Basic Information | |
---|---|
Family ID | F090316 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 108 |
Average Sequence Length | 44 residues |
Representative Sequence | MPDDLQREEELFLKALKEYKEKKSQEPTDKTTNTLPAVIAAVL |
Number of Associated Samples | 71 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 70.37 % |
% of genes near scaffold ends (potentially truncated) | 14.81 % |
% of genes from short scaffolds (< 2000 bps) | 75.00 % |
Associated GOLD sequencing projects | 68 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Predicted Viral (36.111 % of family members) |
NCBI Taxonomy ID | 10239 (predicted) |
Taxonomy | All Organisms → Viruses → Predicted Viral |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (21.296 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.037 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (35.185 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 62.79% β-sheet: 0.00% Coil/Unstructured: 37.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF13385 | Laminin_G_3 | 1.85 |
PF07460 | NUMOD3 | 0.93 |
PF06941 | NT5C | 0.93 |
PF01327 | Pep_deformylase | 0.93 |
PF04851 | ResIII | 0.93 |
PF13604 | AAA_30 | 0.93 |
PF13884 | Peptidase_S74 | 0.93 |
PF14279 | HNH_5 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.74 % |
Unclassified | root | N/A | 34.26 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352004|2199881200 | Not Available | 927 | Open in IMG/M |
2199352004|2199908449 | All Organisms → Viruses → Predicted Viral | 2853 | Open in IMG/M |
3300000401|BB_Man_B_Liq_inBBDRAFT_1002444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 3533 | Open in IMG/M |
3300001274|B570J13895_1001945 | All Organisms → Viruses → Predicted Viral | 2787 | Open in IMG/M |
3300001580|Draft_10290781 | Not Available | 705 | Open in IMG/M |
3300001970|GOS2248_10112280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Neptunevirus → Synechococcus virus SRIM50 | 839 | Open in IMG/M |
3300002408|B570J29032_109522724 | Not Available | 835 | Open in IMG/M |
3300002835|B570J40625_100734482 | Not Available | 878 | Open in IMG/M |
3300003430|JGI25921J50272_10016908 | All Organisms → Viruses → Predicted Viral | 2030 | Open in IMG/M |
3300005662|Ga0078894_10509951 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
3300005662|Ga0078894_11100361 | Not Available | 678 | Open in IMG/M |
3300005805|Ga0079957_1276859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 766 | Open in IMG/M |
3300006033|Ga0075012_10312623 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
3300006639|Ga0079301_1008398 | All Organisms → Viruses → Predicted Viral | 3956 | Open in IMG/M |
3300006639|Ga0079301_1092583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 932 | Open in IMG/M |
3300006641|Ga0075471_10199877 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
3300006916|Ga0070750_10430559 | Not Available | 547 | Open in IMG/M |
3300006917|Ga0075472_10037338 | All Organisms → Viruses → Predicted Viral | 2277 | Open in IMG/M |
