Basic Information | |
---|---|
Family ID | F090226 |
Family Type | Metagenome |
Number of Sequences | 108 |
Average Sequence Length | 41 residues |
Representative Sequence | MKYLLLVCWDAEKMDAQTEPDPGNTPDEESFPWLDDLQAR |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.07 % |
% of genes near scaffold ends (potentially truncated) | 95.37 % |
% of genes from short scaffolds (< 2000 bps) | 93.52 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.333 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.222 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.074 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.852 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.65% β-sheet: 0.00% Coil/Unstructured: 82.35% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF07883 | Cupin_2 | 9.26 |
PF00072 | Response_reg | 2.78 |
PF00106 | adh_short | 2.78 |
PF03795 | YCII | 2.78 |
PF00027 | cNMP_binding | 2.78 |
PF02909 | TetR_C_1 | 1.85 |
PF00583 | Acetyltransf_1 | 1.85 |
PF13649 | Methyltransf_25 | 1.85 |
PF04828 | GFA | 0.93 |
PF00226 | DnaJ | 0.93 |
PF12681 | Glyoxalase_2 | 0.93 |
PF00246 | Peptidase_M14 | 0.93 |
PF08241 | Methyltransf_11 | 0.93 |
PF08386 | Abhydrolase_4 | 0.93 |
PF13539 | Peptidase_M15_4 | 0.93 |
PF09360 | zf-CDGSH | 0.93 |
PF03006 | HlyIII | 0.93 |
PF13378 | MR_MLE_C | 0.93 |
PF01370 | Epimerase | 0.93 |
PF06803 | DUF1232 | 0.93 |
PF07040 | DUF1326 | 0.93 |
PF01257 | 2Fe-2S_thioredx | 0.93 |
PF07732 | Cu-oxidase_3 | 0.93 |
PF04237 | YjbR | 0.93 |
PF01494 | FAD_binding_3 | 0.93 |
PF00501 | AMP-binding | 0.93 |
PF00196 | GerE | 0.93 |
PF01113 | DapB_N | 0.93 |
PF13376 | OmdA | 0.93 |
PF02674 | Colicin_V | 0.93 |
PF00903 | Glyoxalase | 0.93 |
PF01741 | MscL | 0.93 |
PF01738 | DLH | 0.93 |
PF01594 | AI-2E_transport | 0.93 |
PF08818 | DUF1801 | 0.93 |
PF02673 | BacA | 0.93 |
PF01883 | FeS_assembly_P | 0.93 |
PF00005 | ABC_tran | 0.93 |
PF02803 | Thiolase_C | 0.93 |
PF01061 | ABC2_membrane | 0.93 |
PF08448 | PAS_4 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.78 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.85 |
COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 1.85 |
COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 0.93 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.93 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.93 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.93 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.93 |
COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 0.93 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.93 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.93 |
COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.93 |
COG1905 | NADH:ubiquinone oxidoreductase 24 kD subunit (chain E) | Energy production and conversion [C] | 0.93 |
COG1286 | Colicin V production accessory protein CvpA, regulator of purF expression and biofilm formation | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.93 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.93 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.93 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.93 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.33 % |
Unclassified | root | N/A | 16.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908016|OU_2_1_1_newblercontig19036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 658 | Open in IMG/M |
2124908045|KansclcFeb2_ConsensusfromContig1237669 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
