| Basic Information | |
|---|---|
| Family ID | F090234 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MEAFDEELNNYYESLEDSSECMECGVEVQLGKQYCCFSCLDASNR |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 53.70 % |
| % of genes from short scaffolds (< 2000 bps) | 73.15 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (40.741 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater (22.222 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.111 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.67% β-sheet: 24.44% Coil/Unstructured: 48.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF13481 | AAA_25 | 22.22 |
| PF11753 | DUF3310 | 13.89 |
| PF04404 | ERF | 9.26 |
| PF05065 | Phage_capsid | 5.56 |
| PF12684 | DUF3799 | 2.78 |
| PF05135 | Phage_connect_1 | 2.78 |
| PF01510 | Amidase_2 | 2.78 |
| PF04883 | HK97-gp10_like | 1.85 |
| PF05521 | Phage_H_T_join | 1.85 |
| PF04542 | Sigma70_r2 | 1.85 |
| PF13662 | Toprim_4 | 0.93 |
| PF01555 | N6_N4_Mtase | 0.93 |
| PF02195 | ParBc | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 5.56 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.85 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.85 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.85 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.85 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.93 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.26 % |
| Unclassified | root | N/A | 40.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10020747 | All Organisms → cellular organisms → Bacteria | 3840 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10260610 | Not Available | 539 | Open in IMG/M |
| 3300000929|NpDRAFT_10145068 | Not Available | 728 | Open in IMG/M |
| 3300001344|JGI20152J14361_10022190 | All Organisms → Viruses | 2289 | Open in IMG/M |
| 3300001344|JGI20152J14361_10034445 | All Organisms → Viruses → Predicted Viral | 1581 | Open in IMG/M |
| 3300001344|JGI20152J14361_10041101 | All Organisms → Viruses → Predicted Viral | 1343 | Open in IMG/M |
| 3300001344|JGI20152J14361_10060327 | Not Available | 928 | Open in IMG/M |
| 3300001348|JGI20154J14316_10042005 | All Organisms → Viruses → Predicted Viral | 2066 | Open in IMG/M |
| 3300001351|JGI20153J14318_10061121 | Not Available | 1272 | Open in IMG/M |
| 3300001351|JGI20153J14318_10075457 | Not Available | 1049 | Open in IMG/M |
| 3300001351|JGI20153J14318_10093939 | Not Available | 853 | Open in IMG/M |
| 3300001351|JGI20153J14318_10131912 | All Organisms → Viruses | 630 | Open in IMG/M |
| 3300003580|JGI26260J51721_1011493 | Not Available | 2258 | Open in IMG/M |
| 3300003580|JGI26260J51721_1013795 | All Organisms → Viruses → Predicted Viral | 1951 | Open in IMG/M |
| 3300003580|JGI26260J51721_1046047 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 700 | Open in IMG/M |
| 3300004097|Ga0055584_100484333 | All Organisms → Viruses → Predicted Viral | 1286 | Open in IMG/M |
| 3300004460|Ga0066222_1203989 | Not Available | 530 | Open in IMG/M |
| 3300005239|Ga0073579_1171200 | Not Available | 29373 | Open in IMG/M |
| 3300005837|Ga0078893_14527525 | All Organisms → Viruses → Predicted Viral | 1476 | Open in IMG/M |