3300007538|Ga0099851_1000567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 15464 | Open in IMG/M |
3300007539|Ga0099849_1209994 | Not Available | 729 | Open in IMG/M |
3300007960|Ga0099850_1029387 | All Organisms → Viruses → Predicted Viral | 2405 | Open in IMG/M |
3300007973|Ga0105746_1296864 | Not Available | 560 | Open in IMG/M |
3300008107|Ga0114340_1142346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 896 | Open in IMG/M |
3300008110|Ga0114343_1125194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 855 | Open in IMG/M |
3300008113|Ga0114346_1253662 | Not Available | 651 | Open in IMG/M |
3300008261|Ga0114336_1088407 | All Organisms → Viruses → Predicted Viral | 1484 | Open in IMG/M |
3300008261|Ga0114336_1093375 | All Organisms → Viruses → Predicted Viral | 1430 | Open in IMG/M |
3300008962|Ga0104242_1009030 | All Organisms → Viruses → Predicted Viral | 1770 | Open in IMG/M |
3300008962|Ga0104242_1043403 | Not Available | 762 | Open in IMG/M |
3300009001|Ga0102963_1226823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 742 | Open in IMG/M |
3300009009|Ga0105105_10227704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 979 | Open in IMG/M |
3300009124|Ga0118687_10457068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 500 | Open in IMG/M |
3300009169|Ga0105097_10026862 | All Organisms → Viruses → Predicted Viral | 3062 | Open in IMG/M |
3300010354|Ga0129333_10647488 | Not Available | 913 | Open in IMG/M |
3300010354|Ga0129333_10745004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 839 | Open in IMG/M |
3300010354|Ga0129333_10789018 | All Organisms → cellular organisms → Archaea → Asgard group | 811 | Open in IMG/M |
3300010354|Ga0129333_10910586 | Not Available | 743 | Open in IMG/M |
3300010354|Ga0129333_10916570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 740 | Open in IMG/M |
3300010354|Ga0129333_10992962 | Not Available | 706 | Open in IMG/M |
3300010354|Ga0129333_11113946 | Not Available | 659 | Open in IMG/M |
3300010354|Ga0129333_11173636 | Not Available | 638 | Open in IMG/M |
3300010354|Ga0129333_11404509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 574 | Open in IMG/M |
3300010354|Ga0129333_11565416 | Not Available | 539 | Open in IMG/M |
3300010354|Ga0129333_11635979 | Not Available | 525 | Open in IMG/M |
3300010354|Ga0129333_11724884 | Not Available | 509 | Open in IMG/M |
3300010354|Ga0129333_11769640 | Not Available | 501 | Open in IMG/M |
3300010370|Ga0129336_10493697 | Not Available | 660 | Open in IMG/M |
3300010370|Ga0129336_10710960 | Not Available | 532 | Open in IMG/M |
3300011268|Ga0151620_1072098 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
3300012000|Ga0119951_1018382 | All Organisms → Viruses → Predicted Viral | 2569 | Open in IMG/M |
3300012000|Ga0119951_1070853 | Not Available | 911 | Open in IMG/M |
3300012970|Ga0129338_1086335 | Not Available | 529 | Open in IMG/M |
3300013004|Ga0164293_10693668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 653 | Open in IMG/M |