2170459003|FZ032L002H5PJW | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300000858|JGI10213J12805_10197206 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300000956|JGI10216J12902_121565903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1084 | Open in IMG/M |
3300003321|soilH1_10287584 | Not Available | 1660 | Open in IMG/M |
3300003373|JGI25407J50210_10003615 | All Organisms → cellular organisms → Bacteria | 3716 | Open in IMG/M |
3300004153|Ga0063455_100041005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 1497 | Open in IMG/M |
3300004153|Ga0063455_100186445 | Not Available | 1007 | Open in IMG/M |
3300004643|Ga0062591_100729765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 901 | Open in IMG/M |
3300005177|Ga0066690_10114481 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
3300005179|Ga0066684_10245347 | Not Available | 1174 | Open in IMG/M |
3300005328|Ga0070676_11204902 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300005355|Ga0070671_102101011 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300005444|Ga0070694_100785254 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300005544|Ga0070686_100880087 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300005544|Ga0070686_101695685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 536 | Open in IMG/M |
3300005557|Ga0066704_11054075 | Not Available | 501 | Open in IMG/M |
3300005558|Ga0066698_10293091 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300005563|Ga0068855_100940274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
3300005576|Ga0066708_10388602 | Not Available | 896 | Open in IMG/M |
3300005874|Ga0075288_1090479 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300005937|Ga0081455_10915068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 545 | Open in IMG/M |
3300006032|Ga0066696_10695368 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300006034|Ga0066656_10794627 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300006046|Ga0066652_101117264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 746 | Open in IMG/M |
3300006049|Ga0075417_10278927 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300006049|Ga0075417_10567529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300006755|Ga0079222_10185926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 1231 | Open in IMG/M |
3300006846|Ga0075430_100874189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
3300006847|Ga0075431_101415115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
3300006880|Ga0075429_100060464 | All Organisms → cellular organisms → Bacteria | 3300 | Open in IMG/M |
3300009012|Ga0066710_101883330 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300009098|Ga0105245_11167040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 817 | Open in IMG/M |
3300009840|Ga0126313_11736684 | Not Available | 521 | Open in IMG/M |
3300010037|Ga0126304_10139014 | Not Available | 1563 | Open in IMG/M |
3300010037|Ga0126304_10149543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1510 | Open in IMG/M |
3300010037|Ga0126304_10237435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
3300010044|Ga0126310_10120150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Calidithermus → Calidithermus chliarophilus | 1627 | Open in IMG/M |
3300010301|Ga0134070_10420492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