| 3300006025|Ga0075474_10148109 | All Organisms → Viruses | 738 | Open in IMG/M |
| 3300006029|Ga0075466_1008491 | All Organisms → Viruses → Predicted Viral | 3557 | Open in IMG/M |
| 3300006754|Ga0098044_1018940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium stylosanthis | 3115 | Open in IMG/M |
| 3300006793|Ga0098055_1353217 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 546 | Open in IMG/M |
| 3300006803|Ga0075467_10006205 | Not Available | 8508 | Open in IMG/M |
| 3300006810|Ga0070754_10040754 | Not Available | 2519 | Open in IMG/M |
| 3300006810|Ga0070754_10200278 | Not Available | 930 | Open in IMG/M |
| 3300006874|Ga0075475_10010891 | Not Available | 4594 | Open in IMG/M |
| 3300006874|Ga0075475_10375201 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 575 | Open in IMG/M |
| 3300007229|Ga0075468_10003162 | All Organisms → Viruses | 7021 | Open in IMG/M |
| 3300007344|Ga0070745_1075618 | Not Available | 1344 | Open in IMG/M |
| 3300007344|Ga0070745_1109233 | Not Available | 1075 | Open in IMG/M |
| 3300007344|Ga0070745_1186512 | Not Available | 772 | Open in IMG/M |
| 3300007540|Ga0099847_1000736 | Not Available | 11131 | Open in IMG/M |
| 3300009074|Ga0115549_1273665 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 534 | Open in IMG/M |
| 3300009074|Ga0115549_1301822 | Not Available | 505 | Open in IMG/M |
| 3300009076|Ga0115550_1223600 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 625 | Open in IMG/M |
| 3300009086|Ga0102812_10175706 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300009423|Ga0115548_1075309 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300009434|Ga0115562_1009945 | Not Available | 5517 | Open in IMG/M |
| 3300009438|Ga0115559_1360147 | All Organisms → Viruses | 506 | Open in IMG/M |
| 3300011253|Ga0151671_1145799 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 546 | Open in IMG/M |
| 3300017749|Ga0181392_1155918 | All Organisms → Viruses | 667 | Open in IMG/M |
| 3300017772|Ga0181430_1105877 | Not Available | 835 | Open in IMG/M |
| 3300020165|Ga0206125_10015557 | All Organisms → Viruses | 4879 | Open in IMG/M |
| 3300020165|Ga0206125_10050111 | Not Available | 2034 | Open in IMG/M |
| 3300020165|Ga0206125_10132971 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
| 3300020166|Ga0206128_1032818 | All Organisms → Viruses → Predicted Viral | 2729 | Open in IMG/M |
| 3300020166|Ga0206128_1185376 | Not Available | 809 | Open in IMG/M |
| 3300020166|Ga0206128_1357841 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 502 | Open in IMG/M |
| 3300020175|Ga0206124_10187262 | All Organisms → Viruses | 821 | Open in IMG/M |
| 3300020175|Ga0206124_10315875 | All Organisms → Viruses | 593 | Open in IMG/M |
| 3300020182|Ga0206129_10021835 | Not Available | 4930 | Open in IMG/M |
| 3300021085|Ga0206677_10042897 | Not Available | 2413 | Open in IMG/M |
| 3300021371|Ga0213863_10003390 | Not Available | 11006 | Open in IMG/M |
| 3300021957|Ga0222717_10157167 | All Organisms → Viruses → Predicted Viral | 1379 | Open in IMG/M |
| 3300021957|Ga0222717_10160873 | All Organisms → Viruses → Predicted Viral | 1359 | Open in IMG/M |
