| Basic Information | |
|---|---|
| Family ID | F090350 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MERLVTVEFGPSRSKRFGKALAEARSGAGECSEIEPGRYRR |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.47 % |
| % of genes near scaffold ends (potentially truncated) | 90.74 % |
| % of genes from short scaffolds (< 2000 bps) | 87.04 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.963 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.852 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.481 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.407 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.39% β-sheet: 10.14% Coil/Unstructured: 72.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 2.78 |
| PF13401 | AAA_22 | 0.93 |
| PF01527 | HTH_Tnp_1 | 0.93 |
| PF10604 | Polyketide_cyc2 | 0.93 |
| PF07508 | Recombinase | 0.93 |
| PF12844 | HTH_19 | 0.93 |
| PF07690 | MFS_1 | 0.93 |
| PF00484 | Pro_CA | 0.93 |
| PF12762 | DDE_Tnp_IS1595 | 0.93 |
| PF13936 | HTH_38 | 0.93 |
| PF01053 | Cys_Met_Meta_PP | 0.93 |
| PF13384 | HTH_23 | 0.93 |
| PF01381 | HTH_3 | 0.93 |
| PF00248 | Aldo_ket_red | 0.93 |
| PF00067 | p450 | 0.93 |
| PF08327 | AHSA1 | 0.93 |
| PF04191 | PEMT | 0.93 |
| PF13280 | WYL | 0.93 |
| PF10646 | Germane | 0.93 |
| PF05977 | MFS_3 | 0.93 |
| PF13439 | Glyco_transf_4 | 0.93 |
| PF00107 | ADH_zinc_N | 0.93 |
| PF01734 | Patatin | 0.93 |
| PF05593 | RHS_repeat | 0.93 |
| PF00472 | RF-1 | 0.93 |
| PF02627 | CMD | 0.93 |
| PF04307 | YdjM | 0.93 |
| PF00773 | RNB | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.93 |
| COG4776 | Exoribonuclease II | Transcription [K] | 0.93 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.93 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.93 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.93 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.93 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.93 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.93 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.93 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.93 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.93 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 0.93 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.93 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.93 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.93 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.93 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.93 |
| COG0557 | Exoribonuclease R | Transcription [K] | 0.93 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.93 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.93 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.93 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.89 % |
| Unclassified | root | N/A | 11.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig1218939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
| 3300002122|C687J26623_10001739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4664 | Open in IMG/M |
| 3300003373|JGI25407J50210_10009747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2439 | Open in IMG/M |
| 3300005174|Ga0066680_10166615 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300005174|Ga0066680_10738154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300005450|Ga0066682_10957963 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005471|Ga0070698_102193316 | Not Available | 506 | Open in IMG/M |
