NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090145

Metagenome / Metatranscriptome Family F090145

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090145
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 45 residues
Representative Sequence ALEFYDRWLPGTMRRITGITRTCMPQCVTLRSPGDWAARPGYR
Number of Associated Samples 93
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.93 %
% of genes near scaffold ends (potentially truncated) 98.15 %
% of genes from short scaffolds (< 2000 bps) 97.22 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (62.963 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.482 % of family members)
Environment Ontology (ENVO) Unclassified
(36.111 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.148 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.44%    β-sheet: 0.00%    Coil/Unstructured: 60.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF04672Methyltransf_19 35.19
PF00392GntR 11.11
PF04149DUF397 3.70
PF01402RHH_1 3.70
PF13023HD_3 0.93
PF13560HTH_31 0.93
PF12728HTH_17 0.93
PF01936NYN 0.93
PF13581HATPase_c_2 0.93
PF00005ABC_tran 0.93
PF01850PIN 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG1432NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturationGeneral function prediction only [R] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A62.96 %
All OrganismsrootAll Organisms37.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005175|Ga0066673_10389813Not Available813Open in IMG/M
3300005332|Ga0066388_103891310All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300005445|Ga0070708_100975034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia795Open in IMG/M
3300005467|Ga0070706_101114035Not Available726Open in IMG/M
3300005549|Ga0070704_101943314Not Available546Open in IMG/M
3300005610|Ga0070763_10057145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1871Open in IMG/M
3300006028|Ga0070717_10445403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1167Open in IMG/M
3300006796|Ga0066665_10780503Not Available755Open in IMG/M
3300009520|Ga0116214_1101111Not Available1060Open in IMG/M
3300009525|Ga0116220_10503607Not Available550Open in IMG/M
3300009700|Ga0116217_10855257Not Available559Open in IMG/M
3300010366|Ga0126379_13678441Not Available514Open in IMG/M
3300010379|Ga0136449_101342363Not Available1110Open in IMG/M
3300010379|Ga0136449_102284239All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300010379|Ga0136449_102937985Not Available668Open in IMG/M
3300010379|Ga0136449_103384123Not Available611Open in IMG/M
3300010396|Ga0134126_12040880Not Available627Open in IMG/M
3300010876|Ga0126361_10209277Not Available1528Open in IMG/M
3300012356|Ga0137371_11079730Not Available605Open in IMG/M
3300012357|Ga0137384_11115040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300013104|Ga0157370_11337142Not Available645Open in IMG/M
3300013105|Ga0157369_11571865Not Available669Open in IMG/M
3300013307|Ga0157372_10959569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia991Open in IMG/M
3300013307|Ga0157372_12093226Not Available650Open in IMG/M
3300015241|Ga0137418_10772072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia725Open in IMG/M
