NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090231

Metagenome / Metatranscriptome Family F090231

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090231
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 87 residues
Representative Sequence LSTNDPINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHL
Number of Associated Samples 90
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Archaea
% of genes with valid RBS motifs 24.07 %
% of genes near scaffold ends (potentially truncated) 21.30 %
% of genes from short scaffolds (< 2000 bps) 79.63 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (71.296 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.926 % of family members)
Environment Ontology (ENVO) Unclassified
(26.852 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.481 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 88.37%    β-sheet: 0.00%    Coil/Unstructured: 11.63%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF03167UDG 5.56
PF00561Abhydrolase_1 4.63
PF00072Response_reg 3.70
PF00491Arginase 1.85
PF01638HxlR 1.85
PF00543P-II 0.93
PF10604Polyketide_cyc2 0.93
PF01728FtsJ 0.93
PF01903CbiX 0.93
PF02933CDC48_2 0.93
PF00082Peptidase_S8 0.93
PF00037Fer4 0.93
PF07998Peptidase_M54 0.93
PF07995GSDH 0.93
PF01926MMR_HSR1 0.93
PF01361Tautomerase 0.93
PF00011HSP20 0.93
PF00535Glycos_transf_2 0.93
PF03364Polyketide_cyc 0.93
PF01555N6_N4_Mtase 0.93
PF00106adh_short 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 5.56
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 5.56
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 5.56
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 1.85
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.85
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.93
COG029323S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJTranslation, ribosomal structure and biogenesis [J] 0.93
COG0347Nitrogen regulatory protein PIISignal transduction mechanisms [T] 0.93
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.93
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.93
COG1189Predicted rRNA methylase YqxC, contains S4 and FtsJ domainsTranslation, ribosomal structure and biogenesis [J] 0.93
COG1913Predicted Zn-dependent proteaseGeneral function prediction only [R] 0.93
COG1942Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.93
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.93
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.22 %
UnclassifiedrootN/A27.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0733100All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1529Open in IMG/M
2228664021|ICCgaii200_c0735727All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon847Open in IMG/M
3300000156|NODE_c0669645Not Available2704Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_10673794All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon585Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_11298428Not Available847Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101702088All Organisms → cellular organisms → Archaea → TACK group3166Open in IMG/M
3300000787|JGI11643J11755_11696605All Organisms → cellular organisms → Archaea1878Open in IMG/M
3300000787|JGI11643J11755_11713931All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1101Open in IMG/M
3300000890|JGI11643J12802_12048504All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon791Open in IMG/M