| 3300005552|Ga0066701_10040727 | Not Available | 2491 | Open in IMG/M |
| 3300005553|Ga0066695_10149779 | Not Available | 1452 | Open in IMG/M |
| 3300005561|Ga0066699_10930798 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005566|Ga0066693_10247053 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300006034|Ga0066656_11119298 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006581|Ga0074048_12632430 | All Organisms → cellular organisms → Archaea | 1070 | Open in IMG/M |
| 3300006791|Ga0066653_10687856 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006796|Ga0066665_11285068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300006796|Ga0066665_11544144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300006800|Ga0066660_10409720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1121 | Open in IMG/M |
| 3300009012|Ga0066710_100018100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7648 | Open in IMG/M |
| 3300009012|Ga0066710_103327176 | Not Available | 613 | Open in IMG/M |
| 3300009088|Ga0099830_10201513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1558 | Open in IMG/M |
| 3300009088|Ga0099830_11503403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300009089|Ga0099828_11869884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300009089|Ga0099828_11988356 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009090|Ga0099827_10297120 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300009090|Ga0099827_10619733 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300009090|Ga0099827_10992848 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300009090|Ga0099827_11008825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 722 | Open in IMG/M |
| 3300009090|Ga0099827_11763817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300009137|Ga0066709_103733267 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300009518|Ga0116128_1194442 | Not Available | 571 | Open in IMG/M |
| 3300010166|Ga0126306_10113397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1975 | Open in IMG/M |
| 3300011271|Ga0137393_11672513 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300011994|Ga0120157_1086684 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012008|Ga0120174_1076567 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300012014|Ga0120159_1111729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
| 3300012045|Ga0136623_10292938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300012198|Ga0137364_11401630 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012199|Ga0137383_10591533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
| 3300012201|Ga0137365_10544420 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300012207|Ga0137381_10880821 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300012208|Ga0137376_10225524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1623 | Open in IMG/M |
| 3300012209|Ga0137379_11597017 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012350|Ga0137372_10212310 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300012350|Ga0137372_10818832 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300012353|Ga0137367_10302271 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300012354|Ga0137366_10073451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2604 | Open in IMG/M |
