Metagenome / Metatranscriptome Family F090123

Basic Information
Family ID	F090123
Family Type	Metagenome / Metatranscriptome
Number of Sequences	108
Average Sequence Length	41 residues
Representative Sequence	MSVIDFFEYLAASDHTVELAHELADVWVARQVSDVYQPAA
Number of Associated Samples	84
Number of Associated Scaffolds	108

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	78.50 %
% of genes near scaffold ends (potentially truncated)	23.15 %
% of genes from short scaffolds (< 2000 bps)	90.74 %
Associated GOLD sequencing projects	78
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.57

Most Common Taxonomy
Group	Bacteria (57.407 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil (9.259 % of family members)
Environment Ontology (ENVO)	Unclassified (23.148 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (47.222 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 108 Family Scaffolds
PF00694	Aconitase_C	37.04
PF13649	Methyltransf_25	14.81
PF08241	Methyltransf_11	5.56
PF08502	LeuA_dimer	3.70
PF00330	Aconitase	3.70
PF12847	Methyltransf_18	1.85
PF00486	Trans_reg_C	0.93
PF00154	RecA	0.93
PF00588	SpoU_methylase	0.93
PF08713	DNA_alkylation	0.93
PF08242	Methyltransf_12	0.93

COG ID	Name	Functional Category	% Frequency in 108 Family Scaffolds
COG0119	Isopropylmalate/homocitrate/citramalate synthases	Amino acid transport and metabolism [E]	3.70
COG0219	tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain	Translation, ribosomal structure and biogenesis [J]	0.93
COG0468	RecA/RadA recombinase	Replication, recombination and repair [L]	0.93
COG0565	tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase	Translation, ribosomal structure and biogenesis [J]	0.93
COG0566	tRNA G18 (ribose-2'-O)-methylase SpoU	Translation, ribosomal structure and biogenesis [J]	0.93
COG4912	3-methyladenine DNA glycosylase AlkD	Replication, recombination and repair [L]	0.93