| 3300021957|Ga0222717_10571708 | All Organisms → Viruses | 597 | Open in IMG/M |
| 3300021958|Ga0222718_10002279 | Not Available | 17402 | Open in IMG/M |
| 3300021959|Ga0222716_10466782 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 717 | Open in IMG/M |
| 3300022072|Ga0196889_1041084 | Not Available | 915 | Open in IMG/M |
| 3300022167|Ga0212020_1060709 | Not Available | 640 | Open in IMG/M |
| 3300022178|Ga0196887_1000487 | Not Available | 19248 | Open in IMG/M |
| 3300022218|Ga0224502_10449121 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 502 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10062999 | All Organisms → Viruses → Predicted Viral | 1521 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10247068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Cbastvirus → Cellulophaga virus ST | 781 | Open in IMG/M |
| 3300023698|Ga0228682_1009283 | All Organisms → Viruses → Predicted Viral | 1263 | Open in IMG/M |
| 3300024185|Ga0228669_1081478 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 620 | Open in IMG/M |
| 3300024191|Ga0228636_1003163 | All Organisms → Viruses → Predicted Viral | 4097 | Open in IMG/M |
| 3300024191|Ga0228636_1067901 | Not Available | 832 | Open in IMG/M |
| 3300024221|Ga0228666_1031298 | All Organisms → Viruses → Predicted Viral | 1194 | Open in IMG/M |
| 3300024226|Ga0228667_1012499 | All Organisms → Viruses → Predicted Viral | 1784 | Open in IMG/M |
| 3300024226|Ga0228667_1046324 | Not Available | 844 | Open in IMG/M |
| 3300024294|Ga0228664_1024687 | All Organisms → Viruses → Predicted Viral | 1679 | Open in IMG/M |
| 3300024314|Ga0228657_1058699 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 816 | Open in IMG/M |
| 3300024319|Ga0228670_1015258 | All Organisms → Viruses → Predicted Viral | 2064 | Open in IMG/M |
| 3300024319|Ga0228670_1057419 | Not Available | 861 | Open in IMG/M |
| 3300024328|Ga0228635_1003879 | All Organisms → Viruses | 6181 | Open in IMG/M |
| 3300024359|Ga0228628_1037267 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
| 3300025483|Ga0209557_1025098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Cbastvirus → Cellulophaga virus ST | 1829 | Open in IMG/M |
| 3300025543|Ga0208303_1004018 | Not Available | 5238 | Open in IMG/M |
| 3300025577|Ga0209304_1001606 | Not Available | 13403 | Open in IMG/M |
| 3300025594|Ga0209094_1054556 | All Organisms → Viruses | 1023 | Open in IMG/M |
| 3300025594|Ga0209094_1083059 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 754 | Open in IMG/M |
| 3300025620|Ga0209405_1003663 | Not Available | 9244 | Open in IMG/M |
| 3300025621|Ga0209504_1060549 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
| 3300025637|Ga0209197_1037387 | Not Available | 1771 | Open in IMG/M |
| 3300025645|Ga0208643_1002332 | Not Available | 9507 | Open in IMG/M |
| 3300025696|Ga0209532_1068598 | All Organisms → Viruses → Predicted Viral | 1331 | Open in IMG/M |
| 3300025815|Ga0208785_1096570 | All Organisms → Viruses | 735 | Open in IMG/M |
| 3300025860|Ga0209119_1081084 | Not Available | 1498 | Open in IMG/M |
| 3300026479|Ga0228622_1047988 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1006 | Open in IMG/M |
