGLACARLGELVVSMTRDASVLELVITRQDGGGTPQGDLATCERLVREAGGLLRVERRLGAGFRV
Ga0070661_10059173113300005344Corn RhizosphereINQDWTGAQDVALDDTAERERIAGSLAATLAEEIEAPLEQLLGLIGVVADEVGALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPAPYSPGPVDASEAVRSALRLVSSEVKRACGIRTEQLPTTLVQADEPRLRHALVRVLLETARGPGLAHARLGDLVVSMTREVSVLELVLTRTDSCPVPQGDLATCIRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRT*
Ga0070671_10004028233300005355Switchgrass RhizospherePLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD*
Ga0070674_10122396713300005356Miscanthus RhizosphereQLLGLIGVVADEVGALADTDPSLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDAGECMRSALRLVSSEVKRSCGIRTELLATMVVQADEPRLRHALVRVLLETARGPGVAYARLGDLVVSMIREVSVLELILTRTDRCPVPQGDLASCVRLVREAGGLLRVEPHVGQGFRVRIALPVVQLHD*
Ga0070701_1127945013300005438Corn, Switchgrass And Miscanthus RhizosphereAHEVDLDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELV
Ga0070695_10037721713300005545Corn, Switchgrass And Miscanthus RhizosphereDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD*
Ga0070696_10006114523300005546Corn, Switchgrass And Miscanthus RhizosphereMSLDAAHELRKPLDVRWQLSTGHGLRSYTTRLLPFADGGESTEYFGYVNQDWTGAHEVELDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLEIVLTR
Ga0068864_10000172613300005618Switchgrass RhizosphereHGLRSYTTRLLPFADGGESTEYFGYVNQDWTGAHEVELDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD*
Ga0068851_1052501213300005834Corn RhizosphereLLPFADGGESTEYFGYVNQDWTGAHEVDLDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRV
Ga0068862_10068101523300005844Switchgrass RhizosphereGYVNQDWTGAHEVELDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD*
Ga0074053_1178702613300006575SoilEIEAPLEQLLGLIGVVADEVGALADTDPALELEECGRVLASAMLLARRAHLPVHELRGFLRQVPYSPGPVDAGESVRSALRLVSSEVKRSCGIRTELLPTTLVQADEPRLRHALVRVLLETARGPGMAYARLGNLVVSMTREVSVLELVLTRTDRCPVPQGDLASCVRLVREAGGLLRVEPNDLVVIDVGRMAQRARW*
Ga0126374_1023611323300009792Tropical Forest SoilERERIAGALAAALTEEVEAPLEQLLGLIGIVADEVGALADTDPSLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDAGECIRGALRLVSSEVKRSCGIRTELLPTMLVHADEPRLRHALVQVLLETARGPGLAHARLGDLVVSMARDSSVLELTITRTDRCATPQGDLTTCERLVREAGGLLRVEPQIGNGFRVRIALPLVQLRD*
Ga0126372_1205696513300010360Tropical Forest SoilHFGYINQDWTGAHSVHLDDAAERERLAGALASALAEEVEAPLEQLLGLIGVVADEVGALADLDPTLELEECGRVLASAMLLARRAHMPVHELREFLRPVPYSPGPVEAGECMRSALRLVSSEVKRSCGVRTEILPATFVQADEPRLRHALIRTLLETGRGPGLVCARLGELVVSMTRDTSVLELVITRTDGGGTPQGDLATCERL
Ga0126378_1132283113300010361Tropical Forest SoilFGYISQDWTGAQDVALDDAAERERIAGALAAALAEEVEAPLEQLLGLIGVVADEVGALADTDPSLELEECGRVLASAMLLARRAHLPIHELRGFLRPVPYSPGPVDAGECLRGALRLVSSEVKRSCGIRTELLPMTLVQADEPRLRHALVRVLLETARRPGMDLVRLGDLIVSMTRDSSVLELTITRMDRCRTPKGDLATCERLVREAGGLLRVEPQIGHGFRVRIALPLVQLHD*
Ga0126378_1300761413300010361Tropical Forest SoilDPHQQFGYINQDWTASDHVQIGDQTERERLAGALASALSEEIEAPLEQLLGLIGIVSDEVNALSDMAPELELEECGRVLATATLLSRKAHRPVRELREFLRPTSYAPGPVDAAATVRSAVRLVGSEVRRSVGLKVDPLPGVLVQADEARLKHALVRVLLETARGPGVSFARVGDLVVS
Ga0126381_10019637513300010376Tropical Forest SoilWTGAENVAVGDQAERERLAGALASALAEEIEAPLEQLLGLIGIVSDEVRALADIDPALELEECGRVLASAVLLARRAHLPAHELRDFLRPSPSSPGPVDPGECLRRAMRLVGSEVKRSVGVRMQPMPAALVQADERILRHALMRVLLETARGPGLGFARAGELVLSMTMDDRTLELVITRTDRCPVPQGNLGFCEALVGEAGGTLTVEPRVGTGFRVRVGLPILNLRS*