| 3300012354|Ga0137366_10666011 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300012354|Ga0137366_10798741 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012356|Ga0137371_10829218 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012357|Ga0137384_11535515 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012359|Ga0137385_11614185 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012362|Ga0137361_10290441 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300012532|Ga0137373_10046994 | All Organisms → cellular organisms → Bacteria | 4042 | Open in IMG/M |
| 3300012684|Ga0136614_10645233 | Not Available | 750 | Open in IMG/M |
| 3300013294|Ga0120150_1059376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300013501|Ga0120154_1037629 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300013501|Ga0120154_1095043 | Not Available | 683 | Open in IMG/M |
| 3300013758|Ga0120147_1064424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300013765|Ga0120172_1004282 | All Organisms → cellular organisms → Bacteria | 5038 | Open in IMG/M |
| 3300013765|Ga0120172_1047833 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300013765|Ga0120172_1079313 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300013765|Ga0120172_1124314 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300013768|Ga0120155_1067807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1029 | Open in IMG/M |
| 3300013770|Ga0120123_1183053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
| 3300013772|Ga0120158_10145804 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300014056|Ga0120125_1117685 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300014058|Ga0120149_1037209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1197 | Open in IMG/M |
| 3300014058|Ga0120149_1137148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300014823|Ga0120170_1023156 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300014827|Ga0120171_1063125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1058 | Open in IMG/M |
| 3300014827|Ga0120171_1086885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 819 | Open in IMG/M |
| 3300014827|Ga0120171_1102898 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300017789|Ga0136617_11321320 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300018077|Ga0184633_10347358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 749 | Open in IMG/M |
| 3300018077|Ga0184633_10609533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300018079|Ga0184627_10372635 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300018081|Ga0184625_10199856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1047 | Open in IMG/M |
| 3300018082|Ga0184639_10566432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300018468|Ga0066662_12887669 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300018482|Ga0066669_12093816 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300019890|Ga0193728_1362665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300025324|Ga0209640_10019964 | All Organisms → cellular organisms → Bacteria | 5844 | Open in IMG/M |
| 3300025501|Ga0208563_1010847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2945 | Open in IMG/M |