| 3300026483|Ga0228620_1085873 | All Organisms → Viruses | 659 | Open in IMG/M |
| 3300026503|Ga0247605_1053707 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300026506|Ga0228604_1041252 | All Organisms → Viruses | 721 | Open in IMG/M |
| 3300026511|Ga0233395_1131754 | Not Available | 608 | Open in IMG/M |
| 3300028125|Ga0256368_1059141 | Not Available | 667 | Open in IMG/M |
| 3300028131|Ga0228642_1026543 | All Organisms → Viruses → Predicted Viral | 1667 | Open in IMG/M |
| 3300028280|Ga0228646_1063944 | All Organisms → Viruses | 909 | Open in IMG/M |
| 3300028297|Ga0228617_1101001 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 705 | Open in IMG/M |
| 3300028337|Ga0247579_1095887 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 581 | Open in IMG/M |
| 3300028416|Ga0228614_1013592 | All Organisms → Viruses → Predicted Viral | 2210 | Open in IMG/M |
| 3300028598|Ga0265306_10438512 | Not Available | 713 | Open in IMG/M |
| 3300028599|Ga0265309_10074137 | Not Available | 1959 | Open in IMG/M |
| 3300028599|Ga0265309_10473461 | Not Available | 830 | Open in IMG/M |
| 3300028599|Ga0265309_10799478 | Not Available | 644 | Open in IMG/M |
| 3300031658|Ga0307984_1067478 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
| 3300032277|Ga0316202_10189745 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 954 | Open in IMG/M |
| 3300034375|Ga0348336_096123 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Hymenobacter → Hymenobacter lapidiphilus | 1019 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 22.22% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 17.59% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 11.11% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 11.11% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 8.33% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.63% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.70% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 3.70% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.85% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.85% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.85% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.85% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.93% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.93% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.93% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.93% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.93% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.93% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.93% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.93% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.93% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023698 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024185 | Seawater microbial communities from Monterey Bay, California, United States - 84D | Environmental | Open in IMG/M |
| 3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
| 3300024221 | Seawater microbial communities from Monterey Bay, California, United States - 80D | Environmental | Open in IMG/M |