3300010322|Ga0134084_10339834 | Not Available | 569 | Open in IMG/M |
3300010325|Ga0134064_10384349 | Not Available | 556 | Open in IMG/M |
3300010398|Ga0126383_11670069 | Not Available | 726 | Open in IMG/M |
3300010403|Ga0134123_11528246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
3300011000|Ga0138513_100038294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
3300012008|Ga0120174_1103376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
3300012014|Ga0120159_1093464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
3300012022|Ga0120191_10044298 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300012186|Ga0136620_10245877 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300012200|Ga0137382_10333816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 1062 | Open in IMG/M |
3300012207|Ga0137381_10213680 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
3300012207|Ga0137381_11673911 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300012361|Ga0137360_10316366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1299 | Open in IMG/M |
3300012672|Ga0137317_1013021 | Not Available | 730 | Open in IMG/M |
3300012680|Ga0136612_10490040 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300012893|Ga0157284_10261750 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300012897|Ga0157285_10188995 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300012922|Ga0137394_10950632 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300012951|Ga0164300_10001709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5277 | Open in IMG/M |
3300012957|Ga0164303_11329824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 533 | Open in IMG/M |
3300012985|Ga0164308_12133589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 522 | Open in IMG/M |
3300014326|Ga0157380_10874619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 922 | Open in IMG/M |
3300014827|Ga0120171_1053160 | Not Available | 1217 | Open in IMG/M |
3300015262|Ga0182007_10253014 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300017787|Ga0183260_10144196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1701 | Open in IMG/M |
3300017789|Ga0136617_10036538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4367 | Open in IMG/M |
3300018071|Ga0184618_10070943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1313 | Open in IMG/M |
3300018081|Ga0184625_10081649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1654 | Open in IMG/M |
3300018422|Ga0190265_11271796 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300018422|Ga0190265_13829567 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300018432|Ga0190275_13468277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
3300018433|Ga0066667_10008020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4866 | Open in IMG/M |
3300018433|Ga0066667_11063023 | Not Available | 699 | Open in IMG/M |
3300018466|Ga0190268_10238897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1032 | Open in IMG/M |
3300019377|Ga0190264_11744717 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300019884|Ga0193741_1074968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
3300020016|Ga0193696_1112561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. Soil774 | 694 | Open in IMG/M |
3300021445|Ga0182009_10785230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 520 | Open in IMG/M |
3300021560|Ga0126371_13451371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