3300015357|Ga0134072_10413920Not Available534Open in IMG/M
3300016294|Ga0182041_10534594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1021Open in IMG/M
3300016341|Ga0182035_11059913Not Available720Open in IMG/M
3300016422|Ga0182039_10966816Not Available763Open in IMG/M
3300016445|Ga0182038_11012480Not Available736Open in IMG/M
3300017928|Ga0187806_1262609Not Available600Open in IMG/M
3300017932|Ga0187814_10392099Not Available540Open in IMG/M
3300017943|Ga0187819_10546766Not Available658Open in IMG/M
3300017946|Ga0187879_10255964Not Available975Open in IMG/M
3300017973|Ga0187780_10313375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae1104Open in IMG/M
3300017974|Ga0187777_11471079All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300018001|Ga0187815_10397284Not Available587Open in IMG/M
3300018012|Ga0187810_10377320Not Available594Open in IMG/M
3300018044|Ga0187890_10298691Not Available904Open in IMG/M
3300018058|Ga0187766_10008015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6092Open in IMG/M
3300018058|Ga0187766_10564846Not Available773Open in IMG/M
3300018058|Ga0187766_11116658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300018058|Ga0187766_11269588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae536Open in IMG/M
3300018060|Ga0187765_10552959Not Available736Open in IMG/M
3300018085|Ga0187772_11324226Not Available533Open in IMG/M
3300018086|Ga0187769_10645170Not Available800Open in IMG/M
3300020581|Ga0210399_11053053Not Available653Open in IMG/M
3300020581|Ga0210399_11081199Not Available643Open in IMG/M
3300021180|Ga0210396_10361245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora1280Open in IMG/M
3300021181|Ga0210388_11558145Not Available550Open in IMG/M
3300021407|Ga0210383_10272797All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300021432|Ga0210384_11136576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia685Open in IMG/M
3300021479|Ga0210410_10894006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia775Open in IMG/M
3300021559|Ga0210409_11671322Not Available513Open in IMG/M
3300021560|Ga0126371_13429127Not Available535Open in IMG/M
3300021860|Ga0213851_1644227Not Available502Open in IMG/M
3300025900|Ga0207710_10204722All Organisms → cellular organisms → Bacteria → Proteobacteria976Open in IMG/M
3300025929|Ga0207664_11914083Not Available516Open in IMG/M
3300027680|Ga0207826_1093994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia825Open in IMG/M
3300028879|Ga0302229_10009019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6199Open in IMG/M
3300029944|Ga0311352_11306743Not Available548Open in IMG/M
3300031234|Ga0302325_12793385Not Available572Open in IMG/M
3300031543|Ga0318516_10022505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3240Open in IMG/M
3300031546|Ga0318538_10778516Not Available519Open in IMG/M
3300031564|Ga0318573_10208424Not Available1037Open in IMG/M
3300031670|Ga0307374_10483770Not Available673Open in IMG/M
3300031681|Ga0318572_10092424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1696Open in IMG/M
3300031708|Ga0310686_102692926Not Available1486Open in IMG/M
3300031723|Ga0318493_10638462Not Available595Open in IMG/M