3300013004|Ga0164293_10762385 | Not Available | 616 | Open in IMG/M |
3300013005|Ga0164292_10392760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → Pseudoalteromonas fuliginea | 928 | Open in IMG/M |
3300014819|Ga0119954_1013877 | All Organisms → Viruses → Predicted Viral | 1744 | Open in IMG/M |
3300017766|Ga0181343_1082560 | Not Available | 921 | Open in IMG/M |
3300017766|Ga0181343_1147652 | Not Available | 656 | Open in IMG/M |
3300020574|Ga0208221_1000007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Aurunvirus → Synechococcus virus STIM5 | 47838 | Open in IMG/M |
3300021961|Ga0222714_10079500 | All Organisms → Viruses → Predicted Viral | 2143 | Open in IMG/M |
3300022200|Ga0196901_1000312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 26133 | Open in IMG/M |
3300022752|Ga0214917_10015865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6498 | Open in IMG/M |
3300022752|Ga0214917_10137976 | All Organisms → Viruses → Predicted Viral | 1317 | Open in IMG/M |
3300022752|Ga0214917_10147619 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
3300022752|Ga0214917_10154952 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
3300024239|Ga0247724_1000011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 89329 | Open in IMG/M |
3300024239|Ga0247724_1004563 | All Organisms → Viruses → Predicted Viral | 2183 | Open in IMG/M |
3300024289|Ga0255147_1003972 | All Organisms → Viruses → Predicted Viral | 3436 | Open in IMG/M |
3300024306|Ga0255148_1010097 | All Organisms → Viruses → Predicted Viral | 1900 | Open in IMG/M |
3300024351|Ga0255141_1043567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 664 | Open in IMG/M |
3300024536|Ga0256338_1045462 | Not Available | 998 | Open in IMG/M |
3300025769|Ga0208767_1115576 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
3300026187|Ga0209929_1166501 | Not Available | 529 | Open in IMG/M |
3300027114|Ga0208009_1032523 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
3300027467|Ga0255154_1036057 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
3300027899|Ga0209668_10341693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 969 | Open in IMG/M |
3300031857|Ga0315909_10277428 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
3300031857|Ga0315909_10541549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 793 | Open in IMG/M |
3300031857|Ga0315909_10923637 | Not Available | 536 | Open in IMG/M |
3300032116|Ga0315903_10591877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 854 | Open in IMG/M |
3300033488|Ga0316621_10700381 | Not Available | 732 | Open in IMG/M |
3300033521|Ga0316616_102618169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 678 | Open in IMG/M |
3300033521|Ga0316616_104751165 | Not Available | 511 | Open in IMG/M |
3300033557|Ga0316617_100283197 | All Organisms → Viruses → Predicted Viral | 1390 | Open in IMG/M |
3300033557|Ga0316617_102654162 | Not Available | 521 | Open in IMG/M |