Ga0134121_1040518613300010401Terrestrial SoilTGAHEVELDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD*
Ga0134123_1086253523300010403Terrestrial SoilSTEYFGYVNQDWTGAHEVELDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD*
Ga0164301_1102318513300012960SoilALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLEVALTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD*
Ga0164309_1096028313300012984SoilELRKPLDVRWQLSTGHGLRSYTTRLLPFADGGESTEYFGYVNQDWTGAHEVELDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQG
Ga0157372_1046923623300013307Corn RhizosphereLSTGHGLRSYTTRLLPFADGGESTEYFGYVNQDWTGAHEVELDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLGSAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD*
Ga0157377_1000214513300014745Miscanthus RhizosphereTTRLLPFADGGESTEYFGYVNQDWTGAHEVDLDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD*
Ga0157376_1022433123300014969Miscanthus RhizosphereVRWQLATGHGLRTFTTRLLPFSDGGEPMQHFGYINQDWTGAQDVALDDGAERERIAGALAAALTEEIEAPLEQLLGLVGVVADEVGALAETDPSLELEECGRVLASAMLLARRAHLPVHELRGFLRPVRYSPGPVDAGECMRSALRLVSSEVKRSCGIRTEVLPTMLVQADEPRLRHALVRVLLETARGPGMAYARLGDLVVSMTRETSVLELILTRTDRCPVPQGDLATCVRLVREAGGLLRVEPNVGYGFRVRIALPLVQLRD*
Ga0132256_10103021723300015372Arabidopsis RhizospherePGQDDPMQHFGYINQDWTGSATAPLDEMMERERLAGALAATLAEEVEAPLQQLLGLIGIAADEVGALADTDPELELEECGRVLSIAMVLAGSAHTPVRELREFLRPVAHSPGPVDAGECLASALRLVGSEVKKSCGVRTESMRSALVHADEPRLRHALVRVLLETARGPGLAYARAGDLLLSMAVDDRRLELVITRTDRCPTPQGDLAACESLVQRAGGTLRVEPWVGTGFRVRVVLPLLQLRG*
Ga0132256_10106220813300015372Arabidopsis RhizosphereLAATLAEEIEAPLEQLLGLIGVVADEVGALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRTCGIRTDLLPATLVQADEPRLRHALVRVLLETARGPGLAYARLGDLVISMTHEVSVLELVLTRTDSCPVPQGDLATCVRLVREAGGLLRVEPRVGCGFRVRIALPLVQLRE*
Ga0182033_1014887923300016319SoilERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEMLPATLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFRVRIALPLVQLRG
Ga0206353_1057087513300020082Corn, Switchgrass And Miscanthus RhizosphereALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD
Ga0182009_1044738313300021445SoilALAATLTAEIEAPLEQLLDLIGVVADEVGALADTDPALELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRSCGIRTELLPSTLVQADEPRLRHALVRVLLETARGPGMAYARLGDLVVSMTREVSVLELIITRTDSCPVPQGDLATCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD
Ga0207695_1023496913300025913Corn RhizosphereLAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD
Ga0207663_1161691613300025916Corn, Switchgrass And Miscanthus RhizosphereLAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASC
Ga0207660_1049448623300025917Corn RhizosphereERERIAGAVAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD
Ga0207652_1124238313300025921Corn RhizosphereALGHPYHLKYYSGGYHWHSLSRFLWSHGYRDQVVRDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD
Ga0207712_1060894923300025961Switchgrass RhizosphereDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD
Ga0207668_1183764113300025972Switchgrass RhizosphereALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAG
Ga0207677_1000248973300026023Miscanthus RhizosphereGHGLRSYTTRLLPFADGGESTEYFGYVNQDWTGAHEVDLDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD
Ga0207428_1102439013300027907Populus RhizosphereKDSTQYFGHITQDWTGARDLSIDDAAERERLAGALASALAEEIEAPLEQLLGLIGVVADEVGALADTDPALELEECGRVLASAMLLARRAHLPIHDLREFLRPVPYSPGPVDPGECMRSALRLVSSQVKRSCGVRTDILPATLVQADEPRLRHALARVLLEIARGPGLAHARLGDLLVSMTREVSVLEMVITR
Ga0318538_1023125123300031546SoilDVSLDDAAERERLAGTLAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVAYSPGPVDAGECVRSALRLVSSEVKRSCGIRTEMLPATLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMAQDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0310887_1058274613300031547SoilQHFGYINQDWTGAHDVTLEDTAERERIAGALAAALTEEVEAPLEQLLGLIGVVADEVGALADMDPSLELEECGRVLASAMLLARRAHLPVHDLRGFLRPVPYSPGPVDAGECVRSALRLVGSEVKRSCGIRTELLPMALVQADEPRLRHALVKVMLETARGPGMSYARLGDLLVSMTREVSVLELTITRVDRCRMQGDLETCQRLVREAGGLLRVEPHVGHGFRVRI
Ga0318528_1052315613300031561SoilVIPFTQGDGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDL
Ga0318574_1092671513300031680SoilAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDL
Ga0318572_1078744213300031681SoilNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMAQDASVLELVLSR
Ga0318572_1083904613300031681SoilDWTGAQDVALDDAAERERIAGALAAALAEEVEAPLEQLLGLIGVVADEVGALADIDPSLELEECGRVLASAMLLTRRAHLPIHELRGFLRPVAYSPGPVDAGECMRGALRLVSSEVKRSCGIRTELLPMTLVQADEPRLRHALVRVLLETARGPGTDHARVGDLIVSMSRDASVLELTIT
Ga0306917_1159018713300031719SoilLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECVRSALRLVSSEVKRSCGIRTEMLPATLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMAQDASVLELVLSRIDRCGTPQGDLATCERLVRE
Ga0307469_1082736113300031720Hardwood Forest SoilGKPLDVRWQLSTDHGLRSFTSRLLPFPDRGGSLQHFGYINKDWTGGQSVQVEDAAERERIAGALVSALAEEIEAPLEQLLGLIGIVADEVGALADTDPALELEECGRVLASAMLLARRAHLPVHELREFMRPIPYSPGPVEAGECMRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALIRTLLETARGPGTAYARVGELVVSMVRDASVLELVITRTDRCPTPQGDLVTCKRLVREAGGLLRVEPRVGTGFRVRIALPLLQLRG
Ga0318493_1027262213300031723SoilTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFRVRIALPLVQLRG
Ga0318500_1050932013300031724SoilTQDWTGAEKVALGDQSERERLAGALASALAEEIEAPLEQLLGLIGIVSDEVRALAEIDPALELEECGRVLATAVLLARRAHLPVHELRDFLRASPSSPGPVDPGGCLRSAMRLVGSEVKRSVGVRMAPMPAALVQADERILRHALMRVLLETARGPGLGFARAGDLLLSMTMDDRRLELLITRTDRCPAPQGNLGTCEALV
Ga0307468_10110349213300031740Hardwood Forest SoilADGAESTEYFGYVNQDWTGAPEVDLVDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGMAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRI
Ga0318492_1034385213300031748SoilEMSGRTALELGLPSSLVQGWLMSLDAAHQLGRPLDVRWQLSTGRGLRTFTTRVIPFAQGDGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTP
Ga0318494_1005546713300031751SoilTRVIPFAQGDGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318535_1010150423300031764SoilALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318509_1022335523300031768SoilEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318526_1027466213300031769SoilIPFTQGDGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQ
Ga0318521_1012092723300031770SoilGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318543_1052584813300031777SoilAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLS
Ga0318548_1010961413300031793SoilSTGRGLRTFTSRVIPFAQGDGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318557_1047043113300031795SoilEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFRVRIA
Ga0318576_1032881313300031796SoilDVRWQLATRHGLRTFTTRLLPFADGGESLQRFGYISQDWTGAQDVALDDAAERERIAGALAAALAEEVEAPLEQLLGLIGVVADEVGALADIDPSLELEECGRVLASAMLLARRAHLPIHELRGFLRPVAYSPGPVDAGECMRGALRLVSSEVKRSCGIRTELLPMTLVQADEPRLRHALVRVLLETARGPGTDHARVGDLIVSMSRDASVLELTITRMDRCPTPKGDLATCERLVREAG
Ga0318523_1019974013300031798SoilLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318497_1057941113300031805SoilSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLV
Ga0318499_1018671713300031832SoilLRTFTTRVIPFAQGDGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318517_1045817113300031835SoilSQDWTGAQDVALDDAAERERIAGALAAALAEEVEAPLEQLLGLIGVVADEVGALADIDPSLELEECGRVLASAMLLARRAHLPIHELRGFLRPVAYSPGPVDAGECMRGALRLVSSEVKRSCGIRTELLPMTLVQADEPRLRHALVRVLLETARGPGTDHARVGDLIVSMSRDASVLELTITRMDRCPTPK
Ga0318512_1010224623300031846SoilTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFRVRIALPLVQLRG
Ga0310904_1116720913300031854SoilEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRG
Ga0310892_1008705313300031858SoilQLSTGHGLRSYTTRLLPFADGGESTEYFGYVNQDWTGAHEVDLDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPRVGRGFRVRIALPLVQLRD
Ga0310892_1094112413300031858SoilIGVVADEVGALADMDPSLELEECGRVLASAMLLARRAHLPVHDLRGFLRPVPYSPGPVDAGECVRSALRLVGSEVKRSCGIRTELLPMALVQADEPRLRHALVKVMLETARGPGMSYARLGDLLVSMTREVSVLELTITRVDRCRMQGDLETCQRLVREAGGLLRVEPHVGHGFRVRIALPLVQLRD
Ga0306925_1086317623300031890SoilSRVIPFAQGDGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFRVRIALPLVQLRG
Ga0318522_1006964913300031894SoilVIPFTQGDGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318551_1033808523300031896SoilRERLAGTLAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318520_1042458413300031897SoilSRVIPFTQGDGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFRVRIALPLVQLRG
Ga0306926_1266597013300031954SoilFGYISQDWTGAQDVALDDAAERERIAGALAAALAEEVEAPLEQLLGLIGVVADEVGALADIDPSLELEECGRVLASAMLLARRAHLPIHELRGFLRPVAYSPGPVDAGECMRGALRLVSSEVKRSCGIRTELLPMTLVQADEPRLRHALVRVLLETARGPGTDHARVGDLIVSMSRDASV
Ga0306922_1121877113300032001SoilHQLGRPLDVRWQLSTGRGLRTFTSRVIPFAQGDGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQ
Ga0318562_1011509623300032008SoilALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318563_1028919723300032009SoilLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFRVRIALPLVQLRG
Ga0310902_1052713213300032012SoilAAHELRKPLDVRWQLSTGHGLRSYTTRLLPFADGGESTEYFGYVNQDWTGAHEVDLDDTAERERIAGALAAALTDEIEAPLEQLLSLIGIVADEVSALADTDPTLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDASEAMRSALRLVSSEVKRACGIRTQHLPSTLVQADEPRLRHALVRVLLETARGPGTAYARLGDLVVSMSREVSVLELVLTRTDSCPVPQGDLASCVRLVREAGGLLRVEPR
Ga0318507_1018597513300032025SoilAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFRVRIALPLVQLRG
Ga0318549_1051367813300032041SoilLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVAYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMAQDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFR
Ga0318556_1021032413300032043SoilVIPFTQGDGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMAQDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFRVRIALPLVQLRG
Ga0318506_1009971613300032052SoilTRVIPFAQGDGSTQNFGYINQDWTGAQDISLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318570_1014020223300032054SoilVGALADTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEMLPATLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMAQDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFRVRIALPLVQLR
Ga0318575_1042597513300032055SoilLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVAYSPGPVDAGECVRSALRLVSSEVKRSCGIRTEMLPATLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318510_1002066523300032064SoilTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFRVRIALPLVQLRG
Ga0318514_1008390213300032066SoilLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318553_1011880623300032068SoilPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFRVRIALPLVQLRG
Ga0306924_1139158013300032076SoilNQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0318518_1008564823300032090SoilIPFTQGDGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHMPVHELREFVRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTELLPATLVQADEPRLRHALVRVLIETARGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQIGHGFRVRIALPLVQLRG
Ga0306920_10025444613300032261SoilEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0335082_1003030113300032782SoilLLPFPIGSDPTQHFGYINHDWTGSATAPLDDMVERERLAGALAAALAEEIETPLQQLLGLMGVVADEVGALAESDPELELEECGRVLAIAMLLARTAHLPVHELREFLRPVASTPGPVDAGACLQSALRLAGSEVKRSCGVRTEPMPSALVHADEPRLRHALVRVLLETARGPGLAYARAGDLLLSMTMEDRRLELVITRTDRCPTPQGDFATCEALVQRAGGTLRVEPWIGTGFRVRIGLPLLQTRG
Ga0335080_1007203443300032828SoilFPDRGGSTQHFGYINTDLTGENTTHLGDQIERERLAGALASALAEEIEAPLEQLLQLIGIVTDEVGALAATDPELELEECGRVLALATILARKAHLPVRELREFLRPQGFSPGPVDAAESVRSALRLVGSEVKRSVGLRVDTLPASLVQADEPRLRHALIGVLLETARGPGPAFARVGDLVVSMQKDDRMLELLITRTDRCPVPQGDLARCEILVREAGGSLRVEPWVSGGFRVRVTLPLMQPGA
Ga0335081_1152582113300032892SoilMVHQLRAPLDVPWQLSTPFGLRSFKSRVLPFPDRGGSTQHFGYINTDLTGENTTHLGDQIERERLAGALASALAEEIEAPLEQLLQLIGIVTDEVGALAATDPELELEECGRVLALATILARKAHLPVRELREFLRPQGFSPGPVDAAESVRSALRLVGSEVKRSVGLRVDTLPASLVQADEPRLRHALIGVLLETARGPGPAFARVGDLVVSMQKDDRMLELLITRTDRCPVPQGDLARCEILV
Ga0335084_1083119013300033004SoilVALDDAAERERIAGVLAAALTEEVEAPLEQLLGLIGIVADEVGALADTDPSLELEECGRVLASAMLLARRAHLPVHELRGFLRPVPYSPGPVDAAECIRGALRLVSSEVKRSCGIRTELLPMMLVQADEPRLRHALVRVLLETARGPGMALARLGDLVVSMARDASVLELTITRTDRCHSPQGDLATCERLVREAGGLLRVEPHIGNGFRVRIALPLVELRD
Ga0335084_1217057913300033004SoilVEDSAERERIAGALASALAEEIEAPLEQLLGLIGIVADEVGALADTDPALELEECGRVLASAMLLARRAHLPVHELREFLRPVPYSPGPVEAAECMRSALRLVSSEVKRSCGIRTEFLPATLVQADEPRLRHALIRTLLETARGPGSAFARVGELVVSMVRDASVLELVITRTDRCPAP
Ga0318519_1045288113300033290SoilSRVIPFAQGDGSTQNFGYINQDWTGAQDVSLDDAAERERLAGALAAALTEEIEAPLEQLLGLIGVVADEVGALADTDPLLELEECGRVLASAMLLARRAHVPVHELREFLRPVPYSPGPVDAGECIRSALRLVSSEVKRSCGIRTEVLPSTLVQADEPRLRHALVRVLIETGRGPGAAHARLGDLVVSMARDASVLELVLSRIDRCGTPQGDLATCERLVREAGGLLRVEPQTGHGFRVRIALPLVQLRG
Ga0373959_0139355_2_5293300034820Rhizosphere SoilMQHFGYINQDWTGAHDVTLEDTAERERIAGALAAALTEEVEAPLEQLLGLIGVVADEVGALADMDPSLELEECGRVLASAMLLARRAHLPVHDLRGFLRPVPYSPGPVDAGECVRSALRLVGSEVKRSCGIRTELLPMALVQADEPRLRHALVKVMLETARGPGMSYARLGDLLVS
Ga0373959_0168787_2_5623300034820Rhizosphere SoilPLQQLLGLIGIAADEVGALADTDPELELEECGRVLSIAMVLAGSAHTPVRELREFLRPVAHSPGPVDAGECLASALRLVGSEVKKSCGVRTESMRSALVHADEPRLRHALVRVLLETARGPGLAYARAGDLLLSMAVDDRRLELVITRTDRCPTPQGDLAACESLVQRAGGTLRVEPWVGTGFRVRV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.