3300031747|Ga0318502_10185219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1200Open in IMG/M
3300031751|Ga0318494_10221808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1080Open in IMG/M
3300031751|Ga0318494_10300129Not Available926Open in IMG/M
3300031765|Ga0318554_10702402Not Available567Open in IMG/M
3300031770|Ga0318521_10905836Not Available539Open in IMG/M
3300031798|Ga0318523_10144908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planobispora → Planobispora longispora1180Open in IMG/M
3300031819|Ga0318568_10956842Not Available529Open in IMG/M
3300031821|Ga0318567_10642907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300031831|Ga0318564_10545933Not Available502Open in IMG/M
3300031835|Ga0318517_10502895Not Available546Open in IMG/M
3300031845|Ga0318511_10323708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300031890|Ga0306925_10238597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1960Open in IMG/M
3300031890|Ga0306925_10333876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1629Open in IMG/M
3300031893|Ga0318536_10217406Not Available972Open in IMG/M
3300031910|Ga0306923_10651913Not Available1177Open in IMG/M
3300031910|Ga0306923_12062571Not Available577Open in IMG/M
3300031912|Ga0306921_11521303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae730Open in IMG/M
3300031945|Ga0310913_10220655Not Available1328Open in IMG/M
3300031946|Ga0310910_11148613Not Available604Open in IMG/M
3300032001|Ga0306922_10536028Not Available1245Open in IMG/M
3300032008|Ga0318562_10100149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1644Open in IMG/M
3300032025|Ga0318507_10154572Not Available982Open in IMG/M
3300032025|Ga0318507_10166669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planobispora → Planobispora longispora946Open in IMG/M
3300032054|Ga0318570_10170814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae977Open in IMG/M
3300032067|Ga0318524_10695534Not Available536Open in IMG/M
3300032076|Ga0306924_11801873Not Available638Open in IMG/M
3300032091|Ga0318577_10063336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1681Open in IMG/M
3300032160|Ga0311301_11643257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia778Open in IMG/M
3300032160|Ga0311301_11745869Not Available745Open in IMG/M
3300032261|Ga0306920_103712368Not Available560Open in IMG/M
3300032261|Ga0306920_103742726Not Available557Open in IMG/M
3300032782|Ga0335082_11350615Not Available582Open in IMG/M
3300032892|Ga0335081_12255910Not Available571Open in IMG/M
3300032954|Ga0335083_10342691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1297Open in IMG/M
3300032955|Ga0335076_10582581All Organisms → cellular organisms → Bacteria → Terrabacteria group1001Open in IMG/M
3300033134|Ga0335073_10364717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1705Open in IMG/M
3300033134|Ga0335073_11802435Not Available571Open in IMG/M
3300033289|Ga0310914_11387777Not Available605Open in IMG/M