3300033816|Ga0334980_0017698 | All Organisms → Viruses → Predicted Viral | 3069 | Open in IMG/M |
3300033816|Ga0334980_0045171 | All Organisms → Viruses → Predicted Viral | 1869 | Open in IMG/M |
3300033978|Ga0334977_0002072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 11667 | Open in IMG/M |
3300033978|Ga0334977_0103822 | All Organisms → Viruses → Predicted Viral | 1517 | Open in IMG/M |
3300033981|Ga0334982_0030772 | All Organisms → Viruses → Predicted Viral | 3064 | Open in IMG/M |
3300033994|Ga0334996_0095646 | All Organisms → Viruses → Predicted Viral | 1739 | Open in IMG/M |
3300033994|Ga0334996_0219934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 999 | Open in IMG/M |
3300034021|Ga0335004_0187344 | All Organisms → Viruses → Predicted Viral | 1302 | Open in IMG/M |
3300034061|Ga0334987_0003389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 15327 | Open in IMG/M |
3300034072|Ga0310127_203627 | Not Available | 733 | Open in IMG/M |
3300034073|Ga0310130_0000643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 24667 | Open in IMG/M |
3300034073|Ga0310130_0005541 | All Organisms → Viruses → Predicted Viral | 4920 | Open in IMG/M |
3300034073|Ga0310130_0012818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 2852 | Open in IMG/M |
3300034073|Ga0310130_0073110 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
3300034073|Ga0310130_0084947 | Not Available | 946 | Open in IMG/M |
3300034073|Ga0310130_0302695 | Not Available | 509 | Open in IMG/M |
3300034102|Ga0335029_0097526 | All Organisms → Viruses → Predicted Viral | 2078 | Open in IMG/M |
3300034104|Ga0335031_0297416 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
3300034106|Ga0335036_0342860 | Not Available | 978 | Open in IMG/M |
3300034120|Ga0335056_0068003 | All Organisms → Viruses → Predicted Viral | 2269 | Open in IMG/M |
3300034200|Ga0335065_0860056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 503 | Open in IMG/M |
3300034272|Ga0335049_0735887 | Not Available | 592 | Open in IMG/M |
3300034283|Ga0335007_0001671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17246 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 21.30% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 13.89% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.33% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 6.48% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.63% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.63% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.63% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.63% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.63% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.63% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.70% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.85% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.85% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.93% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.93% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.93% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.93% |
Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 0.93% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.93% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.93% |
Bioluminescent Bay | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay | 0.93% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.93% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300000401 | Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B Liquid | Environmental | Open in IMG/M |
3300001274 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
3300001970 | Hypersaline microbial communities from Punta Cormorant, Floreana Island, Equador - GS033 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006033 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300020574 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2200063800 | 2199352004 | Freshwater | MPDDLQREEEILLKALKEHKEKKSQEPIVKPQDDTSNILPAVIAAVL |
2200090274 | 2199352004 | Freshwater | MPDDLQREEELFFKALEEYKEKKSQEPTDKTTNTLPTVIAAVL |
BB_Man_B_Liq_inBBDRAFT_10024446 | 3300000401 | Bioluminescent Bay | MTDDLQREEELLFKALEEYKEKKSQEPTDKTTNTLPAVIAAAL* |
B570J13895_10019458 | 3300001274 | Freshwater | MPDDLQREEEILLKALKEHKEKKSQEPIVKPQDDTSNILPAVIAAVL* |
Draft_102907814 | 3300001580 | Hydrocarbon Resource Environments | MPDDLQREEELLFKTLEEYKEKKSQEPTDKTTNTLPAVIAAAL* |
GOS2248_101122802 | 3300001970 | Hypersaline | MPDDLQREEELFFKALEEYKGKKSQEPTDKTTNTDKTTNTLPAVIAAVL* |
B570J29032_1095227241 | 3300002408 | Freshwater | MPDDLQREEELFFKALKKYKEKKTQEPTDKTTNILPAVIAAVL*PLQKIGLYIIVLG |
B570J40625_1007344823 | 3300002835 | Freshwater | MPDDLQREEELFFKALKKYKEKKTQEPTDKTTNILPAVIAAVL* |
JGI25921J50272_100169084 | 3300003430 | Freshwater Lake | MPDDLQREEELFLKALKEYKEKKSQEPTDKTTNTLPAVIAAVL* |
Ga0078894_105099512 | 3300005662 | Freshwater Lake | MPDDLQREEELFFKALEEYKEKKSQEPTDKTTNTLPAVIAAIL* |
Ga0078894_111003612 | 3300005662 | Freshwater Lake | MPDDLQREEELLLKALKEHKEKKSQEPTDKTTNTLPAVIAAVL* |
Ga0079957_12768593 | 3300005805 | Lake | MPDDLQIEEEIFLKALEEYKEKKSQEPTDKTTNTLPAVIAAVL* |
Ga0075012_103126236 | 3300006033 | Watersheds | MPDDLQREEELFFKALEEYKEKKSQEPTDKTTNTLPAVIAAVL* |
Ga0079301_10083981 | 3300006639 | Deep Subsurface | MPDDLQREEELFFKALKEYKEKKSQEPTDKTTNTLPAVIAAVL* |
Ga0079301_10925834 | 3300006639 | Deep Subsurface | MPDDLQREEEIFLKALKEYKEKKTQEPTDKTTNTLPAVIAAVL* |
Ga0075471_101998775 | 3300006641 | Aqueous | MPDDLQREEELFFKALEEYKEKKSQEPTDKTTNTLPTVIAAVL* |
Ga0070750_104305591 | 3300006916 | Aqueous | MPDDLQREEELFFKALEEYKEKKSQEPTDKTTNTLPAVIAAAL* |
Ga0075472_100373382 | 3300006917 | Aqueous | MPDDLQREEELFFKALEEYKKKKSQEPTDKTTNTLPTVIAAVL* |
Ga0099851_100056742 | 3300007538 | Aqueous | MPDDLQREEELFFKALEEYKEKKSQEPKDKTTNTLPAVIAAAL* |
Ga0099849_12099942 | 3300007539 | Aqueous | MPDDLQQEEELFFKALEEYKEKKSQEPTNKTTNTLPAVIAAAL* |
Ga0099850_10293871 | 3300007960 | Aqueous | EELLFKALKEYKEKKSQEPTDKTTNTLPAVIAAVL* |