| 3300024226 | Seawater microbial communities from Monterey Bay, California, United States - 81D | Environmental | Open in IMG/M |
| 3300024294 | Seawater microbial communities from Monterey Bay, California, United States - 78D | Environmental | Open in IMG/M |
| 3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
| 3300024319 | Seawater microbial communities from Monterey Bay, California, United States - 85D | Environmental | Open in IMG/M |
| 3300024328 | Seawater microbial communities from Monterey Bay, California, United States - 44D | Environmental | Open in IMG/M |
| 3300024359 | Seawater microbial communities from Monterey Bay, California, United States - 34D | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025637 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300026479 | Seawater microbial communities from Monterey Bay, California, United States - 26D | Environmental | Open in IMG/M |
| 3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026506 | Seawater microbial communities from Monterey Bay, California, United States - 4D | Environmental | Open in IMG/M |
| 3300026511 | Seawater microbial communities from Monterey Bay, California, United States - 27D | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028131 | Seawater microbial communities from Monterey Bay, California, United States - 53D | Environmental | Open in IMG/M |
| 3300028280 | Seawater microbial communities from Monterey Bay, California, United States - 58D | Environmental | Open in IMG/M |
| 3300028297 | Seawater microbial communities from Monterey Bay, California, United States - 18D | Environmental | Open in IMG/M |
| 3300028337 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 38R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028416 | Seawater microbial communities from Monterey Bay, California, United States - 15D | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100207476 | 3300000101 | Marine | MCIVDHELNEHLDSLEQRSECMECGVDVSLGKHYCCFSCLNASNR* |
| DelMOSum2010_102606101 | 3300000101 | Marine | MEAFDEELNNYYESLEDSSECMECGVEVQLGKQYCCFSCLDASNR* |
| NpDRAFT_101450682 | 3300000929 | Freshwater And Marine | MCIVDHELNEHLDSLEERSECMECGVDVSLGKHYCCFSCLNASNR* |
| JGI20152J14361_100221905 | 3300001344 | Pelagic Marine | MDVFDHQLNEHLESSEQKSECMECGVDVQLGKQYCCFGCFDSSNR* |
| JGI20152J14361_100344452 | 3300001344 | Pelagic Marine | MEAFDEELNNYYESLEDSSECMECGIEVQLGKQYCCFSCLDASNR* |
| JGI20152J14361_100411012 | 3300001344 | Pelagic Marine | MEAFDEELNEYYXSLEESSECMXCGIEVQLGKRYCCFSCLDASNR* |
| JGI20152J14361_100603272 | 3300001344 | Pelagic Marine | DEELNEYYNSLEESSECMECGIEVQLGKRYCCFSCLDASNR* |
| JGI20154J14316_100420053 | 3300001348 | Pelagic Marine | MEAFDEELNNYYESLEDNSECMECGIEVQLGKQYCCFSCLDASNR* |
| JGI20153J14318_100611211 | 3300001351 | Pelagic Marine | MDVFNHQLNEHLESSEQKSECMECGVDVQLGKQYCCFG |
| JGI20153J14318_100754571 | 3300001351 | Pelagic Marine | MDVFDHQLNEHLESSEQKSECMECGVDVQLGKQYCCFG |
| JGI20153J14318_100939392 | 3300001351 | Pelagic Marine | MEAFDEELNEYYNSLEESSECMECGIEIQLGKRYCCFSCFDSSNK* |
| JGI20153J14318_101319122 | 3300001351 | Pelagic Marine | HQLNEHLESSEQKSECMECGVDVQLGKQYCCFGCFDSSNR* |