3300034124|Ga0370483_0041641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1427Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.04%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.33%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland8.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.70%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.78%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.85%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.93%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066673_1038981323300005175SoilLEFYDRWLPGTMRRITAITRTCMPHCVMLRGPGDWVARPGYR*
Ga0066388_10389131013300005332Tropical Forest SoilALEFYDRWLPGTMRRISGITGKCIPHCMMLRGPGDWAVRPRRA*
Ga0070708_10097503413300005445Corn, Switchgrass And Miscanthus RhizosphereGRPDLARALEFYDRWLPGTMRRISAITGQCMPHCVMLRASGDWAARPRYG*
Ga0070706_10111403513300005467Corn, Switchgrass And Miscanthus RhizosphereEFYDRWLPGTMRRITGITGKCMPDCVTLRGPGEWTARPGYR*
Ga0070704_10194331413300005549Corn, Switchgrass And Miscanthus RhizosphereLEFYDRWLPGTMRRITGITGKCMPHCVMLRGPGDWAARPGYR*
Ga0070763_1005714513300005610SoilRPDLARALEFYDRWLPGTMRRITGITRACMPHCVMLRGHGDWAARPGYR*
Ga0070717_1044540313300006028Corn, Switchgrass And Miscanthus RhizospherePGTMRRISAITGQCMPHCVMLRASGDWPARPGYR*
Ga0066665_1078050313300006796SoilTRPDLARTLEFYDGWLPGTMRRITGITGKCMPHCVTLRGPGEWAARPGYH*
Ga0116214_110111113300009520Peatlands SoilPDLARALEFYDRWLPGTMRRIAGITRTCIPQCVMLRGPGDWAARPGYR*
Ga0116220_1050360723300009525Peatlands SoilLARALEFHDRWLPGTMRRITDITRQCVPQCVMLRSPGDWAARPGYR*
Ga0116217_1085525723300009700Peatlands SoilGGPRPDLARALEFYDRWLPGTMRRITDITRACMPQCVMLRGPGDWNALPRYR*
Ga0126379_1367844123300010366Tropical Forest SoilGRALEFYDRWLPSTMRRIAGITLTCIPHCVTLRSPGDWAARPGYG*
Ga0136449_10134236323300010379Peatlands SoilRPDLARALEFYDRWLPGTMRRITDITRACMPQCVTLRGPDDWNALPRYR*
Ga0136449_10228423933300010379Peatlands SoilARALEFYDRWLPGTMRRITDITRACMPQCVMLRGPGDWNALPRYR*
Ga0136449_10293798513300010379Peatlands SoilRALEFHDRWLPGTMRRITGITGKCMPHCVMLRGPGDWAARPGYR*
Ga0136449_10338412323300010379Peatlands SoilLKFYDRWLPGTMSRITHITRTCIPNCVTLRSPSDWAARPGYR*
Ga0134126_1204088013300010396Terrestrial SoilRPDLARALEFYDRWLPGTMRRITGITGKCVPHCVMLRDRGDWAVRPGYR*
Ga0126361_1020927743300010876Boreal Forest SoilLARALEFHDRWLPGTMRRITEITRASTPQCVMLRNPGDWAARPGYR*
Ga0137371_1107973023300012356Vadose Zone SoilARALEFYDRWLPGTMRRITGITGKCMPHCVMLRGPGQWAARPGYR*
Ga0137384_1111504013300012357Vadose Zone SoilPDLAMALEFYDRWLPGTMRRITGITRTCTPHCVTLRSPGDWAARPGYR*
Ga0157370_1133714223300013104Corn RhizosphereGTRLDLARALEFYDRWLPGTMRRITGITGKCMPHCVMLRGPGDWAARPGYR*
Ga0157369_1157186533300013105Corn RhizospherePGTMRRITGITGKCMPHCVMLRGPSDWAARPGYR*
Ga0157372_1095956923300013307Corn RhizospherePDLARALEFYDRWLPGTMRRITSITGKCMPHCVTLRGPGDWAARPGYR*
Ga0157372_1209322633300013307Corn RhizosphereWLPGTMRRITGITGKCMPHCVMLRGPSDWAARPGYR*
Ga0137418_1077207223300015241Vadose Zone SoilDLARALEFYDRWLPGIMRRITGITGKCMPHCVMLRGTGDWAARPGYR*
Ga0134072_1041392023300015357Grasslands SoilWLPGTMRRITAITRTCMPHCVMLRGPGDWVARPGYR*
Ga0182041_1053459413300016294SoilAAAAGGAGTDLDRALEFYDRWLPGTMRRITVITVITGKCMPQCVLLRGPGDRAARPGYG
Ga0182035_1105991313300016341SoilTGPDLARALEFYDRWLPGNMRRITDITRNCLPQCTTLRSPDDWTARPRYR
Ga0182039_1096681613300016422SoilEFYDRWLPGTMRRVTDITRTCMPQCATLRSPGDWTARPPYR
Ga0182038_1101248033300016445SoilPDLARALEFYDRWLPGTIRRITGITRACMPQCVTLHRPDEWAARPPYR
Ga0187806_126260913300017928Freshwater SedimentDRWLPGTIRRISDITRTCMPQCATLSSPGGWTARPRYR
Ga0187814_1039209913300017932Freshwater SedimentEFYDRWLPGTMRRISDITRTCMPQCATLSSPGGWTARPRYR