3300000956|JGI10216J12902_106506997Not Available771Open in IMG/M
3300002568|C688J35102_119166896Not Available648Open in IMG/M
3300004114|Ga0062593_100018932Not Available3568Open in IMG/M
3300004157|Ga0062590_100208571All Organisms → cellular organisms → Archaea1422Open in IMG/M
3300004479|Ga0062595_100080087Not Available1648Open in IMG/M
3300004479|Ga0062595_100083761All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1625Open in IMG/M
3300004479|Ga0062595_100204289Not Available1227Open in IMG/M
3300005179|Ga0066684_10161261Not Available1429Open in IMG/M
3300005184|Ga0066671_10341662All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus franklandus948Open in IMG/M
3300005186|Ga0066676_10163796All Organisms → cellular organisms → Archaea1407Open in IMG/M
3300005187|Ga0066675_11161210Not Available574Open in IMG/M
3300005289|Ga0065704_10112397All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1935Open in IMG/M
3300005560|Ga0066670_10109043All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera1564Open in IMG/M
3300005981|Ga0081538_10223089All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas taiwanensis745Open in IMG/M
3300006755|Ga0079222_10013782All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis3039Open in IMG/M
3300006755|Ga0079222_10273511All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1081Open in IMG/M
3300006755|Ga0079222_10302684All Organisms → cellular organisms → Archaea1046Open in IMG/M
3300006797|Ga0066659_10579630All Organisms → cellular organisms → Archaea909Open in IMG/M
3300006804|Ga0079221_10926275Not Available643Open in IMG/M
3300006806|Ga0079220_11166041All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon632Open in IMG/M
3300006845|Ga0075421_100523403All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1405Open in IMG/M
3300006852|Ga0075433_10297225All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1430Open in IMG/M
3300006954|Ga0079219_10135316All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera gargensis → Candidatus Nitrososphaera gargensis Ga9.21286Open in IMG/M
3300009147|Ga0114129_10658347Not Available1351Open in IMG/M
3300009789|Ga0126307_10034198All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae3924Open in IMG/M
3300010038|Ga0126315_10750915All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon640Open in IMG/M
3300010040|Ga0126308_10021457All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae3488Open in IMG/M
3300010040|Ga0126308_10041617All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae2626Open in IMG/M
3300010042|Ga0126314_10008708All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon5665Open in IMG/M
3300010373|Ga0134128_10474954Not Available1394Open in IMG/M
3300010373|Ga0134128_10482518Not Available1382Open in IMG/M
3300010396|Ga0134126_10335326Not Available1767Open in IMG/M
3300010396|Ga0134126_11217974Not Available836Open in IMG/M
3300011003|Ga0138514_100004432All Organisms → cellular organisms → Archaea2016Open in IMG/M
3300012200|Ga0137382_11041623All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon586Open in IMG/M
3300012201|Ga0137365_10302629All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1185Open in IMG/M
3300012285|Ga0137370_10370394All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon864Open in IMG/M
3300012353|Ga0137367_10590451All Organisms → cellular organisms → Archaea778Open in IMG/M