| JGI26260J51721_10114934 | 3300003580 | Marine | MCIVDHELNDHLDSLEEKSECMQCGVDVSLGKDYCCFSCLNASNR* |
| JGI26260J51721_10137953 | 3300003580 | Marine | MEAFDEELNNYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR* |
| JGI26260J51721_10460472 | 3300003580 | Marine | MEAFDEELNNYYESLEDNSECMECGVEIQLGKQYCCFSCLDASNR* |
| Ga0055584_1004843333 | 3300004097 | Pelagic Marine | MEAFDEELNEYYNSLEESSECMECGIEVQLGKRYCCFSCLDASNR* |
| Ga0066222_12039891 | 3300004460 | Marine | MEAFDEELNNYYESLEESSDCMECGVEVQLGKRYCCFSCLDASNR* |
| Ga0073579_11712002 | 3300005239 | Marine | MEIFDEELNNYYESLEDNSECMECGIDVQLGKQYCCFSCLDASNR* |
| Ga0078893_145275253 | 3300005837 | Marine Surface Water | MEVFDEELNEYYKSLEECSECMECGVQVQLGKKYCCFSCLDASNR* |
| Ga0075474_101481092 | 3300006025 | Aqueous | IIMEGLDYDLNEYFDSIEDKSECMECGVDVQLGKQYCCFGCFNASHR* |
| Ga0075466_10084913 | 3300006029 | Aqueous | MDVFDHQLNEHLESSEENSECMECGVDVQLGKQYCCFNCFNASNR* |
| Ga0098044_101894010 | 3300006754 | Marine | MCIVDHELNEHLDSLEEKSECMECGVDVQLGKHYCCFSCLNASNR* |
| Ga0098055_13532171 | 3300006793 | Marine | NNYYEYLEDNSECMECGIEIQLGKQYCCFSCLDASNR* |
| Ga0075467_100062051 | 3300006803 | Aqueous | EVMCIVDHELNEHLDSLEQKSECMECGVDVSLGKHYCCFSCLNASNR* |
| Ga0070754_100407543 | 3300006810 | Aqueous | MEGLDYDLNEYFDSIEDKSECMECGVDVQLGKQYCCFGCFNASHR* |
| Ga0070754_102002783 | 3300006810 | Aqueous | MEGLDYDLNEYFDSIEDKSECMECGVDVQLEKQYCCFGCFNASHR* |
| Ga0075475_1001089112 | 3300006874 | Aqueous | YDLNEYFDSIEDKSECMECGVDVQLGKQYCCFGCFNASHR* |
| Ga0075475_103752011 | 3300006874 | Aqueous | MEGLDYDLNEYFDSIEDKSECMECGVDVQLGKQYC |
| Ga0075468_1000316214 | 3300007229 | Aqueous | MCIVDHELNEHLDSLEQKSECMECGVDVSLGKHYCCFSCLNASNR* |
| Ga0070745_10756181 | 3300007344 | Aqueous | LDYDLNEYFDSIEDKSECMECGVDVQLGKQYCCFGCFNASHR* |
| Ga0070745_11092331 | 3300007344 | Aqueous | MEGLDYDLNEYFDSIEDKSECMECGVDVQLGKQYCC |
| Ga0070745_11865121 | 3300007344 | Aqueous | MEGLDYDLNEYFDSIEDKSECMECGVDVQLGKQYCCFGCFNASH |
| Ga0099847_100073614 | 3300007540 | Aqueous | MEVFDQELNNHLEETSDCMECGVEIQLGKRYCCFSCFDSSNR* |
| Ga0115549_12736652 | 3300009074 | Pelagic Marine | LFYYNTMEAFDEELNEYYNSLEESSECMECGIEVQLGKRYCCFSCLDASNR* |
| Ga0115549_13018222 | 3300009074 | Pelagic Marine | TMEAFDEELNEYYNSLEESSECMECGIEIQLGKRYCCFSCFDSSNR* |
| Ga0115550_12236002 | 3300009076 | Pelagic Marine | MEAFDEELNNYFESLEDSSECMECGIEVQLGKQYCCFSCLDASNR* |
| Ga0102812_101757063 | 3300009086 | Estuarine | TMEAFDEELNNYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR* |
| Ga0115548_10753093 | 3300009423 | Pelagic Marine | YNTMEAFDEELNEYYNSLEESSECMECGIEVQLGKRYCCFSCLDASNR* |
| Ga0115562_10099452 | 3300009434 | Pelagic Marine | MEVFDEELNKHYRSLDESSECMECGIEVQLGKRYCCFSCLDASNR* |
| Ga0115559_13601472 | 3300009438 | Pelagic Marine | RKKEVMCIVDHELNEHLDSLEERSECMECGVDVSLGKHYCCFSCLNASNR* |
| Ga0151671_11457992 | 3300011253 | Marine | MAVFDEELNEYYKSLEESSECMECGIEVQLGKRYCCFSCLDASNR* |
| Ga0181392_11559183 | 3300017749 | Seawater | MCIVDHELNEHLDSLEERNECMECGVDVSLGKHYCCFSCL |
| Ga0181430_11058773 | 3300017772 | Seawater | MEAFDEELNNYYESLEDNSECMECGIEIQLGKQYCCFSCIDASNR |
| Ga0206125_100155579 | 3300020165 | Seawater | MDVFNHQLNEHLESSEQKSECMECGVDVQLGKQYCCFGCFDSSNR |