Ga0105746_12968641 | 3300007973 | Estuary Water | MPYNTLIHKRQMPDDLQREEELFFKALEEYKEKKSQEPTDKTTNTLPAVIAAVL* |
Ga0114340_11423464 | 3300008107 | Freshwater, Plankton | MPDDLQIEEEIFLKALEEYKEKKSQEPKDKITNTLPAVIAAVL* |
Ga0114343_11251944 | 3300008110 | Freshwater, Plankton | MPDDLQREEEIFLKALEEYKEKKSQEPKDKITNTLPAVIAAVL* |
Ga0114346_12536623 | 3300008113 | Freshwater, Plankton | MPDDLQKEEELLLKALKEHKEKKSQEPIVKPQDDTSNILPAVIAAVL* |
Ga0114336_10884075 | 3300008261 | Freshwater, Plankton | MPDDLQKEEELLFKALKEHKEKKSQEPIVKPQDDTSNILPAVIAAVL* |
Ga0114336_10933754 | 3300008261 | Freshwater, Plankton | MPDDLQREEEIFLKALEEYKEKKSQEPTDKTTNTLPAVIAAAL* |
Ga0104242_10090302 | 3300008962 | Freshwater | MPDDLQREELFFKALKEYKEKKSQEPQDKTTNTLPAVIATVL* |
Ga0104242_10434031 | 3300008962 | Freshwater | EIFLKALKEHKEKKTQEPTDKTTNTLPAVIAAVL* |
Ga0102963_12268233 | 3300009001 | Pond Water | MPDDLQREEELFLKALKEYKEKKSQEPTDKTTNTLPAVIAAAL* |
Ga0105105_102277043 | 3300009009 | Freshwater Sediment | MPDDLQREEELFFKALEEYKEKKSQEPKDKTTNTLPAVIAAVL* |
Ga0118687_104570682 | 3300009124 | Sediment | MPDDLQREEELFFKALEEYKEKKSQEPTDKTTNTLPAVIAATL* |
Ga0105097_100268624 | 3300009169 | Freshwater Sediment | MPDDLQREEEIFLKALEEHKEKKSQEPKDKTTNTLPAVIAAVL* |
Ga0129333_106474885 | 3300010354 | Freshwater To Marine Saline Gradient | MPDDLQREEEILLKALKEHKEKKSQEPIVKPQDDTSNILPAIIAAVL* |
Ga0129333_107450042 | 3300010354 | Freshwater To Marine Saline Gradient | MPDDLQREEELFLKALEEYKEKKSQEPKDKTTNTLPAVIAAVL* |
Ga0129333_107890183 | 3300010354 | Freshwater To Marine Saline Gradient | MPDDLQEEEQIFLKALKEHKEKKSQEPIVKPQDDTSNILPAIIAATL* |
Ga0129333_109105863 | 3300010354 | Freshwater To Marine Saline Gradient | MPDDLQKEEELLFKALEVHKEKKSQEPKDKTTNSLPAVIAAVL* |
Ga0129333_109165703 | 3300010354 | Freshwater To Marine Saline Gradient | MPDDLQREEEIFLKALEEYVEKKSQEPKDKTPNTLPAVIASVL* |
Ga0129333_109929622 | 3300010354 | Freshwater To Marine Saline Gradient | MSDDLQREEELFLKALEEYKEKKSQEPQDKTTNTLPSVIAAVL* |
Ga0129333_111139461 | 3300010354 | Freshwater To Marine Saline Gradient | MPDDLQKEEELLFKALEEYKEKKSQEPIVKPQDDTSNIL |
Ga0129333_111736362 | 3300010354 | Freshwater To Marine Saline Gradient | MPDDLQREEEIFLKTLKEYKEKKTQEPTDKTTNTLPAVIAAVL* |
Ga0129333_114045093 | 3300010354 | Freshwater To Marine Saline Gradient | MPDDLQREEELFLKALEEYKEKKSQEPQDKTINTLPAVIAAVL* |
Ga0129333_115654162 | 3300010354 | Freshwater To Marine Saline Gradient | MPDDLQREEEIFLKALQEYKEKKSQEPTDKITNTLPAVIAAVL* |
Ga0129333_116359792 | 3300010354 | Freshwater To Marine Saline Gradient | MPDDLQREEEIFLKALEEHKEKKSQEPKDKTTNTLPAVIAAAL* |
Ga0129333_117248842 | 3300010354 | Freshwater To Marine Saline Gradient | MPDDLQREEEIFLKALKEHKEKKTQEPKDKTTNTLPAVIAAVL* |
Ga0129333_117696402 | 3300010354 | Freshwater To Marine Saline Gradient | MPDDLHEEEQIFLKALKEHKDKKSQEPIVKPQDDTSNILPAIIAATL* |
Ga0129336_104936974 | 3300010370 | Freshwater To Marine Saline Gradient | MPDDLQRQEELFLKALKEYKEKKTQEPTDKTTNTLPAVIAAVL* |
Ga0129336_107109601 | 3300010370 | Freshwater To Marine Saline Gradient | EEEIFLKALKEHKEKKTQEPTDKTTNTLPAVIAAVL* |