3300022756|Ga0222622_11124560 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300025918|Ga0207662_10885873 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300025930|Ga0207701_11346981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
3300025945|Ga0207679_11081793 | Not Available | 735 | Open in IMG/M |
3300026088|Ga0207641_12169298 | Not Available | 556 | Open in IMG/M |
3300026095|Ga0207676_11059125 | Not Available | 801 | Open in IMG/M |
3300026306|Ga0209468_1017190 | All Organisms → cellular organisms → Bacteria | 2615 | Open in IMG/M |
3300026316|Ga0209155_1203963 | Not Available | 622 | Open in IMG/M |
3300027907|Ga0207428_10814293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
3300028721|Ga0307315_10087462 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300028787|Ga0307323_10212071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 699 | Open in IMG/M |
3300028796|Ga0307287_10394882 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300028799|Ga0307284_10013334 | All Organisms → cellular organisms → Bacteria | 2506 | Open in IMG/M |
3300028800|Ga0265338_11166443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
3300028811|Ga0307292_10121704 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300028811|Ga0307292_10426461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
3300028824|Ga0307310_10748852 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300028884|Ga0307308_10555320 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300028885|Ga0307304_10413292 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300030619|Ga0268386_10897695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
3300031199|Ga0307495_10076501 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300031716|Ga0310813_12273181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
3300031731|Ga0307405_12158029 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300031740|Ga0307468_101041952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
3300031995|Ga0307409_100934570 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300031995|Ga0307409_101282549 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300033551|Ga0247830_10929799 | Not Available | 693 | Open in IMG/M |
3300033551|Ga0247830_11341475 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300034417|Ga0364941_039315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1031 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.11% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.56% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.63% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.63% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.70% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.78% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.78% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.78% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.78% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.85% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.93% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.93% |
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.93% | |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908016 | Sample 642 | Environmental | Open in IMG/M |
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012672 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2 | Environmental | Open in IMG/M |