Ga0187819_1054676613300017943Freshwater SedimentALEFYDRWLPGTMRRITGITRTCMPQCVTLRSPGDWAARPGYR
Ga0187879_1025596413300017946PeatlandGNRPDLTRALDFYDRWLPGTMRRITGITRTCTPQCVTLRGPGDQAPLPRYR
Ga0187780_1031337513300017973Tropical PeatlandGSRPDLARALEFYDRWLPGTMRRITDITRACLPHCATLRSPGDWASRPGYR
Ga0187777_1147107913300017974Tropical PeatlandYAGERPDLARALEFYDRWLPGTMRRITGITRGCTPQCATLRSTGDWPARPGYR
Ga0187815_1039728423300018001Freshwater SedimentALEFYDRWLPGTMRRITHITRTCMPHCVMLRSPGDWAARPGYR
Ga0187810_1037732013300018012Freshwater SedimentPDLARALEFYDRWLPNTIRHIADITRACMPQCVTLRSPGDWNALPQYR
Ga0187890_1029869113300018044PeatlandLEFQDRWLPGTMRRITSFTCECRSQCMTIRSPGNWPARPSYH
Ga0187766_1000801513300018058Tropical PeatlandRPDLARALEFYDRWLPGTMRRITGITRGCTPQCATLRSTGDWPARPGYR
Ga0187766_1056484613300018058Tropical PeatlandALEFYDRWLPGTMRRITGITRNCMAQCVMLRGPGDWAARTGYR
Ga0187766_1111665823300018058Tropical PeatlandFYDRWLPGTMRRITDITRACLPHCATLRSPGDWAPRPGYR
Ga0187766_1126958823300018058Tropical PeatlandARALEFYDRWLPGTMRRINAITGKCVPECVMLRGPGDWAARTRYR
Ga0187765_1055295913300018060Tropical PeatlandDRWLPGTMRRITAITGKCMPHCVMLRDRGDWAARPEYR
Ga0187772_1132422623300018085Tropical PeatlandWLPGTMRRITSITRKCIPQCVTLRGPGDWDVRPEYH
Ga0187769_1064517033300018086Tropical PeatlandPDLARALEFYDRWLPGTMRRITDITRGCLPQCATLQSPGDWAARPRYR
Ga0210399_1105305323300020581SoilRALEFYDRWLPGTMRRITGITRACMPHCVMLRGHSDWAARPGYR
Ga0210399_1108119923300020581SoilLARALEFYDRWLPGTMRRITGITGKCIPHCAMLRGPGEWTARPGYR
Ga0210396_1036124513300021180SoilLEFYDRWLPGTMRRITGITRKCVPQCAMLRSPGDWTARPSYH
Ga0210388_1155814513300021181SoilARALEFYDRWLPGTMRRITDITRTCMPQCALLRGPGDWAAHPQYRR
Ga0210383_1027279743300021407SoilARALEFYDRWLPGTIRRITDITRGCMPQCATLRSHGDWTARPRYR
Ga0210384_1113657623300021432SoilARALEFYDRWLPGTMRRITGTTGKCMPHCVMLRGTGDWAARPGYR
Ga0210410_1089400623300021479SoilYGGQRPDLARALEFYDRWLPGTMRRISAITGQCMPHCVMLRASGDWAARPRYG
Ga0210409_1167132213300021559SoilALEFYDRWLPGTMRRITGITGKCMPHCVMLRGPGEWVARPSYR
Ga0126371_1342912723300021560Tropical Forest SoilARALEFHDRWLPGTMRRITGITAKCVPHCVTLRSPGDWATRSGYR
Ga0213851_164422713300021860WatershedsDLARALEFYDRWLPGTMRRISDITRTCMPQCATLSSPGGWTARPRYR
Ga0207710_1020472243300025900Switchgrass RhizosphereGGTRPDLARALEFYDRWLPGAMRRITGITGKCMPRCVMLRGPSDWAARPGYR
Ga0207664_1191408323300025929Agricultural SoilYDRWLPGTMRRITGITGRCVPHCVMLRDRGDWAVRPGYR
Ga0207826_109399433300027680Tropical Forest SoilRALDFYDHWLPSTMRRIADITRTCIPHCVTLRNPGDWAARPGYR
Ga0302229_1000901913300028879PalsaPDLARALEFYDRWLPGTMRRITDITGACLSQCVLLRGPGDRATRPGYR
Ga0311352_1130674323300029944PalsaRWLPGTMRRITGITRTCTPHCVALRGPGDRVDLPGYR
Ga0302325_1279338523300031234PalsaLPGAMRRINGITRKCVLQCVMLDGPGDVVARPGYR
Ga0318516_1002250513300031543SoilPDLARALEFYDRWLPGTMRRITDITRGCLPHCTTLRSPDNWAARPRYR
Ga0318538_1077851623300031546SoilTYAGTGPDLARALEFYDRWLPGTMRRITDITRNCLPQCTTLRSPDDWTARPRYR
Ga0318573_1020842413300031564SoilAGTRPDLDRALEFYDRWLPGTIRRITNITRGCLPQCATLRSPGDWTARPRYR
Ga0307374_1048377013300031670SoilEFHDRWLPGTIRRITDITRACMPQCVMLRYPSERPASPGYR
Ga0318572_1009242413300031681SoilARALEFHDRWLPGTMRRVNAITGKCVPQCVLLRCPGDRAARPGYR
Ga0310686_10269292643300031708SoilLARALEFYDRWLPGTMRRITDITRTCMPQCALLRGLGDWAALPRYRR
Ga0318493_1063846213300031723SoilEFYDRWLPGTIRRITNITRGCLPQCATLRSPGDWTARPRYR