Ga0151620_10720984 | 3300011268 | Freshwater | MPDDLQREEEIFLKALKEYKKKKSQEPTDKTTNTLPAVIAAAL* |
Ga0119951_10183828 | 3300012000 | Freshwater | GWWKMPDDLQREELFFKALKEYKEKKSQEPQDKTTNTLPAVIATVL* |
Ga0119951_10708533 | 3300012000 | Freshwater | MPDDLQREEELFLKALKEHKEKKSQEPTDKTTNTLPAVIAAVL* |
Ga0129338_10863352 | 3300012970 | Aqueous | MPDDLQKEEELLFKALKEHKEKKSQEPTDKTTNILPAVIAAVL* |
Ga0164293_106936681 | 3300013004 | Freshwater | MSYDLQREEEIFLKALKEYKEKKSQEPTDKTTNTLPA |
Ga0164293_107623851 | 3300013004 | Freshwater | MPDDLQREEEIFLKALEEYKEKETQEPTDKTTNTLPAVIAAVL* |
Ga0164292_103927605 | 3300013005 | Freshwater | MPDDLQREEELFLKALKEYKEKKSQEPTDKTTNILPAVIAAVL* |
Ga0119954_10138773 | 3300014819 | Freshwater | LKNWHRRTHRALWMPYNTLIHKRQMPDDLQKEEELFLKALKEYKEKKSQEPKDKTTNTLPAVIAAVL* |
Ga0181343_10825603 | 3300017766 | Freshwater Lake | MPDDLQREEELLLKALKEHKEKKSQEPTDKTTNTLPAVIAAVL |
Ga0181343_11476522 | 3300017766 | Freshwater Lake | MPDDLQREEEIFLKALKEYKKKKTQEPTDKTTNILPAVIAAVL |
Ga0208221_100000713 | 3300020574 | Freshwater | MPDDLQREEELFLKALEEYKEKKSQEPKDKTTNTLPAVIAAVL |
Ga0222714_100795008 | 3300021961 | Estuarine Water | MPDDLQREEEIFLKALKEYKKKKSQEPTDKTTNTLPAVIAAAL |
Ga0196901_100031237 | 3300022200 | Aqueous | MPDDLQREEELFFKALEEYKEKKSQEPKDKTTNTLPAVIAAAL |
Ga0214917_1001586517 | 3300022752 | Freshwater | MPDDLQREELFFKALKEYKEKKSQEPQDKTTNTLPAVIATVL |
Ga0214917_101379764 | 3300022752 | Freshwater | LKNWHRRTHRALWMPYNTLIHKRQMPDDLQKEEELFLKALKEYKEKKSQEPKDKTTNTLPAVIAAVL |
Ga0214917_101476191 | 3300022752 | Freshwater | LEIEMPDDLQREEEIFLKALKEYKEKKSQEPTDKTTNTLPAVIAAVL |
Ga0214917_101549524 | 3300022752 | Freshwater | MPDDLQREEELFFKVLKEYKEKKLQEPTDKTTNTLPAVIAAVL |
Ga0247724_100001198 | 3300024239 | Deep Subsurface Sediment | MPDDLQREEELFFKALEEYKEKKSQEPKDKTTNTLPAVIAAVL |
Ga0247724_100456310 | 3300024239 | Deep Subsurface Sediment | MPDDLQREEELFFKALEEYKEKKSQEPKDKTTNTLPAVIAATL |
Ga0255147_10039724 | 3300024289 | Freshwater | MPDDLQREEEIFLKALKEYKEKKTQEPTDKTTNTLPAVIAAVL |
Ga0255148_10100977 | 3300024306 | Freshwater | LKIYGGRRMPDDLQREEELFFKALEEYKEKKSQEPKDKTTNTLPAVIAAVL |
Ga0255141_10435673 | 3300024351 | Freshwater | MLTREKSLKIYGGRRMPDDLQREEELFFKALEEYKEKKSQEPKDKTTNTLPAVIAAVL |
Ga0256338_10454626 | 3300024536 | Freshwater | DDLQREEEIFLKALKEYKEKKTQEPTDKTTNTLPAVIAAVL |
Ga0208767_11155762 | 3300025769 | Aqueous | VILPYNTLIHKRQMPDDLQREEELFFKALEEYKEKKSQEPTDKTTNTLPAVIAAAL |
Ga0209929_11665012 | 3300026187 | Pond Water | MPYNTFIHKSQMPDDLQREEELFLKALKEYKEKKSQEPTDKTTNTLPAVIAAAL |
Ga0208009_10325236 | 3300027114 | Deep Subsurface | MPDDLQREEELFFKALKEYKEKKSQEPTDKTTNTLPAVIAAVL |
Ga0255154_10360571 | 3300027467 | Freshwater | LKIYGGRRMPDDLQREEELFFKALEEYKEKKSQEPKDKTTN |
Ga0209668_103416933 | 3300027899 | Freshwater Lake Sediment | MSDDLQREEEMFLKALKEYKEKKSQEPTDKTTNTLPAVIAAVL |
Ga0315909_102774282 | 3300031857 | Freshwater | MPDDLRREEEIFLKALKEYKEKKSQEPTDKTTNILPAVIAAVL |
Ga0315909_105415492 | 3300031857 | Freshwater | MPDDLQREEELFFKALEEYKEKKSQEPKDKTINTLPAVIAAVL |