3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
OU_01300720 | 2124908016 | VKFLLLVCWDGEAMNAQTEPEPGEAQEEESFPWLDDLQAR | |
KansclcFeb2_10335310 | 2124908045 | Soil | MKYLMLVCWDVEKMNAQPEPDPSAAADEESFPWLDD |
E4A_05760460 | 2170459003 | Grass Soil | MKFLLLVCWDAEKMDAQAEPDSTDAPNEEEGFPWLDDLQARGIWVTG |
JGI10213J12805_101972061 | 3300000858 | Soil | MRYLLLVCWDAEKMNAQTEPDPGESREEESFPWLDDLHARAIWVTG |
JGI10216J12902_1215659034 | 3300000956 | Soil | MKFLLLVCWDAEKMDAQTEPDPNETQEEEGFPWLDDLQ |
soilH1_102875841 | 3300003321 | Sugarcane Root And Bulk Soil | VKYLLLVCWDAERMNRQAEPDRSALPTDDDEEEPFPWVDDL |
JGI25407J50210_100036151 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MKYLLLICWNAERMDGQTEPDPSEQTEPESFPWLDDLQAQGKWI |
Ga0063455_1000410051 | 3300004153 | Soil | MLLVCWDAERMNAREEPRPGDARDHEGFPWLNDLQARGKWV |
Ga0063455_1001864453 | 3300004153 | Soil | MKYLLLVCWDAEQMNSQTEPEPGEAQDEEGFPWLDDLQARGI |
Ga0062591_1007297651 | 3300004643 | Soil | MKYMLLVCWDAERMNAREEPRPGDARDDEGFPWLNDLQARGK |
Ga0066690_101144811 | 3300005177 | Soil | MKYLLLVCWDAEKMDAQTEPDPGNTPDEESFPWLDDLQAR |
Ga0066684_102453471 | 3300005179 | Soil | MKYLLLVCWDAEKMDAQTEPDPGNTPDEESFPWLDDLQARKMWI |
Ga0070676_112049021 | 3300005328 | Miscanthus Rhizosphere | MKFLLFVCWDGDKMNAQPEPDPSQPRTEESFPWLDELQARGT |
Ga0070671_1021010112 | 3300005355 | Switchgrass Rhizosphere | MKYLLLVCWDGDRMNDQTEPEPGEEQPDKGFWWVDELREQGIWQ |
Ga0070694_1007852542 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFLMLVCWDGEKMDAQTEPESSNDAADDESFPWLDDLQARGIWV |
Ga0070686_1008800871 | 3300005544 | Switchgrass Rhizosphere | MKFLLLVCWDAEKMNELEEPDGSEAEDQDGFPWLDELQARGAW |
Ga0070686_1016956852 | 3300005544 | Switchgrass Rhizosphere | MKYLLLVCWDAEHMNGQTEPDATAKAADAEEEPFPWVDEL |
Ga0066704_110540751 | 3300005557 | Soil | MKYLLLVCWDAERMNGQTEPDPNTAPAEEEEGFPWVDHLR |
Ga0066698_102930912 | 3300005558 | Soil | MKYLMLVCWDAEKMNAQTEPDPNDTSDEETFPWLDDF* |
Ga0068855_1009402742 | 3300005563 | Corn Rhizosphere | MKYLLLVCWDTERMNGQTEPEPVATPAEDEEGFPWVDDLRER |
Ga0066708_103886021 | 3300005576 | Soil | MKYLLLVCWDAERMNGQTEPEPGAARDEDEESFPWL |
Ga0075288_10904791 | 3300005874 | Rice Paddy Soil | MKYLLLVCWDAERMDARTEPDPGETAEEESFPWLDDLQARGAWITGDQ |
Ga0081455_109150681 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKYLLFVCWDTERMNAQIEPDPGDTPDEEEGFPWVD |
Ga0066696_106953681 | 3300006032 | Soil | MKYLLLVCWDAENMDAQTEPDPGEAPNDESFPWLDDLQ |
Ga0066656_107946271 | 3300006034 | Soil | MKYLMLVCWDAENMDALTEPDPADSPDEESFPWLDDLQARG |
Ga0066652_1011172641 | 3300006046 | Soil | VKYMLLVCWDAERMNAREEPRPGDARDHEGFPWLNDLQARGKWVTG |
Ga0075417_102789271 | 3300006049 | Populus Rhizosphere | MKYLLLICWDAERMDAQTEPDPTDPPEEDTFPWLDDI |
Ga0075417_105675292 | 3300006049 | Populus Rhizosphere | MKYLMLVCWDAERMDAQVEPDPNALPDVEEPFPWVDDLQ |
Ga0079222_101859264 | 3300006755 | Agricultural Soil | MKFMLLVSWDAERMNAEEEPKPGEREEESFPWLDDLQARGVWVTGDR |
Ga0075430_1008741892 | 3300006846 | Populus Rhizosphere | MKYMLLVCWGAERMDAQVEPEPSDTPEEPESFPWLGDVQER |
Ga0075431_1014151152 | 3300006847 | Populus Rhizosphere | MKYMLLVCWGAERMDAQVEPEPSDTPEEPESFPWLGDVQERGIWVT |
Ga0075429_1000604641 | 3300006880 | Populus Rhizosphere | MKYMLLVCWDAERMDAQVEPDPTDTPEEPESFPWLDD |
Ga0066710_1018833301 | 3300009012 | Grasslands Soil | MKFLLLVCWDAEKMDAQTEPDATESADEESFPWLDDLQARGIWVTG |
Ga0105245_111670403 | 3300009098 | Miscanthus Rhizosphere | MKFLLLVCWDAEKMNELEEPDGSEAEDQDGFPWLDELQARGAWVIGD |
Ga0126313_117366842 | 3300009840 | Serpentine Soil | MKYLMLVCWDAERMNAQVEPDPGETQDEESFPWLEDVQARGAWITG |