| Ga0206125_100501114 | 3300020165 | Seawater | MDVFDHQLNEHLESSEEKSECMECGVDVQLGKQYCCFNCFNASNR |
| Ga0206125_101329712 | 3300020165 | Seawater | YYNTMEAFDEELNEYYNSLEESSECMECGIEVQLGKRYCCFSCLDASNR |
| Ga0206128_10328186 | 3300020166 | Seawater | DEELNNYYESLEDNSECMECGIEVQLGKQYCCFSCLDASNR |
| Ga0206128_11853761 | 3300020166 | Seawater | MEAFDEELNNYYESLEDNSECMECGIEVQLGKQYCCFSCLDASNR |
| Ga0206128_13578411 | 3300020166 | Seawater | NNYYESLEDNSECMECGIEVQLGKQYCCFSCLDASNR |
| Ga0206124_101872623 | 3300020175 | Seawater | ELNEHLDSLEERSECMECGVDVSLGKHYCCFSCLNASNR |
| Ga0206124_103158751 | 3300020175 | Seawater | EVMCIVDHELNEHLDSLEERSECMECGVDVSLGKHYCCFSCLNASNR |
| Ga0206129_1002183513 | 3300020182 | Seawater | MCIVDHELNEHLDSLEERSECMECGVDVSLGKHYCCFSCLNASNR |
| Ga0206677_100428976 | 3300021085 | Seawater | MCIVDHELNEHLDSLEERNECMECGVDVSLGKHYCCFSCLNASNR |
| Ga0213863_1000339013 | 3300021371 | Seawater | MEGLDYDLNEDLDSLEEKSECMECGVDVQLGKHYCCFSCLNASNR |
| Ga0222717_101571671 | 3300021957 | Estuarine Water | LNNYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR |
| Ga0222717_101608733 | 3300021957 | Estuarine Water | MEAFDEELNNYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR |
| Ga0222717_105717081 | 3300021957 | Estuarine Water | MCIVDHELNEHLDSLEEKSECMECGVDVSLGKHYCCFSCLNASNR |
| Ga0222718_1000227929 | 3300021958 | Estuarine Water | MEVFDKELNEYHKSLEESSECMECGVEVQLGKRYCCFSCLDASNR |
| Ga0222716_104667821 | 3300021959 | Estuarine Water | ELNNYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR |
| Ga0196889_10410841 | 3300022072 | Aqueous | EELNNYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR |
| Ga0212020_10607091 | 3300022167 | Aqueous | MEGLDYDLNEYFDSIEDKSECMECGVDVQLGKQYCCFGCFNASHR |
| Ga0196887_100048714 | 3300022178 | Aqueous | MCIVDHELNEHLDSLEQKSECMECGVDVSLGKHYCCFSCLNASNR |
| Ga0224502_104491211 | 3300022218 | Sediment | DEELNNYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR |
| (restricted) Ga0233412_100629992 | 3300023210 | Seawater | MMEVFDEELNNYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR |
| (restricted) Ga0233412_102470681 | 3300023210 | Seawater | HELNDHLDSLEEKSECMQCGVDVSLGKDYCCFSCLNASNR |
| Ga0228682_10092831 | 3300023698 | Seawater | MEAFDEELNNYYESLEDNSECMECGIEIQLGKQYCCFSC |
| Ga0228669_10814781 | 3300024185 | Seawater | TMEAFDEELNNYYESLEDNSECMECGVEIQLGKQYCCFSCLDASNR |
| Ga0228636_100316310 | 3300024191 | Seawater | MEVFDEELNEYYKSLEESSECMECGIEVQLGKRYCCFSCLDASNR |
| Ga0228636_10679012 | 3300024191 | Seawater | NYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR |
| Ga0228666_10312981 | 3300024221 | Seawater | NTMEAFDEELNNYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR |
| Ga0228667_10124991 | 3300024226 | Seawater | MEAFDEELNNYYESLEDNSECMECGVEIQLGKQYCCFSCLDASNR |
| Ga0228667_10463242 | 3300024226 | Seawater | LPLFYYNTMEAFDEELNNYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR |
| Ga0228664_10246872 | 3300024294 | Seawater | MEVFDEELNEYYRSLEESSECMECGIEVQLGKRYCCFSCLDASNR |
| Ga0228657_10586991 | 3300024314 | Seawater | MDVFDHQLNEHLESSEEKSECMECGVDVQLGKQYCCFGCFDSSNR |
| Ga0228670_10152583 | 3300024319 | Seawater | MEVFDEELNNYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR |
| Ga0228670_10574192 | 3300024319 | Seawater | KLPLFYYNTMEAFDEELNNYYESLEDNSECMECGVEIQLGKQYCCFSCLDASNR |
| Ga0228635_10038792 | 3300024328 | Seawater | MCIVDHELNEHLDSLEEKSECMECGVDVQLGKHYCCFSCLNASNR |
| Ga0228628_10372671 | 3300024359 | Seawater | FDEELNNYYESLEDNSECMECGIEIQLGKQYCCFSCIDASNR |
| Ga0209557_10250988 | 3300025483 | Marine | MCIVDHELNDHLDSLEEKSECMQCGVDVSLGKDYCCFSCLNASNR |
| Ga0208303_10040188 | 3300025543 | Aqueous | MEVFDQELNNHLEETSDCMECGVEIQLGKRYCCFSCFDSSNR |
| Ga0209304_100160614 | 3300025577 | Pelagic Marine | MDVFDHQLNEHLESSEQKSECMECGVDVQLGKQYCCFGCFDSSNR |
| Ga0209094_10545561 | 3300025594 | Pelagic Marine | HQLNEHLESSEQKSECMECGVDVQLGKQYCCFGCFDSSNR |
| Ga0209094_10830592 | 3300025594 | Pelagic Marine | MEAFDEELNNYFESLEDSSECMECGIEVQLGKQYCCFSCLDASNR |
| Ga0209405_100366312 | 3300025620 | Pelagic Marine | MEVFDEELNKHYRSLDESSECMECGIEVQLGKRYCCFSCLDASNR |
| Ga0209504_10605491 | 3300025621 | Pelagic Marine | AFDEELNEYYNSLEESSECMECGIEVQLGKRYCCFSCLDASNR |
| Ga0209197_10373871 | 3300025637 | Pelagic Marine | RKKEVMCIVDHELNEHLDSLEERSECMECGVDVSLGKHYCCFSCLNASNR |
| Ga0208643_10023326 | 3300025645 | Aqueous | MDVFDHQLNEHLESSEENSECMECGVDVQLGKQYCCFNCFNASNR |
| Ga0209532_10685985 | 3300025696 | Pelagic Marine | MEAFDEELNEYYNSLEESSECMECGIEVQLGKRYCCF |
| Ga0208785_10965702 | 3300025815 | Aqueous | IMEGLDYDLNEYFDSIEDKSECMECGVDVQLGKQYCCFGCFNASHR |
| Ga0209119_10810845 | 3300025860 | Pelagic Marine | MDVFNHQLNEHLESSEQKSECMECGVDVQLGKQYCCFGCFDSSN |
| Ga0228622_10479881 | 3300026479 | Seawater | MCIVDHELNEHLDSLEEKSECMECGVDVSLGKHYCCFS |
| Ga0228620_10858732 | 3300026483 | Seawater | HELNEHLDSLEEKSECMECGVDVSLGKHYCCFSCLNASNR |
| Ga0247605_10537071 | 3300026503 | Seawater | AFDEELNNYYESLEDNSECMECGVEIQLGKQYCCFSCLDASNR |
| Ga0228604_10412523 | 3300026506 | Seawater | DLELNEHLDSLEEKSECMECGVDVSLGKHYCCFSCLNASNR |
| Ga0233395_11317541 | 3300026511 | Seawater | YYNTMEAFDEELNNYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR |
| Ga0256368_10591412 | 3300028125 | Sea-Ice Brine | MEAFDEELNNYYESLEESSDCMECGVEVQLGKRYCCFSCLDASNR |
| Ga0228642_10265434 | 3300028131 | Seawater | TMEAFDEELNNYYESLEDNSECMECGIEIQLGKQYCCFSCIDASNR |
| Ga0228646_10639444 | 3300028280 | Seawater | MCIVDHELNEHLDSLEERSECMECGVDVSLGKHYC |
| Ga0228617_11010011 | 3300028297 | Seawater | FYYNTMEAFDEELNNYYESLEDNSECMECGIEIQLGKQYCCFSCLDASNR |
| Ga0247579_10958871 | 3300028337 | Seawater | LFYYNTMEAFDEELNNYYESLEDNSECMEFGIEIQLGKQYCCFSCLDASNR |
| Ga0228614_10135923 | 3300028416 | Seawater | MEVFDKELNEYHKSLEESGECMECGVEVQLGKRYCCFSCLDASNR |
| Ga0265306_104385122 | 3300028598 | Sediment | MDVFDHQLNEHLKSSEQKSECMECGVDVQLGKQYCCFGCFDSSNR |
| Ga0265309_100741375 | 3300028599 | Sediment | MCIVDHELNEHLDSLEQRSECMECGVDVSLGKHYCCFSCLNASNR |
| Ga0265309_104734611 | 3300028599 | Sediment | MDVFDHQLNEHLKSSEQKSECMECGVDVQLGKQYCC |
| Ga0265309_107994783 | 3300028599 | Sediment | EELNNYYESLEDNSECMECGIEVQLGKQYCCFSCLDASNR |
| Ga0307984_10674781 | 3300031658 | Marine | PLFYYKTMEALNEELNNYLDSSEDSSECMECGVDVQLGKRYCCFSCLDASNR |
| Ga0316202_101897453 | 3300032277 | Microbial Mat | EAFDEELNNYYESLEDNSECMECGIEVQLGKQYCCFSCLDASNR |
| Ga0348336_096123_2_112 | 3300034375 | Aqueous | EYFDSIEDKSECMECGVDVQLGKQYCCFGCFNASHR |
| ⦗Top⦘ |