3300012354|Ga0137366_10343875All Organisms → cellular organisms → Archaea1092Open in IMG/M
3300012354|Ga0137366_10485879All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon893Open in IMG/M
3300012356|Ga0137371_11120488All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon591Open in IMG/M
3300012882|Ga0157304_1008645All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1097Open in IMG/M
3300012897|Ga0157285_10006253Not Available2203Open in IMG/M
3300012898|Ga0157293_10334416Not Available513Open in IMG/M
3300012905|Ga0157296_10161907All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon680Open in IMG/M
3300012908|Ga0157286_10001187All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae3859Open in IMG/M
3300012985|Ga0164308_11780395Not Available573Open in IMG/M
3300012989|Ga0164305_11563609Not Available587Open in IMG/M
3300013096|Ga0157307_1007288Not Available1653Open in IMG/M
3300014488|Ga0182001_10321773All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon636Open in IMG/M
3300014497|Ga0182008_10015634All Organisms → cellular organisms → Archaea3956Open in IMG/M
3300014497|Ga0182008_10032969All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis2600Open in IMG/M
3300014497|Ga0182008_10095463All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera gargensis → Candidatus Nitrososphaera gargensis Ga9.21467Open in IMG/M
3300015077|Ga0173483_10018928Not Available2413Open in IMG/M
3300015077|Ga0173483_10269061All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon820Open in IMG/M
3300017997|Ga0184610_1106201All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon894Open in IMG/M
3300018027|Ga0184605_10005548All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis4563Open in IMG/M
3300018028|Ga0184608_10000011All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis38512Open in IMG/M
3300018061|Ga0184619_10042548All Organisms → cellular organisms → Archaea1955Open in IMG/M
3300018433|Ga0066667_10286287All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae1272Open in IMG/M
3300018466|Ga0190268_11908310All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon541Open in IMG/M
3300019356|Ga0173481_10000230All Organisms → cellular organisms → Archaea11029Open in IMG/M
3300019356|Ga0173481_10026597All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1815Open in IMG/M
3300019361|Ga0173482_10062524All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1248Open in IMG/M
3300019362|Ga0173479_10114372Not Available1023Open in IMG/M
3300019767|Ga0190267_11266921All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon547Open in IMG/M
3300019865|Ga0193748_1012681All Organisms → cellular organisms → Archaea775Open in IMG/M
3300019867|Ga0193704_1000017All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis26356Open in IMG/M
3300019869|Ga0193705_1054925All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon814Open in IMG/M
3300019870|Ga0193746_1000502All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae2543Open in IMG/M
3300019999|Ga0193718_1041857All Organisms → cellular organisms → Archaea1005Open in IMG/M
3300021358|Ga0213873_10125702All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon756Open in IMG/M
3300021413|Ga0193750_1011851All Organisms → cellular organisms → Archaea2189Open in IMG/M
3300021445|Ga0182009_10696878Not Available550Open in IMG/M
3300021445|Ga0182009_10814245Not Available511Open in IMG/M