Ga0126304_101390142 | 3300010037 | Serpentine Soil | MKYLLLVCWDGDRMNAQTEPDPAEPQDEEEGFPWVDDL |
Ga0126304_101495434 | 3300010037 | Serpentine Soil | MRFLLLVCWDAEKMDALTVLDAAATTEKESFPWLDDLQSRGVWVMGDQV |
Ga0126304_102374351 | 3300010037 | Serpentine Soil | MKYLLLVCWDAERMNGQTEPDRRAASDEGEGFPWV |
Ga0126310_101201503 | 3300010044 | Serpentine Soil | MKYLLLVCWDADRMNADTEPVPASGTEPPEKESFPWLD |
Ga0134070_104204921 | 3300010301 | Grasslands Soil | MKFLLLLCWDAERMNAQTEPDPTDTPDEESFPWLDDLQARG |
Ga0134084_103398341 | 3300010322 | Grasslands Soil | MKYLLLVCWDAERMNGQTEPEPGAARDEDEESFPWLDDLQARGAW |
Ga0134064_103843491 | 3300010325 | Grasslands Soil | MKFLLMVCWDTDRMNAQTEPDPNEPQADEGFWWVDDLR |
Ga0126383_116700691 | 3300010398 | Tropical Forest Soil | MKYLLLVCWNGERMNGQTEPDAEALKAAEEEGFPWVD |
Ga0134123_115282462 | 3300010403 | Terrestrial Soil | MKFMMLVCWDAGAMDAQTEPDPAEEYEPESFPWLDDVQGRGKW |
Ga0138513_1000382942 | 3300011000 | Soil | MKYMMLICWDAERMDAQEEPDPSEAAEVESFPWLDDVQA |
Ga0120174_11033762 | 3300012008 | Permafrost | MKYLMLVCWDAEKMDGQTEPDPADTPDEESFPWLDDVQARGM* |
Ga0120159_10934641 | 3300012014 | Permafrost | MKYLLLVCWDAEKMDALTEPEPTDTSDEESFPWLDDLQ |
Ga0120191_100442982 | 3300012022 | Terrestrial | MKYLLLVCWDAERMDAQTEPDPGETPDDDSFPWVDDLEARGI |
Ga0136620_102458771 | 3300012186 | Polar Desert Sand | MKYLLVCWDAERMDAQTEPDPGTSQSEDEEGFPWVDDLQARGIW |
Ga0137382_103338162 | 3300012200 | Vadose Zone Soil | MLLVCWDAERMNAREEPRPGDARDHEGFPWLNDLQARGKWVTG |
Ga0137381_102136804 | 3300012207 | Vadose Zone Soil | MKYLMLVCWDAENMDAQTEPDPTDTPEEESFPWLDDLQARGSWIT |
Ga0137381_116739112 | 3300012207 | Vadose Zone Soil | MKYLLLVCWDAENMDAQTEPDPTDTPEEESFPWLDDLQARGSWIT |
Ga0137360_103163661 | 3300012361 | Vadose Zone Soil | MKYLLLVFWDGESMNGQAEPEPGEAPDDTSFPWLDDLQ |
Ga0137317_10130212 | 3300012672 | Soil | MKYMLLVCWETERMDAQVEPDPTDSPEEPESFPWLDDVQERGIWVTG |
Ga0136612_104900402 | 3300012680 | Polar Desert Sand | MKYLLLVCWDAENMDAQTEPDPTDTPDEESFPWLDD |
Ga0157284_102617501 | 3300012893 | Soil | MKFMMLVCWDAQSMDAQTEPDPTDTPDEKSFPWLDDVQARGI |
Ga0157285_101889952 | 3300012897 | Soil | MKYLLPVCRDNGKMNGQTEPDPGAAGEEEPFPWVDELRARASG* |
Ga0137394_109506321 | 3300012922 | Vadose Zone Soil | MKYLMLVCWDAENMDAQTEPDPTDTPDEESFPWLDD |
Ga0164300_100017097 | 3300012951 | Soil | MKFLMLVCWDAEKMDAQTEPEASNDAADDESFPWLDDLQARGIWV |
Ga0164303_113298241 | 3300012957 | Soil | MKFMLLVSWDAERMNAEEEPKPGEREEESFPWLDDLQ |
Ga0164308_121335891 | 3300012985 | Soil | MKFLLLVTWDTERMNAQDEPEPGTEDEDDKGFPWL |
Ga0157380_108746194 | 3300014326 | Switchgrass Rhizosphere | MSLYLLLICWDAERMDAQEEPAPGTAEEPESFPWLDELQARGRWV |
Ga0120171_10531603 | 3300014827 | Permafrost | MKFLMFVCWDAKNMDAQAEPDPANPPDEESFPWLDDLQARGIWVLG |
Ga0182007_102530141 | 3300015262 | Rhizosphere | MKYLLLVCWDRERMDGQTEPDPGAPSDDRGFPWVD |
Ga0183260_101441964 | 3300017787 | Polar Desert Sand | MKYLRLVCWDAERMNAQTEPDPGTSQSEDEEGFPWVDDLQARGIC |
Ga0136617_100365386 | 3300017789 | Polar Desert Sand | MKYLMLVCWDAEKMDAQTEPDPTDTPNDESFPWLDDLQARGIWV |
Ga0184618_100709432 | 3300018071 | Groundwater Sediment | MKFLMLVCWDAEKMDAQTEPESSNDTADNESFPWLDDLQARGIWVTG |
Ga0184625_100816493 | 3300018081 | Groundwater Sediment | MKYLMLVCWEAERMDAQTEPDPTDTPDEESFPWLDDLQAQG |
Ga0190265_112717961 | 3300018422 | Soil | MKYMMLVCWGAEKMDAQPEPEPTGTPDEEGFPWLDDLQA |
Ga0190265_138295671 | 3300018422 | Soil | MRYLMLVCWDAEKMDAQTEPDPTGDPDEESFPWLDDLQARGIWVT |
Ga0190275_134682771 | 3300018432 | Soil | MRFLMLVCWDAENMDAQTEPGPTDTPDEESFPWLDDVQERG |