| 3300025533|Ga0208584_1056975 | Not Available | 998 | Open in IMG/M |
| 3300025619|Ga0207926_1055322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1079 | Open in IMG/M |
| 3300027561|Ga0209887_1062999 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300027875|Ga0209283_10751343 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300027882|Ga0209590_10837409 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300028711|Ga0307293_10135415 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300028793|Ga0307299_10291563 | Not Available | 613 | Open in IMG/M |
| 3300028796|Ga0307287_10244621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
| 3300028807|Ga0307305_10302262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → unclassified Actinoplanes → Actinoplanes sp. ATCC 53533 | 728 | Open in IMG/M |
| 3300028807|Ga0307305_10384410 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300028814|Ga0307302_10380825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 697 | Open in IMG/M |
| 3300028814|Ga0307302_10689804 | Not Available | 508 | Open in IMG/M |
| 3300028828|Ga0307312_10049767 | All Organisms → cellular organisms → Bacteria | 2500 | Open in IMG/M |
| 3300028828|Ga0307312_10072220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2095 | Open in IMG/M |
| 3300028875|Ga0307289_10192530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 839 | Open in IMG/M |
| 3300028878|Ga0307278_10000580 | All Organisms → cellular organisms → Bacteria | 18343 | Open in IMG/M |
| 3300028878|Ga0307278_10063417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → unclassified Actinoplanes → Actinoplanes sp. ATCC 53533 | 1668 | Open in IMG/M |
| 3300028878|Ga0307278_10461030 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031543|Ga0318516_10406870 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300031782|Ga0318552_10390259 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300031949|Ga0214473_11882342 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300032160|Ga0311301_12769441 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300034165|Ga0364942_0263710 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.85% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 21.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.04% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.63% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.85% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.93% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025619 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_15458260 | 2124908045 | Soil | VERRVTVEFGPSRSKRFGRALAEARSGVGECRELEPGRYRV |
| C687J26623_100017391 | 3300002122 | Soil | VARVRFLTVVFGPSRSKRFGKAVAEAQGGAGECSELAPGRYRARFVLGEDAAAT* |
| JGI25407J50210_100097474 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VERRFTVEFGPSRSKRFGRAVAQAQRGADECSDRVPGRYRATFL |
| Ga0066680_101666153 | 3300005174 | Soil | MERLVTVEFGPSRSKRFGKAVTEARKGGECAEVESGRYRASFALGADSDAYTAL |
| Ga0066680_107381542 | 3300005174 | Soil | MELVFTVEFGPSRSKRFGRALSEAQSGAGECREVEPGRYRARFVLGED |
| Ga0066682_109579632 | 3300005450 | Soil | MERLVTIEFGPSRSKRFGKAVALAQSGPGACTESEPGRYRVTFLLGA |
| Ga0070698_1021933161 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MEQLVTVEFGPSRSRRLGRALAEAQGGAGECNEVEPGRYRGRG |
| Ga0066701_100407271 | 3300005552 | Soil | MERLMTVEFGPSRSKRFGRALAEARGRGGECSEVE |