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	57.41 %
Unclassified	root	N/A	42.59 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	57.41 %
Unclassified	root	N/A	42.59 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	57.41 %
Unclassified	root	N/A	42.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.59 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	14.81 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.59 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	14.81 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.59 %
Acidimicrobiia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia	5.56 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.85 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.59 %
Acidimicrobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales	5.56 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.85 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.59 %
Acidimicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae	5.56 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.85 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.59 %
unclassified Acidimicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae	5.56 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.85 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.59 %
Acidimicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium	5.56 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.85 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908006\|FWIROz_GJ87FRN02HW6H0	Not Available	512	Open in IMG/M
3300001686\|C688J18823_10254493	All Organisms → cellular organisms → Bacteria	1166	Open in IMG/M
3300003992\|Ga0055470_10204989	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300004114\|Ga0062593_103011726	Not Available	539	Open in IMG/M
3300004153\|Ga0063455_100322149	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300004479\|Ga0062595_100755876	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium	792	Open in IMG/M
3300004479\|Ga0062595_101386032	Not Available	639	Open in IMG/M
3300005172\|Ga0066683_10638772	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300005184\|Ga0066671_10133286	All Organisms → cellular organisms → Bacteria	1426	Open in IMG/M
3300005332\|Ga0066388_107129199	Not Available	562	Open in IMG/M
3300005367\|Ga0070667_102101229	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300005434\|Ga0070709_10501542	All Organisms → cellular organisms → Bacteria	922	Open in IMG/M
3300005436\|Ga0070713_100222141	All Organisms → cellular organisms → Bacteria	1714	Open in IMG/M
3300005436\|Ga0070713_100341190	All Organisms → cellular organisms → Bacteria	1388	Open in IMG/M
3300005450\|Ga0066682_10960964	Not Available	506	Open in IMG/M
3300005454\|Ga0066687_10657766	Not Available	623	Open in IMG/M
3300005455\|Ga0070663_100993677	Not Available	729	Open in IMG/M
3300005559\|Ga0066700_10421224	All Organisms → cellular organisms → Bacteria	940	Open in IMG/M
3300005560\|Ga0066670_10206823	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1180	Open in IMG/M
3300005563\|Ga0068855_101606547	Not Available	665	Open in IMG/M
3300005764\|Ga0066903_101292728	Not Available	1362	Open in IMG/M
3300005764\|Ga0066903_104111521	Not Available	779	Open in IMG/M
3300005764\|Ga0066903_107127133	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300005836\|Ga0074470_11413990	Not Available	550	Open in IMG/M
3300005994\|Ga0066789_10309797	All Organisms → cellular organisms → Bacteria	660	Open in IMG/M
3300006047\|Ga0075024_100004768	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5448	Open in IMG/M
3300006047\|Ga0075024_100210737	All Organisms → cellular organisms → Bacteria	915	Open in IMG/M
3300006057\|Ga0075026_100688384	All Organisms → cellular organisms → Bacteria	610	Open in IMG/M
3300006059\|Ga0075017_100023938	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3986	Open in IMG/M
3300006797\|Ga0066659_11143035	All Organisms → cellular organisms → Bacteria	651	Open in IMG/M
3300009012\|Ga0066710_101521895	All Organisms → cellular organisms → Bacteria	1031	Open in IMG/M
3300009090\|Ga0099827_10770600	All Organisms → cellular organisms → Bacteria	832	Open in IMG/M
3300009090\|Ga0099827_11774627	Not Available	538	Open in IMG/M
3300009098\|Ga0105245_10919114	All Organisms → cellular organisms → Bacteria	917	Open in IMG/M
3300010396\|Ga0134126_11481249	Not Available	748	Open in IMG/M
3300010400\|Ga0134122_11655165	All Organisms → cellular organisms → Bacteria	666	Open in IMG/M
3300010856\|Ga0126358_1173851	Not Available	607	Open in IMG/M
3300010857\|Ga0126354_1049903	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	992	Open in IMG/M
3300010858\|Ga0126345_1213102	Not Available	643	Open in IMG/M
3300010861\|Ga0126349_1009049	Not Available	596	Open in IMG/M
3300010861\|Ga0126349_1136563	Not Available	517	Open in IMG/M
3300010861\|Ga0126349_1136749	Not Available	506	Open in IMG/M
3300010862\|Ga0126348_1047483	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1169	Open in IMG/M