3300021510|Ga0222621_1002376All Organisms → cellular organisms → Archaea2948Open in IMG/M
3300022534|Ga0224452_1099942All Organisms → cellular organisms → Archaea886Open in IMG/M
3300022883|Ga0247786_1155281All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon517Open in IMG/M
3300026324|Ga0209470_1128457All Organisms → cellular organisms → Archaea1122Open in IMG/M
3300026550|Ga0209474_10240801Not Available1123Open in IMG/M
3300027765|Ga0209073_10029081Not Available1697Open in IMG/M
3300027775|Ga0209177_10133431All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera gargensis → Candidatus Nitrososphaera gargensis Ga9.2825Open in IMG/M
3300027809|Ga0209574_10351100All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon515Open in IMG/M
3300027909|Ga0209382_10075051All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae3991Open in IMG/M
3300027909|Ga0209382_11215523All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon770Open in IMG/M
3300027992|Ga0247750_1037312Not Available539Open in IMG/M
3300028712|Ga0307285_10113066All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon725Open in IMG/M
3300028796|Ga0307287_10081820All Organisms → cellular organisms → Archaea1211Open in IMG/M
3300028814|Ga0307302_10636614Not Available530Open in IMG/M
3300028885|Ga0307304_10055026All Organisms → cellular organisms → Archaea1485Open in IMG/M
3300030496|Ga0268240_10022649All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1201Open in IMG/M
3300031091|Ga0308201_10231771All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon627Open in IMG/M
3300031093|Ga0308197_10094901All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon871Open in IMG/M
3300031548|Ga0307408_101828160All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon581Open in IMG/M
3300031903|Ga0307407_10149824Not Available1515Open in IMG/M
3300031938|Ga0308175_100246604All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1790Open in IMG/M
3300031996|Ga0308176_10185178Not Available1943Open in IMG/M
3300031996|Ga0308176_11274493All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon780Open in IMG/M
3300034131|Ga0334911_062438All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon545Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil15.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil7.41%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.48%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.63%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.63%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.70%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.93%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.93%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.93%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019865Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300019870Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027992Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S125-311R-5EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300034131Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 7HMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_073310012228664021SoilLSIIDKEHNDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHI
ICCgaii200_073572712228664021SoilVFIIDKEHNDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHI
NODE_066964523300000156Sugar Cane Bagasse Incubating BioreactorIIDKEIDDSITEQLKRFENLKQKLEESPELQKQMTNNLDKLRRQSRLIHSDILKQLIDKMELLIIDDQDITNALGYKMYIEHLISLVQHI*
ICChiseqgaiiFebDRAFT_1067379423300000363SoilMSINNPINEQLKQFENIKRKLESPEIQRIVDKNLDKLREQNRKIHSEVLKQSIEKMELLIIDDDLIAAAGYKIYIEHLISLAQHL*
ICChiseqgaiiFebDRAFT_1129842823300000363SoilMGTKQKLEVPELLKEMNNNLDKLRKQNRLIPSDILKEAIDKMELLIIDEDLTNALGYKMYIEHLISLVQHL*
INPhiseqgaiiFebDRAFT_10170208823300000364SoilLSTNDPINEQLRRFENLKQKLEVPELQKEMNNNLDKLRKQNLLIHSDILKEAIDKMELLIIDEDSTNALGYKMYIEHLISLVQHL*
JGI11643J11755_1169660513300000787SoilLSIIDKEHNDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHI*
JGI11643J11755_1171393123300000787SoilVFIIDKEHNDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHI*
JGI11643J12802_1204850423300000890SoilIIDKEHNDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHI*
JGI10216J12902_10650699713300000956SoilMASCNSISEQLVRFENVKQRLETPELQAEVNSNLDRLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLI
C688J35102_11916689623300002568SoilLLSIIDKEIDDSINEQLKRFENLKQKLEEGPELQKQMTNNLDKLRRQSRLIHLDILKQLIDKTELLIIDEDMINALGYKMYIEHLISLVQHI*
Ga0062593_10001893233300004114SoilMACSNPINEQLVRFENVKQKLESPELQVEVNNNLDRLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQHL*
Ga0062590_10020857123300004157SoilLLSDANGNYINEQLKRFENLNRNLITPELQKELNNNTNKLRRQNRLIHSEILKGLIDKMELLIIDGDVVNALGYKLYIEHLISLVQHL*
Ga0062595_10008008713300004479SoilMACSNPINEQLVRFENVKQKLESPELQVEVNNNLDRLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQH
Ga0062595_10008376123300004479SoilMASGNPISEQLVRFENVKQKLESPELQAEVNSNLDRLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQHL*
Ga0062595_10020428913300004479SoilMACSNPISEQLVRFENVKQKLESPELQAEVNSNLDKLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQH
Ga0066684_1016126113300005179SoilLSYVNDPINEQLKRFKQLKQKLEEGPELQREMNNNVDKLRKQNRLIHSDILKESIDKMELLIIDQDLTNALGYKMYIEHLISLIQDL*
Ga0066671_1034166213300005184SoilLLSIIDKEIDDSITEQLKRFENLKQKLEESPELQKQMTNNLDKLRRQSRLIHSDILKQLIDKMELLIIDDQDITNALGYKMYIEHLI
Ga0066676_1016379623300005186SoilMSDSKPINDQLSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDILKDAIDKIELLIMDEDITNALGYKMYIEHLISLAQHL*
Ga0066675_1116121013300005187SoilLLSVNDKGIDASITQQLKRFENLKEKLEESPELQKQMTNNLDKLRRQSRLIHSDILKQLIDKMELLIIDDQDMINALGYKMYIEHLISLVQHI*
Ga0065704_1011239713300005289Switchgrass RhizosphereMSINNPINEQLKQFENIKRKLESPEIQRIVDKNLDKLREQNRKIHSEVLKQSIEKMELLIIDDDLIAAAGYKIYIEHLISLAQYL*
Ga0066670_1010904313300005560SoilLLSIIDKEHNDDSVNEQLKRFENLKQKLEASPELQKQMNNNLDKFRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHI*
Ga0081538_1022308913300005981Tabebuia Heterophylla RhizosphereMSSNSINEQLKQFENLKRKLESPELQQIVEKNLDKLREQNRMIHSEILKQSIDRMELLIIDEDLIAAAGYKLYIEHLISLAQHL*
Ga0079222_1001378253300006755Agricultural SoilLHLLSSPDDGNSINEQLKRFEILKQKLESPELQKEININSDKLRIQNRLIHLEILKGLIDKMELLIIDAEMINALGYKMYIEHLISLVQHL*
Ga0079222_1027351123300006755Agricultural SoilMASGNPISEQLMRFENVKQKLESPELQAEVNSNLDRLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQHL*
Ga0079222_1030268423300006755Agricultural SoilLLSIIDKEIDDSINEQLERFENLKQKLESPELQKQMTNNLDRLRRQSRLIHSDILKQLIDKMELLIIDDQVMINALGYKMYIEHLITLVQHI*
Ga0066659_1057963013300006797SoilLLSIIDKEIDDSINEQLKRFENLKQKLEEGTEIQKQMTNNLDKLRRQSRLIHLDILKQLIDKTELLIIDGEDMINALGYKMYIEHLLSLVQHI*
Ga0079221_1092627513300006804Agricultural SoilLLSIIDKEIDDSINEQLERFENLKQKLESPELQKQMTNNLDRLRRQSRLIHSDILKQLIDKMELLIIDDQVMINALGYKMYIEHLITVVQHI*
Ga0079220_1116604123300006806Agricultural SoilLLSSPDDGNSINEQLKRFEILKQKLESPDLQKEININSDKLRIQNRLIHLEILKGLIDKMELLIIDAEMINALGYKMYIEHLISLVQHL*