Ga0315909_109236371 | 3300031857 | Freshwater | EELFLKALKEYKEKKSQEPTDKTTNTLPAVIAAVL |
Ga0315903_105918773 | 3300032116 | Freshwater | MPDDLRREEEIFLKALKEYKEKKTQEPTDKTTNTLPAVIAAVL |
Ga0316621_107003812 | 3300033488 | Soil | MPDDLQKEEELLFKALEEYKEKKSQEPIVKPQDDTSNILPAIIAAVLXLSKKPK |
Ga0316616_1026181691 | 3300033521 | Soil | MPDDLQKEEELLFKALKEHKEKKSQEPIVKPQDDTSNILPAIISAVL |
Ga0316616_1047511653 | 3300033521 | Soil | KKMPDDLQREEELFLKALKEYKEKKTQEPTDKTTNTLPAVIAAVL |
Ga0316617_1002831972 | 3300033557 | Soil | MPDDLQREEELFFKALKECKEKKSQEPIVKIKDNTSDILPAVIAAVL |
Ga0316617_1026541622 | 3300033557 | Soil | MGCVLPYNTLIHKRQMPDDLQKEEELLFKALEEYKEKKSQEPIVKPQDDTSNILPAIIAAVL |
Ga0334980_0017698_326_457 | 3300033816 | Freshwater | MPDDLQRQEEILLKALEEYKEKKSQEPTDKTTNTLPAVIAAVL |
Ga0334980_0045171_506_637 | 3300033816 | Freshwater | MTDDLQKEEELLFKALEEYKEKKSQEPTDKTTNTLPAVIAAVL |
Ga0334977_0002072_11196_11327 | 3300033978 | Freshwater | MPDDLQREEEIFLKALEEHKEKKSQEPTDKTTNTLPAVIAAVL |
Ga0334977_0103822_891_1022 | 3300033978 | Freshwater | MPDDLQREEEIFLKALKEYKEKKSQEPTDKTTNTLPAVIAAVL |
Ga0334982_0030772_474_605 | 3300033981 | Freshwater | MPDDLQREEELFFKALKEYKEKKSQEPTDKTTNTLPAIIAAVL |
Ga0334996_0095646_1087_1218 | 3300033994 | Freshwater | MPDDLQREEELFFKALKKYKEKKTQEPTDKTTNILPAVIAAVL |
Ga0334996_0219934_75_218 | 3300033994 | Freshwater | MPDDLQKEEELLFKALKEHKEKKSQEPIVKPQDDTSNILPAIIAAVL |
Ga0335004_0187344_364_495 | 3300034021 | Freshwater | MPDDLQREEELFLKALKEYKEKKSQEPTDKTTNTLPAVIAAVL |
Ga0334987_0003389_3151_3282 | 3300034061 | Freshwater | MPDDLQREEEIFLKALEEYKEKKSQEPKDKTTNTLPAVIAAVL |
Ga0310127_203627_495_626 | 3300034072 | Fracking Water | MPDDLQIEEEIFLKALEEYKEKKSQEPKDKTTNTLPAVIAAVL |
Ga0310130_0000643_345_476 | 3300034073 | Fracking Water | MPDDLQREEELFFKALEEYKEKKSQEPTDKTTNTLPAVIAAAL |
Ga0310130_0005541_389_520 | 3300034073 | Fracking Water | MPDDLQREEELFLKVLKEYKEKKTQEPTDKTTNTLPAVIAAVL |
Ga0310130_0012818_845_976 | 3300034073 | Fracking Water | MPDDLQQEEELLLKALEKYKEKKSQELTDKKTNTLPAVICAVL |
Ga0310130_0073110_329_460 | 3300034073 | Fracking Water | MPDDLQREEELFLKAFEEYKEKKSQEPKDKTTNTLPAVIAAVL |
Ga0310130_0084947_727_858 | 3300034073 | Fracking Water | MPDDLQREEELFFKALEEYKEKKSQEPTDKITNTLPAVIAAAL |
Ga0310130_0302695_305_436 | 3300034073 | Fracking Water | MPDDLQREEKIFLKALKEYKEKKSQEPTDKTTNTLPAVIAAVL |
Ga0335029_0097526_118_249 | 3300034102 | Freshwater | MPDDLQREEELFFKALEEYKEKKSQEPTDKTTNILPAVIAAVL |
Ga0335031_0297416_518_649 | 3300034104 | Freshwater | MPDDLQREEELFFKALKEYKEKKSQEPKDKTTNTLPAVIAAVL |
Ga0335036_0342860_631_762 | 3300034106 | Freshwater | MPDDLQREEEIFLKALEEYKEKETQEPTDKTTNTLPAVIAAVL |
Ga0335056_0068003_1490_1621 | 3300034120 | Freshwater | MPDDLQREEEIFLKALEEYKEKKSQEPTDKTTNTLPAVIAAVL |
Ga0335065_0860056_34_165 | 3300034200 | Freshwater | MPDDLQREEELFFKCFEEYKEKKSQEPTDKTTNTLPAVIAAVL |
Ga0335049_0735887_483_590 | 3300034272 | Freshwater | MTDDLQKEEELLFKALEEYKEKKSQEPTDKTTNTLP |
Ga0335007_0001671_363_494 | 3300034283 | Freshwater | MPDDLQREEEIFLKALEEYVEKKSQEPKDKTTNTLPAVIAAAL |
⦗Top⦘ |