Ga0318502_1018521913300031747SoilDLARALEFHDRWLPGTMRRVNAITGKCVPQCVLLRCPGDRAARPGYR
Ga0318494_1022180813300031751SoilDRWLPGTMRRITDITRNCLPQCTTLRSPDDWTARPRYR
Ga0318494_1030012913300031751SoilARALEFYDRWLPGTIRRITDITRACMPQCVTLHRPDEWAARPPYR
Ga0318554_1070240233300031765SoilARALEFYDRWLPGTMRRVTDITRTCMPQCATLRSPGDWTARPPYR
Ga0318521_1090583613300031770SoilRWLPGTMRRITGITAKCVPHCVTLRGPSDWAARPGYR
Ga0318523_1014490813300031798SoilARALEFYDRWLPGTMRRITDITRGCLPHCTTLRSPDNWAARPRYR
Ga0318568_1095684213300031819SoilGGTRPDLARALEFYDRWLPGTMRRITGKCMPQCVMLRSARDWAARPGYR
Ga0318567_1064290723300031821SoilSGTRPDLARALEFYDRWLPGTMRRITGITRECMPQCVMLRGPGDWAARPGYR
Ga0318564_1054593313300031831SoilPDLARALEFYDRWLPGSIRRITDITRGCLPQCATLRSPADWAARPPYR
Ga0318517_1050289523300031835SoilRPDRARALEFYDRWLPGTMRRINAITGKCVPQCVMLRGPGDWAARPGYR
Ga0318511_1032370813300031845SoilPDLARALEFHDRWLPGTMRRITGITGKCMPQCVLLRGPGDWAARPGYC
Ga0306925_1023859713300031890SoilYDRWLPGTMRRINAITGKCVPQCVMLRGPGDWAARPGYR
Ga0306925_1033387633300031890SoilGGARPDLARALEFYDRWLPGTMRRITAITGNCMPHCVMLRDRGDWAARPGYR
Ga0318536_1021740643300031893SoilWLPGTMRRITDITRNCLPQCTTLRSPDDWTARPRYR
Ga0306923_1065191313300031910SoilPDLARALEFYDRWLPGTMRRITDITRTCVPQCALLRGTGDWAVDPRYRRPG
Ga0306923_1206257113300031910SoilAYGGTRPDRARALEFYDRWLPGTMRRINAITGKCVPQCVMLRGPGDWAARPGYR
Ga0306921_1152130313300031912SoilFYDRWLPGAMRRITGITRTCLPQCATLRSPGDWAARPRYR
Ga0310913_1022065543300031945SoilFYDRWLPGTMRRITGITRPCMPHRVTLRGPGEWTARPEYR
Ga0310910_1114861323300031946SoilSRPDLARALEFHDRWLPGTMRRITGITAKCVPQCVMLRGPSDWAARPGYR
Ga0306922_1053602843300032001SoilGTRPDLARALEFYDRWLPGTMRRITDITRNCLPQCTTLRSPDDWTARPRYR
Ga0318562_1010014913300032008SoilWLPGTMRRITGITGKCMPQCVLLRGPGDWAARPGYC
Ga0318507_1015457243300032025SoilDLARALEFYDRWLPGTMRRVTDITRTCMPQCATLRSPGDWTARPPYR
Ga0318507_1016666923300032025SoilYDRWLPGTMRRITDITRGCLPHCTTLRSPDNWAARPRYR
Ga0318570_1017081433300032054SoilPTPAATPTSPRALEFYDRWLPGTMRRITGITRPCMPHRVTLRGPGEWTARPEYR
Ga0318524_1069553423300032067SoilTYTGPGPGPDLARALEFYDRWLPGTMRRITDITRGCLPQCATLRSPDNWAARPRHR
Ga0306924_1180187313300032076SoilRPDLARALEFYDRWLPGTMRRITDITRTCVPQCALLRGTGDWAVDPRYRRPG
Ga0318577_1006333633300032091SoilDRWLPGTMRRITGITGKCMPQCVLLRGPGDWAARPGYC
Ga0311301_1164325713300032160Peatlands SoilGQRPDLARALEFYDRWLPGTMRRISAITGQCMPHCTMLRASGDWATRPGYR
Ga0311301_1174586913300032160Peatlands SoilARALEFYDRWLPGTMRRITDITRACMPQCVMLRGPGDWNALPRYR
Ga0306920_10371236823300032261SoilGSRPDLARALEFHDHWLPGTMRRITGITAKCVPQCVMLRGPGDWAARPGYS
Ga0306920_10374272623300032261SoilRALEFHDRWLPGTMRRITGITAKCVPHCVTLRGPSDWAARPGYR
Ga0335082_1135061523300032782SoilVNTFAVHDRWLPGTMRRITGITGKCMPQCVLLRGPSDRAARPGYR
Ga0335081_1225591023300032892SoilRALEFHDRWLPGTMRRVTGITGQCMPHCVMLRGAGDWGARPGYR
Ga0335083_1034269113300032954SoilWLPGTMRRIAGITGKCMPQCVLLRGPGDRAARPGYR
Ga0335076_1058258123300032955SoilLEFHDRWLPGTMRRITRITRECMPQCVTLRGPSNWAARPGYR
Ga0335073_1036471713300033134SoilHPDLARALEFYDRWLPGTMRRITGITRNCLPQCATLCSPGDWAARPGYR
Ga0335073_1180243523300033134SoilTRPDLARALKFYDRWLPGTMRRIAGLTAQCVPQCVTLRGPGDWAARPRYR
Ga0310914_1138777723300033289SoilDLARALEFYDRWLPGTMRRITDITRTCVPQCALLRGTGDWAVDPRYRRPG
Ga0370483_0041641_2_1153300034124Untreated Peat SoilRWLPGTMHRITGITRTCTPHCVALRGPGDRVDLPGYR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.