Ga0075421_10052340313300006845Populus RhizosphereMACSNPISEQLVRFENVKQKLESPELQAEVNSNLDKLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQHL*
Ga0075433_1029722523300006852Populus RhizosphereMASCNSISEQLVRFENVKQRLETPELQAEVNSNLDRLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQHL*
Ga0079219_1013531623300006954Agricultural SoilLLSIIDKEIDDSINEQLERFENLKQKLESPELQKEININSDKLRIQNRLIHLEILKGLIDKMELLIIDAEMINALGYKMYIEHLISLVQHL*
Ga0114129_1065834723300009147Populus RhizosphereMASGNPISEQLVRFENVKQKLESPELQAEVNSNLDKLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQHL*
Ga0126307_1003419833300009789Serpentine SoilMSSNSINEQLKQFENLKRKLESPELQQIVEKNLDKLREQNRMIHSEILKQSIDRMELLIIDEDLIAAAGYKIYIEHLISLAQHL*
Ga0126315_1075091513300010038Serpentine SoilMSSNSINEQLKQFENLKRKLETPELQQIVEKNLDKLREQNRMIHSEILKQSIDKMELLIIDEDLIAAAGYKIYIEHLISLAQHL*
Ga0126308_1002145733300010040Serpentine SoilMSRNSINEQLKQFENLKRKLESPELQQIVEKNLDKLREQNRMIHSEILKQSIDKMELLIIDEDLIAAAGYKIYIEHLISLAQHL*
Ga0126308_1004161733300010040Serpentine SoilMSTTNNPITEQLKQFENIKRKLESPEIQRIVDKNLDKLREQNRKIHSEVLKQSIEKMELLIMDEDLIAAAGYKIYIEHLISIAQHL*
Ga0126314_1000870813300010042Serpentine SoilMVSGNPISEQLVRFENVKQKLESPELQAEVNSNLDRLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQHL*
Ga0134128_1047495423300010373Terrestrial SoilLQILLLSYVNDPINEQLKRFKQLKQKLEEGPELQREMNNNVDKLRKQNRLIHSDILKESIDKMELLIIDQDLTNALGYKMYIEHLISLIQDL*
Ga0134128_1048251813300010373Terrestrial SoilITEQLKRFENLKQKLEESPELQKQMTNNLDKLRRQSRLIHSDILKQLIDKMELLIIDDQDITNALGYKMYIEHLISLVQHI*
Ga0134126_1033532623300010396Terrestrial SoilLSIIDKQIDDSITEQLKRFENLRQKLEEGPELQKQMTNNLDKHRRQSRLIQSDILKQLIDKMELLIIDDQDIINALGYKMYIEHLISLVQHI*
Ga0134126_1121797433300010396Terrestrial SoilLLSYVNDPINEQLKRFKQLKQKLEEGPELQREMNNNVDKLRKQNRLIHSDILKESIDKMELLIIDQDLTNALGYKMYIEHLISLIQDL*
Ga0138514_10000443213300011003SoilSYSDPVNEQLKRFENLKQRLEGPELQREITTNLDKFREQNRLIHSDIIKEAIDKMELLIIDEDLINALGYKMYIERLISLLQLI*
Ga0137382_1104162313300012200Vadose Zone SoilMSDSKSINDQLSRFSNLKQKLESPELQQDMNENLDKLREQNRLVHSDILKDAIDKIELLIMDEDITNALGYKMYIEHLISLAQHL*
Ga0137365_1030262913300012201Vadose Zone SoilLSTNDPINEQLRRFENLKQKLEVPELQKEMNNNLDKLRKQNLLIHSDILKESIDKMELLIIDEDLTNALGYKMYIEHLISLVQHL*
Ga0137370_1037039413300012285Vadose Zone SoilLSIIDKEHNDDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHI*
Ga0137367_1059045133300012353Vadose Zone SoilMSDSKPINDQLSRFSYLKQKLESPELQQDMNENLDKVREQNRLVHSDISMDAIDKIELLIMDEDITNALGYKMYIEH*
Ga0137366_1034387523300012354Vadose Zone SoilLSIIDKEHNDPINEQLKRFENLRQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHI*
Ga0137366_1048587913300012354Vadose Zone SoilSKPINDQLSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDISMDAIDKIELLIMDEDITNALGYKMYIEH*
Ga0137371_1112048813300012356Vadose Zone SoilLSIIDKEHNDPINEQLKRFENLRQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHL*
Ga0157304_100864523300012882SoilLSNVDKEHNDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHI*
Ga0157285_1000625313300012897SoilLYNVDKEHNDDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLICLVQHI*
Ga0157293_1033441613300012898SoilLSDANGNYINEQLKRFENLNRNLITPELQKELNNNTNKLRRQNRLIHSEILKGLIDKMELLIIDGDVVNALGYKLYIEHLISLVQHL*
Ga0157296_1016190713300012905SoilLSNVDKEHNDDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQHL*
Ga0157286_1000118743300012908SoilLSNVDKEHNDDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLICLVQHI*