Ga0066667_100080201 | 3300018433 | Grasslands Soil | MKYLMLVCWDAEKMNAQTEPDPNDTPDEETFPWLDDLQARG |
Ga0066667_110630232 | 3300018433 | Grasslands Soil | MKYLLLVCWDAERMNGQTEPEPGAARDEAEESFPWLDDLQARGASVPGA |
Ga0190268_102388973 | 3300018466 | Soil | MRYLLLVCWDRERMDAQDEPEPGAAPDDDGFLWVDDL |
Ga0190264_117447171 | 3300019377 | Soil | MKYLLLVCWDAERMDAQTEPDPTEAPDEESFPWLDD |
Ga0193741_10749681 | 3300019884 | Soil | MKYMLLVCWDAERMDAQVEPDPTDTSEPESFPWLEDVQERGIWVTGD |
Ga0193696_11125611 | 3300020016 | Soil | MKYLMLVCWDAEKMDAQAEPDPNESTEEESFPWLD |
Ga0182009_107852301 | 3300021445 | Soil | MKCLLLVCWDSASMNAQDEPAPGTPPPAEEEPFPWVDDLRAAGIWKI |
Ga0126371_134513711 | 3300021560 | Tropical Forest Soil | MKFMLLVCWDAENMNGQTEPDPGEDDADKGFPWLDDL |
Ga0222622_111245601 | 3300022756 | Groundwater Sediment | MKFILLVCWDAKNMDAQTEPDSNTKETSEDEGFPWLDD |
Ga0207662_108858731 | 3300025918 | Switchgrass Rhizosphere | MKFLLLVCWDAKKMDARTEPAATAASGTESFPWLDDLVARG |
Ga0207701_113469812 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYLLLVCWDAERMDARTEPDPTDAPHEEEEGFPWLD |
Ga0207679_110817933 | 3300025945 | Corn Rhizosphere | VKYLLLVCWDAENMDALTEPEPGDAAEEEGFPWLDDLQARGR |
Ga0207641_121692981 | 3300026088 | Switchgrass Rhizosphere | MKYLLLVCWDGDRMNDQTEPEPGEEQPDKGFWWVDELREQGIWQI |
Ga0207676_110591252 | 3300026095 | Switchgrass Rhizosphere | VKYLLLVCWDADRMNAQTEPLPSTDAEPPVEESFPWLDELRA |
Ga0209468_10171905 | 3300026306 | Soil | MNFLMLVYWDAKKMDAQTEPDSTDAASTQSFPWLDDLQARGRWITGD |
Ga0209155_12039632 | 3300026316 | Soil | MKYLLLVCWDAEKMDAQTEPDPGNTPDEESFPWLDDLQARE |
Ga0207428_108142931 | 3300027907 | Populus Rhizosphere | MRFLLLVCWDAGKMDAQSEPDPGDTTEKESFPWLDDLQAR |
Ga0307315_100874622 | 3300028721 | Soil | MKYLLLVCWDGERMNAQTEPDAADPPDEEEPFPWVDDLQ |
Ga0307323_102120712 | 3300028787 | Soil | MKFLLLVCWDAENMNAQTEPGPDDPSDKEEGFPWLND |
Ga0307287_103948822 | 3300028796 | Soil | MKYLMLVCWDAEKMDAQTEPVPNENTEEESFPWLDDLRARGIWVT |
Ga0307284_100133345 | 3300028799 | Soil | MKFLMLVCWDAKKMDAQTEPDPTQTPVEESFPWLDDLR |
Ga0265338_111664432 | 3300028800 | Rhizosphere | MKYLLLVCWDAEQMDAQVEPDPGAADDEKGFPWLDELQ |
Ga0307292_101217041 | 3300028811 | Soil | MKFLMLVCWDAEKMDAQTEPESSNDAADDESFPWLDDLQA |
Ga0307292_104264611 | 3300028811 | Soil | MKFLMLVCWDAEQMNARTEPDPSDAPEEEEGFPWLDD |
Ga0307310_107488522 | 3300028824 | Soil | MKYLLLVCWDGERMNAQTEPDAADPPDEEEPFPWVDDLQAR |
Ga0307308_105553202 | 3300028884 | Soil | MKFLMFVCWDAKKMDAQTEPDPKQAPAEESFPWLDDLRSRGAWITGDQL |
Ga0307304_104132921 | 3300028885 | Soil | VKYLLLVCWDAERMDAQTEPEPDSAPEEDEGFPWVD |
Ga0268386_108976951 | 3300030619 | Soil | MKYVMLVCWDAERMDAQIEPDPRDSPEEESFPWLDDLQA |
Ga0307495_100765011 | 3300031199 | Soil | MKFLMLVCWDAEKMDAQTEPESSNDAADDESFPWLDDLQARGIWVT |
Ga0310813_122731812 | 3300031716 | Soil | MKYLLLICWDTEHMNGQTEPEPGAAPAEEGGFPWADDLDARGIRL |
Ga0307405_121580292 | 3300031731 | Rhizosphere | MKYLLLVCWDAEAMDAQVEPDPAEAQADESLPWLDDLQA |
Ga0307468_1010419521 | 3300031740 | Hardwood Forest Soil | MKFMMLVCWDAGAMDAQTEPDPAEEYEPESFPWLEDVQGR |
Ga0307409_1009345702 | 3300031995 | Rhizosphere | MKYLMLVCWDADKMNARPDPEPTAEVAEEEPFPWLDDLRDHLAHR |
Ga0307409_1012825492 | 3300031995 | Rhizosphere | MKYLLLVCWDAERMNDQTEPDPSAAPAEDDEGFPWVDDLRAQGIW |
Ga0247830_109297991 | 3300033551 | Soil | MKYLLLVCWDAERMDAQTEPDPTHTPDVEQEGFPWLDDLQAKGSWI |
Ga0247830_113414751 | 3300033551 | Soil | MKYLLLVCWDAERMNAQAEPDAADPPDEEEPFPWVDDLQARGIWKIG |
Ga0364941_039315_1_129 | 3300034417 | Sediment | MKYMLLVCWDAEQMDAQNEPGPNDTPDEKSFPWLDDLQARGMW |
⦗Top⦘ |