| Ga0066695_101497791 | 3300005553 | Soil | MERLVTVEFGPSRSKRFGKAVALAQGGPGECSESEPGRYRVRFLLAADAALYG |
| Ga0066699_109307982 | 3300005561 | Soil | MRRSLTIEFGPSRSQRFGKAVAEAKDGAGACSELEPGRYRVGFVLGSDPAP |
| Ga0066693_102470532 | 3300005566 | Soil | MFSVEFGPSRSKRFGRALSEAQSGAGECREVEPGRYR |
| Ga0066656_111192981 | 3300006034 | Soil | LVERVLTVEFGPSRSKRFQRAVADAESGPGECTELERGSYR |
| Ga0074048_126324301 | 3300006581 | Soil | MERRVTVEFGPSRSKRFGKAVAEAQRGGGECSELEPGRYR |
| Ga0066653_106878563 | 3300006791 | Soil | MERLVTVEFGPSRSKRFGKALTLAQSGPGECIEVEPGRYRARFLL |
| Ga0066665_112850682 | 3300006796 | Soil | MERRLTVEFGPSRSRRFGKAVAEAQSGPGECSELEPDRYRTSFLLGGDA |
| Ga0066665_115441442 | 3300006796 | Soil | MKRLLIVEFGPSRSKRFAKAVAAAQRGPGECVELEP |
| Ga0066660_104097202 | 3300006800 | Soil | LTVVFGPSRSKQFGKAVEEARAGAGECSELWPGSYRVRFVLGRDGRVYTSLA |
| Ga0066710_1000181001 | 3300009012 | Grasslands Soil | MERLLTVEFGPSRSKRFGKALALAQSGPGECTEVEPGRYRARFLLGEDSSLYS |
| Ga0066710_1033271762 | 3300009012 | Grasslands Soil | MERRFSVEFGPSRSRRFGRALAEAQSGAGECSEVEA |
| Ga0099830_102015131 | 3300009088 | Vadose Zone Soil | VERVLTVEFGPSRSKRFRKAVEEARSGAGECSELAPGSYRVRFVLGS |
| Ga0099830_115034031 | 3300009088 | Vadose Zone Soil | VERVLTVEFGPSRSKRFKKAVEEACGGAGECSELEPGSYRVR |
| Ga0099828_118698842 | 3300009089 | Vadose Zone Soil | MERLVTVEFGPSRSKRFPKALARAQNGPGECTEIEPGRYRVRFLLGT |
| Ga0099828_119883561 | 3300009089 | Vadose Zone Soil | MERLLTVEFGPSRSKRFGKAVAAAQSGPGTSTEAELGRYRVS |
| Ga0099827_102971201 | 3300009090 | Vadose Zone Soil | MERLVRVEFGPSWSKRFGQALAEARSGVGECSELEPGRYRTSFVLGED |
| Ga0099827_106197333 | 3300009090 | Vadose Zone Soil | MERVVTVEFGPSRSKRFGEAVAEARSGAGECRELAPNRYQTRFLLGKDAGAY |
| Ga0099827_109928481 | 3300009090 | Vadose Zone Soil | MERVMTVEFGPSRSKRFGRALVEARSRAGECSEVEPGRY |
| Ga0099827_110088252 | 3300009090 | Vadose Zone Soil | VERLLTVVFGPSRSKRFEKAVAEARNGAGEFRELDPGKYRTRFVLD |
| Ga0099827_117638171 | 3300009090 | Vadose Zone Soil | VEFGPSRSKRFGKALAEAGNGPGECSELEPGRYRASFVLGSDAVAYT |
| Ga0066709_1037332671 | 3300009137 | Grasslands Soil | MERVVTVEFGPSRSKRFGRAVADARGQAGECTEVEPGRYRANVVLGTNA |
| Ga0116128_11944421 | 3300009518 | Peatland | MERMVCVVFGPSRSKRFGKAVAEAHSGAGECSEVEP |
| Ga0126306_101133971 | 3300010166 | Serpentine Soil | VVWVERLFTVEFGPSRSKRFGKAVAEAQKGAHECSEVEPGRYRARFRLGED |
| Ga0137393_116725131 | 3300011271 | Vadose Zone Soil | VERVLTVEFGPSRSKRFGAAVAVARSGPGECTELEPGRYQVSFPLGSAAETYSGLGR |
| Ga0120157_10866841 | 3300011994 | Permafrost | MERVVTVEFGPSRSKRFGEAVAEARSGAGECSELALDGYRTRARGTF* |
| Ga0120156_10194091 | 3300011996 | Permafrost | MEPLMTVEFGPSRSKRFGRALAEARSRAGECSELEPGRYRARFVLGTDSAAYTG |
| Ga0120156_10762332 | 3300011996 | Permafrost | MERLMTVEFGPSRSKRFGRALAEARSRAGECSELEPGRYRARFVLGTDSAAYTG |
| Ga0120174_10765671 | 3300012008 | Permafrost | MGRLVTVEFGPSRSRRFGRALSEARSGAGQCREVEPGRDRARFVLG |
| Ga0120159_11117291 | 3300012014 | Permafrost | LFRVVEMERLLTVEFGPSRSKRFAKAVAEARSGAGECSEVEPGRYRTTFALDKDSAVY |
| Ga0136623_102929381 | 3300012045 | Polar Desert Sand | MERPLTVEFGPSRSKRFGKALALAQSGPGECTEIEPGRY |
| Ga0137364_114016301 | 3300012198 | Vadose Zone Soil | LVRVGPVERVLTVEFGPSRSKRFVKAVAEAQSGAGECNALEPGSY |
| Ga0137383_105915332 | 3300012199 | Vadose Zone Soil | MERLVTVEFGPSRSKRFGKAVAEAQSGPGECRELEPDRYRVSFLLGT |
| Ga0137365_105444202 | 3300012201 | Vadose Zone Soil | MERVFTVEFGPSRSKRFGKALAEARRLARDCSEVEPGSYRARFALGTDSAA |