Ga0164308_1178039513300012985SoilLSIIDKEIDDSITEQLKRFENLKQKLEESPELQKQMTNNLDKLRRQSRLIHSDILKQLIDKMELLIIDDQDITNALGYKMYIEHLISLVQHI*
Ga0164305_1156360913300012989SoilLLSIIDKEIDDSITEQLKRFENLKQKLEESPELQKQMTNNLDKLRRQSRLIHSDILKQLIDKMELLIIDDQDITNALGYKMYIEHLISLVQHI*
Ga0157307_100728823300013096SoilLSNVDKEHNDDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQNI*
Ga0182001_1032177313300014488SoilSINEQLKQFENLKRKLESPELQQIVEKNLDKLREQNRMIHSEILKQSIDRMELLIIDEDLIAAAGYKLYIEHLISLAQHL*
Ga0182008_1001563453300014497RhizosphereLFIIDKEHNDDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHI*
Ga0182008_1003296943300014497RhizosphereNVKQRLETPELQAEVNSNLDRLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQHL*
Ga0182008_1009546323300014497RhizosphereLLSSPDDGNSINEQLKRFEILKQKLESPELQKEININSDKLRRQNRLIHLEILKGLIDKMELLIIDAEMINALGYKMYIEHLISLVQHL*
Ga0173483_1001892823300015077SoilLSNVDKEHNDDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHI*
Ga0173483_1026906123300015077SoilLSTNDPINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHL*
Ga0184610_110620113300017997Groundwater SedimentSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDILKDAIDKIELLIMDEDITNALRYKMYIEHLISLAQHL
Ga0184605_1000554823300018027Groundwater SedimentMSDSKPINDQLSRFSYLKHKLESPELQQDMNENLDKLREQNRLVHSDILKDAIDKIELLIMDEDITNALRYKMYIEHLISLAQHL
Ga0184608_1000001133300018028Groundwater SedimentMSDSKPINDQLSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDILKDAIDKIELLIMDEDITNALRYKMYIEHLISLAQHL
Ga0184619_1004254813300018061Groundwater SedimentNDQLSRFSYLKQKLESPELQQDMNENLAKLREQNRLVHSDILKDAIDKIELLIMDEDITNALRYKMYIEHLISLAQHL
Ga0066667_1028628723300018433Grasslands SoilLLSIIDKEHNDDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKFRRQNRLIHSDILKQLIDKLELLMIDQDMINALGYKMYIEHLISLVQHI
Ga0190268_1190831013300018466SoilMSSNSINEQLKQFENLKRKLESPELQQIVEKNLDKLREQNRKIHSEVLKQSIEKMELLIIDEDLIAAAGYKIYIEHLISLAQHL
Ga0173481_10000230123300019356SoilMACSNPINEQLVRFENVKQKLESPELQVEVNNNLDRLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQHL
Ga0173481_1002659723300019356SoilVFIIDKEHNDSINEQLKRFENLKQKLEASPELQKQINNNLDKIRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHI
Ga0173482_1006252413300019361SoilLLSNVDKEHNDDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHI
Ga0173479_1011437213300019362SoilLLSDANGNYINEQLKRFENLNRNLITPELQKELNNNTNKLRRQNRLIHSEILKGLIDKMELLIIDGDVVNALGYKLYIEHLISLVQHL
Ga0190267_1126692113300019767SoilMSTNNPINEQLKQFENIKRKLESPEIQRIVDKNLDKLREQNRKIHSEVLKQSIEKMELLIIDEDLIAAAGYKIYIEHLISIAQHL
Ga0193748_101268113300019865SoilMPKLLFVLDIRMLMSYSDPVNEQLKRFENLKQRLEGPELQREITTNLDKFREQNRLIHSDIIKEAIDKMELLIIDEDLINALGYKMYIERLISLLQLI
Ga0193704_1000017143300019867SoilMSDSKPINDQLSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDNLKDAIDKIELLIMDEDITNALRYKMYIEHLISLAQHL
Ga0193705_105492523300019869SoilMSINNPINEQLKQFENIKRKLESPEIQRIVDKNLDKLREQNRKIHSEVLKQSIEKMELLIIDDDLIAAAGYKIYIEHLISLAQHL
Ga0193746_100050233300019870SoilMPKLLFVLDIHMFMSYSDPVNEQLKRFENLKQRLEGPELQREITTNLDKFREQNRLIHSDIIKEAIDKMELLIIDEDLINALGYKMYIERLISLLQLI
Ga0193718_104185723300019999SoilMSDSKPINDQLSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDILKDAIDKIELLIMDEDITNALRYKMYIEHL
Ga0213873_1012570223300021358RhizosphereLLSDADGNYINEQLKRFENLNRNLITPELQKELNNNTDKLRRQNRLIHSEILKGLIDKMELLIIDGDVVNALGYKLYIEHLISLVQHL
Ga0193750_101185113300021413SoilLSYANDPINEQLKRFEQLKQKLEEGPELQREMSNNLDKLRKQNRLIHSDILKESIDKMELLIIDQDLTNALGYKMYIEHLISLIQDL