| Ga0137381_108808212 | 3300012207 | Vadose Zone Soil | MERLVTVAFGPSRSKRFGKAVIEARKGGECAEVESSRYRASF |
| Ga0137376_102255241 | 3300012208 | Vadose Zone Soil | MDRLFTVEFGPSRSKRFGRALADARRVAREYSEVEPGRYRARF |
| Ga0137379_115970171 | 3300012209 | Vadose Zone Soil | MERLFTVEFGPSRSKRFGRALDEARRLARECSEVEPGKYRARFALGTGTS* |
| Ga0137372_102123103 | 3300012350 | Vadose Zone Soil | MERRMTVEFGPSRSKRFGKAVAEAQSGPGECRELEPGRYRVSFLLGED |
| Ga0137372_108188321 | 3300012350 | Vadose Zone Soil | MERLVTVEFGPSRSRRFGRALAEARSGAGEYSEVESGRHRVSFTL |
| Ga0137367_103022712 | 3300012353 | Vadose Zone Soil | MERVVTVKFGPSRSKRFGRAVADARGQAGECIEVEPGRYRANFV |
| Ga0137366_100734511 | 3300012354 | Vadose Zone Soil | MERQVTVEFGPSRSKRFGKAVVEARNGGECTEVEPGRYRVRFALGADSDAYT |
| Ga0137366_106660112 | 3300012354 | Vadose Zone Soil | MERLVTVEFGPSRSRRFGRALAEARSGAGEYSEVESGRHRVSFTLGTAAAAY |
| Ga0137366_107987411 | 3300012354 | Vadose Zone Soil | VIERQLTVEFGPSRSKRFAKAVMEAEGGAGECSELEPGHYRVRF |
| Ga0137371_108292181 | 3300012356 | Vadose Zone Soil | MARLVTVEFGPSRSRRFKRALAEAQSGVGEWSELEPGRYRVRFLLAERAV* |
| Ga0137384_115355152 | 3300012357 | Vadose Zone Soil | LVRVGWVERVLTVEFGPSRSKRFPKAVEEARSSAGECSELAPGSYRV |
| Ga0137385_116141851 | 3300012359 | Vadose Zone Soil | VIERQLTVEFGPSRSKRFGQAVAEAKRGAGESRELEPDRYRVSFLLGTE |
| Ga0137361_102904411 | 3300012362 | Vadose Zone Soil | MSGRVLTVDFGPSRSKRFRKAVAEAQRGPGQCSELEPG |
| Ga0137373_100469941 | 3300012532 | Vadose Zone Soil | VERLFTVEFGPSRSKRFGKALAEARLGARECSEVEPGRYRA |
| Ga0136614_106452332 | 3300012684 | Polar Desert Sand | MASVVAERVLIVEFGPSRSKRFGKAVAEAQSGAGQC |
| Ga0120150_10593761 | 3300013294 | Permafrost | MERRLTVEFGPSRSKRFAKAVAAAQSGPGECQELEPGRYRVSFV |
| Ga0120154_10376292 | 3300013501 | Permafrost | MERLITVEFGPSRSKRFGRALVEARSRAGECSELEPGRY |
| Ga0120154_10950432 | 3300013501 | Permafrost | MERLMTVEFGPSRSKRFGRALVEARSRAGESSGLEPG |
| Ga0120147_10644241 | 3300013758 | Permafrost | MGSVLGWISLVWMERLLTVEFGPSRSKRFGRAVAEAQSGAGECSEVEPGRY |
| Ga0120172_10042826 | 3300013765 | Permafrost | VERVLIVVFGPSRSKRFRKAVEEARSGAGECSEIEPGSYRVRFVLGRDGRVY |
| Ga0120172_10478334 | 3300013765 | Permafrost | LVKRVLTVEFGPSRSKRFRKAVEEAQSGAGECSELEPGSYRVRFVLGSDGRVY |
| Ga0120172_10793132 | 3300013765 | Permafrost | VERVLTVEFGPSRSKRFRKAVEEAQSGAGDCGELKPGSYR |
| Ga0120172_11243141 | 3300013765 | Permafrost | VERVLTVEFGPSRSKRFAKAVAEAQSGGGECSELEPGSYRVRFV |
| Ga0120155_10678071 | 3300013768 | Permafrost | MERLITVEFGPSRSKRFGRALAEARSRAGECSELEPGRYRARFVLGADSAVYT |
| Ga0120123_11830531 | 3300013770 | Permafrost | VERLLTVEFGPSRSKRFGKAVEEARSGAGECSELEPGSYRVRFL |
| Ga0120158_101458044 | 3300013772 | Permafrost | VERVLTVEFGPSRSKRFHKAVEEAQSGAGECGELEPGRYRVRFVLGSDGSVYT |
| Ga0120125_11176851 | 3300014056 | Permafrost | VERVLTVEFGPSRSKRLPKAVEEAQSGAGECGELEPGSYRGRFVLGSDGC |
| Ga0120149_10372093 | 3300014058 | Permafrost | VERVLTVEFGPSRSKRFKKAVEEACGGAGECSELEPGSYRVRFVLGSDRSVYTSLARL |
| Ga0120149_11371482 | 3300014058 | Permafrost | VERVLTVEFGPSRSKRFAKAVAEAQSGGSECSEREP |
| Ga0120170_10231561 | 3300014823 | Permafrost | MVSVEFGPSRSTRFGKALAEAQGGPGECSELEPGRYRTRFLLGQDAAAYTSLA |
| Ga0120171_10631251 | 3300014827 | Permafrost | MERLVRVEFGPSRSKRFGRALAEARSGVGECSEVEPGRY |
| Ga0120171_10868851 | 3300014827 | Permafrost | MERVVTVEFGPSRSRRFGKAVDEARSGAGECSELAANRYRTRFALGRDCGAY |
| Ga0120171_11028981 | 3300014827 | Permafrost | MVSVEFGPSRSTRFGKALAEAQGGPGECSELEPGRYRTRFL |