Ga0182009_1069687813300021445SoilLLSIIDKEIDDSITEQLKRFENLKQKLEESPELQKQMTNNLDKLRRQSRLIHSDILKQLIDKMELLIIDDQDITNALGYKMYIEHLISLVQHI
Ga0182009_1081424513300021445SoilMASCNSISEQLVRFENVKQRLETPELQAEVNSNLDRLREQNRLIHSDLLKQVIDKMELLIIDGDLINALGN
Ga0222621_100237623300021510Groundwater SedimentMSDSKPINDQLSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDILKDAIDKIELLIMDEDINNALRYKMYIEHLISLAQHL
Ga0224452_109994213300022534Groundwater SedimentMSDSKPINDQLSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDILKDAIDKIELLIMDEDITNALRYKMYVEHLISLAQHL
Ga0247786_115528113300022883SoilLLSNVDKEHNDDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLISLVQHIXTLVAYADLVYISIL
Ga0209470_112845723300026324SoilMSDSKPINDQLSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDILKDAIDKIELLIMDEDITNALGYKMYIEHLISLAQHL
Ga0209474_1024080113300026550SoilLLSVNDKGIDASITQQLKRFENLKEKLEESPELQKQMTNNLDKLRRQSRLIHSDILKQLIDKMELLIIDDQDMINALGYKMYIEHLISLVQHI
Ga0209073_1002908123300027765Agricultural SoilLLSIIDKEIDDSINEQLERFENLKQKLESPELQKQMTNNLDRLRRQSRLIHSDILKQLIDKMELLIIDDQVMINALGYKMYIEHLITLVQHI
Ga0209177_1013343113300027775Agricultural SoilEQLKRFEILKQKLESPELQKEININSDKLRIQNRLIHLEILKGLIDKMELLIIDAEMINALGYKMYIEHLISLVQHL
Ga0209574_1035110023300027809AgaveHRPLALMASGNPISEQLVRFENVKQRLETPELQAEVNSNLDRLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQHL
Ga0209382_1007505133300027909Populus RhizosphereMACSNPISEQLVRFENVKQKLESPELQAEVNSNLDKLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQHL
Ga0209382_1121552313300027909Populus RhizosphereMASCNSISEQLVRFENVKQRLETPELQAEVNSNLDRLREQNRLIHSDLLKQVIDKMELLIIDGDLIHALGYKMYIEHLISLVQHL
Ga0247750_103731213300027992SoilLLSNVDKEHNDDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIE
Ga0307285_1011306613300028712SoilMSDSKPINDQLSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDILKDAIDKIELLIMDEDITNALRYKMYIEHLISLAQHLXKNNILT
Ga0307287_1008182013300028796SoilMSDSKPINDQLSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDILKDAIDKIELLIMDEDITNALRYKMYIEHLISSAQHL
Ga0307302_1063661413300028814SoilMSDSKPINDQLSRFSYLKQKLESPELQQDMNENLDRLVHSDILKGAIDKIELLIMDEDITNALRYKMYIEHLISLAQHLXKNNILT
Ga0307304_1005502633300028885SoilMSDSKPINDQLSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDNLKDAIDKIELLIMDEDITNALRYKMYIEHLISLAQHLXKNN
Ga0268240_1002264913300030496SoilMSTNNPINEQLKQFEIIKRKLESPEIQRIVDKNLDKLREQNRKIHSEVLKQSIEKMELLIIDEDLIAAAGYKIYIEHLISIAQHL
Ga0308201_1023177123300031091SoilMSDSKPINDQLSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDNLKDAIDKIELLIMDEDITNALRYKMYIEHLISLAQHLXKNNILT
Ga0308197_1009490113300031093SoilSKPINDQLSRFSYLKQKLESPELQQDMNENLDKLREQNRLVHSDILKDAIDKIELLIMDEDITNALRYKMYIEHLISLAQHL
Ga0307408_10182816013300031548RhizosphereMSSNSINEQLKQFENLKRKLESPELQQIVEKNLDKLREQNRMIHSEILKQSIDRMELLIIDEDLIAAAGYKIYIEHLISLAQHL
Ga0307407_1014982423300031903RhizosphereMSSNSINEQLKQFENLKRKLESPELQQIVEKNLDKLREQNRMIHSEILKQSIDRMELLIIDEDLIAAAGYKI
Ga0308175_10024660433300031938SoilVLSTNDPINEQLRRFENLKQKLEVPELQKEMNNNLDKLRKQNRLIHSDILKEAIDKMELLIIDEDLTNALGYKMYIEHLISLVQHL
Ga0308176_1018517813300031996SoilLLSNVDKEHNDDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKLRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLICLVQHI
Ga0308176_1127449313300031996SoilLLSNVDKEHNDDSINEQLKRFENLKQKLEASPELQKQMNNNLDKFRRQNRLIHSDILKQLIDKLELLIIDQDMINALGYKMYIEHLICLVQHI
Ga0334911_062438_2_2353300034131Sub-Biocrust SoilEQLKQFENLKRKLESPELQQIVEKNLDKLREQNRMIHSEILKQSIDRMELLIIDEDLIAAAGYKIYIEHLISLAQHL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.