| Ga0136617_113213201 | 3300017789 | Polar Desert Sand | MERPLTVEFGPSRSKRFGKTLTLAQSGPGECTEIEPGRYRVRFLLAREAALYGAL |
| Ga0184633_103473583 | 3300018077 | Groundwater Sediment | MERPLTVEFGPSRSKRFGKALALAQGGPGECSEIEPGRYRV |
| Ga0184633_106095331 | 3300018077 | Groundwater Sediment | VERLLTVEFGPSRSKRFAKAVAEAKSGVGECSELEPGRYRVRFIL |
| Ga0184627_103726351 | 3300018079 | Groundwater Sediment | MERLLTVEFGPSRSKRFAKAVALAQGGLGECSEIEPGRYRVTFLLAS |
| Ga0184625_101998563 | 3300018081 | Groundwater Sediment | VIEVERPLTVEFGPSRSKRFAKALALAQGGPGECTESEP |
| Ga0184639_105664322 | 3300018082 | Groundwater Sediment | MERPLTVEFGPSRSKRFGKAVALAQSGPGECSESEPD |
| Ga0066662_128876691 | 3300018468 | Grasslands Soil | VVERLLKVEFGPSRSKRFGKALARAQSGPGECTEVEPGRYRVSFLLG |
| Ga0066669_120938161 | 3300018482 | Grasslands Soil | VERVLTVEFGPSRSKRFAKAVAEAQSGGGELSELEPGSYRVRFVLGSGGSAY |
| Ga0193728_13626651 | 3300019890 | Soil | MERLLTVEFGPSRSKRFGKALDEARRLARECSEVEPG |
| Ga0209640_100199648 | 3300025324 | Soil | VARVRFLTVVFGPSRSKRFGKAVAEAQGGAGECSELAPGRYRARFVLGEDAAAT |
| Ga0208563_10108473 | 3300025501 | Peatland | VERVLTVEFGPSRSTRFRKAVEEARSGAGECSELEPGSYRMRFVLGSDGRIYTSLARL |
| Ga0208584_10569754 | 3300025533 | Arctic Peat Soil | MVWMERLLTVEFGPSRSTRFGKVVALAESGAGECTEPE |
| Ga0207926_10553221 | 3300025619 | Arctic Peat Soil | LVSLVWMERMVCVVFGPSRSKRFGKAVAEAQTGADECSEVESGRFRAGFLLS |
| Ga0209887_10629991 | 3300027561 | Groundwater Sand | MEWLVSVEFGPSRSKRFGKALAEAQSGSGECREVEPGRYRVSFVLGEEEAAYAL |
| Ga0209283_107513432 | 3300027875 | Vadose Zone Soil | VERVLTVEFGPSRSRRFAKAVEEARSGAGECSELAPG |
| Ga0209590_108374091 | 3300027882 | Vadose Zone Soil | MERLLTVEFGPSRSKRFGKALAEARRGARECTEVEPG |
| Ga0307293_101354152 | 3300028711 | Soil | MERHVTVEFGPSRSKRFGKAVVEARNGGECTEVEPGRYRAR |
| Ga0307299_102915631 | 3300028793 | Soil | MERLFTVEFGPSRSKRFDKAVAEARRLARECTEVEPGRYRA |
| Ga0307287_102446211 | 3300028796 | Soil | MERRLTVEFGPSRSKRFAKAVAAAQSGPGECQELEPGRYRVSFLLGSDAA |
| Ga0307305_103022622 | 3300028807 | Soil | MERVLTVEFGPSRSERFGKAVAEARSGAGECRELAPNRYRTRFALGRDSGV |
| Ga0307305_103844101 | 3300028807 | Soil | MERVVTVEFGPSRSERFGKAVAEARSGAGEYSELAPNRYRTRFALGR |
| Ga0307302_103808251 | 3300028814 | Soil | MERQLTVEFGPSRSKRFAKAVAEAQSGPGECRELEPDRYRVSFLLGKEASVYVG |
| Ga0307302_106898041 | 3300028814 | Soil | VLSVERLLTVEFGPSRSKRFGKALAEARSRAGECTE |
| Ga0307312_100497673 | 3300028828 | Soil | MERVVTVEFGPSRSERFGKAVAEARSGAGEYSELAPNRYRTRFAL |
| Ga0307312_100722202 | 3300028828 | Soil | VERLVTVAFGPSRSKRFGRALAEARRAGECTEVEPGRYRARFVLGEDSEQA |
| Ga0307289_101925302 | 3300028875 | Soil | MERRLTVEFGPSRSKRFAKAVAAAQSGPGECQELEPGRYRVSFLLGSDA |
| Ga0307278_100005803 | 3300028878 | Soil | VERRFTVEFGPSRSKRFGKAVVEAQRGADECREREPGRYRATFRLAAEPAA |
| Ga0307278_100634171 | 3300028878 | Soil | MERVLTVEFGPSRSERFGKAVAEARSGAGECRELAPNRYRTRFALGRDSGVYTGLA |
| Ga0307278_104610302 | 3300028878 | Soil | MERQLTVEFGPSRSKRFGKALAEAENGPGECSELEPGR |
| Ga0318516_104068701 | 3300031543 | Soil | MERLFTVEFGPSRSNRFVKAVARAQADPGECTEIDHGRYR |
| Ga0318552_103902592 | 3300031782 | Soil | MERLFTVVFGPSRSNRFGKAVARALAGPGECTKVEPGRYRVRFQL |
| Ga0214473_118823421 | 3300031949 | Soil | MERLLRVEFGPSRSKRFGKAVALAQGGPGECAESEPGRYRVTF |
| Ga0311301_127694411 | 3300032160 | Peatlands Soil | VTVEFGPSRSKRFGKALDEALNGAGECSEIEPGRYRVRFVLATDPGVY |
| Ga0364942_0263710_256_381 | 3300034165 | Sediment | MERLVTVEFGPSRSKRFGKALAEARSGAGECSEIEPGRYRR |
| ⦗Top⦘ |