3300010862\|Ga0126348_1232724	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium	709	Open in IMG/M
3300010865\|Ga0126346_1323341	All Organisms → cellular organisms → Bacteria	794	Open in IMG/M
3300010880\|Ga0126350_11897306	Not Available	535	Open in IMG/M
3300011120\|Ga0150983_16452042	Not Available	506	Open in IMG/M
3300012212\|Ga0150985_102552038	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium	706	Open in IMG/M
3300012212\|Ga0150985_110247917	Not Available	522	Open in IMG/M
3300012212\|Ga0150985_115362986	Not Available	1579	Open in IMG/M
3300012212\|Ga0150985_119169174	Not Available	539	Open in IMG/M
3300012212\|Ga0150985_120453225	All Organisms → cellular organisms → Bacteria	740	Open in IMG/M
3300012469\|Ga0150984_109958080	Not Available	516	Open in IMG/M
3300012469\|Ga0150984_111598670	All Organisms → cellular organisms → Bacteria	1089	Open in IMG/M
3300012469\|Ga0150984_123361730	All Organisms → cellular organisms → Bacteria	725	Open in IMG/M
3300012683\|Ga0137398_11055266	Not Available	561	Open in IMG/M
3300012927\|Ga0137416_12074949	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	522	Open in IMG/M
3300012931\|Ga0153915_10364952	All Organisms → cellular organisms → Bacteria	1627	Open in IMG/M
3300012984\|Ga0164309_11105577	Not Available	660	Open in IMG/M
3300012989\|Ga0164305_11964894	Not Available	533	Open in IMG/M
3300013772\|Ga0120158_10123370	All Organisms → cellular organisms → Bacteria	1495	Open in IMG/M
3300014322\|Ga0075355_1005313	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2519	Open in IMG/M
3300014968\|Ga0157379_11942187	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300015171\|Ga0167648_1006444	All Organisms → cellular organisms → Bacteria	2978	Open in IMG/M
3300015197\|Ga0167638_1107351	Not Available	525	Open in IMG/M
3300016319\|Ga0182033_10475480	All Organisms → cellular organisms → Bacteria	1070	Open in IMG/M
3300016371\|Ga0182034_10829256	All Organisms → cellular organisms → Bacteria	792	Open in IMG/M
3300017944\|Ga0187786_10104504	All Organisms → cellular organisms → Bacteria	959	Open in IMG/M
3300017959\|Ga0187779_10162257	All Organisms → cellular organisms → Bacteria	1383	Open in IMG/M
3300017959\|Ga0187779_10211848	All Organisms → cellular organisms → Bacteria	1215	Open in IMG/M
3300017959\|Ga0187779_10294906	Not Available	1036	Open in IMG/M
3300017974\|Ga0187777_10183399	All Organisms → cellular organisms → Bacteria	1406	Open in IMG/M
3300018060\|Ga0187765_10907659	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300018482\|Ga0066669_10720291	All Organisms → cellular organisms → Bacteria	879	Open in IMG/M
3300020069\|Ga0197907_11499839	Not Available	593	Open in IMG/M
3300020076\|Ga0206355_1345919	Not Available	583	Open in IMG/M
3300021858\|Ga0213852_1426583	Not Available	581	Open in IMG/M
3300022467\|Ga0224712_10260842	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium	803	Open in IMG/M
3300025916\|Ga0207663_10187485	Not Available	1483	Open in IMG/M
3300025927\|Ga0207687_10823615	All Organisms → cellular organisms → Bacteria	792	Open in IMG/M
3300025928\|Ga0207700_11209621	All Organisms → cellular organisms → Bacteria	674	Open in IMG/M
3300025928\|Ga0207700_11267014	All Organisms → cellular organisms → Bacteria	657	Open in IMG/M
3300026300\|Ga0209027_1157535	Not Available	767	Open in IMG/M
3300026312\|Ga0209153_1263128	Not Available	553	Open in IMG/M
3300027039\|Ga0207855_1003646	Not Available	2419	Open in IMG/M
3300027915\|Ga0209069_10003344	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	8192	Open in IMG/M
3300027915\|Ga0209069_10081917	All Organisms → cellular organisms → Bacteria	1541	Open in IMG/M
3300028379\|Ga0268266_11275129	All Organisms → cellular organisms → Bacteria	710	Open in IMG/M
3300028800\|Ga0265338_10441933	Not Available	922	Open in IMG/M
3300028800\|Ga0265338_11100287	Not Available	535	Open in IMG/M
3300029987\|Ga0311334_11298784	Not Available	612	Open in IMG/M
3300029987\|Ga0311334_11627565	All Organisms → cellular organisms → Bacteria	548	Open in IMG/M
3300029990\|Ga0311336_10961454	All Organisms → cellular organisms → Bacteria	741	Open in IMG/M
3300030997\|Ga0073997_12046233	Not Available	515	Open in IMG/M
3300031238\|Ga0265332_10219270	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium	789	Open in IMG/M
3300031251\|Ga0265327_10025846	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3413	Open in IMG/M
3300031251\|Ga0265327_10160781	All Organisms → cellular organisms → Bacteria	1037	Open in IMG/M
3300031711\|Ga0265314_10693293	Not Available	516	Open in IMG/M
3300032261\|Ga0306920_102401588	All Organisms → cellular organisms → Bacteria	728	Open in IMG/M
3300032770\|Ga0335085_10002288	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	36375	Open in IMG/M
3300032770\|Ga0335085_10002465	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	34452	Open in IMG/M
3300032893\|Ga0335069_10469356	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium	1465	Open in IMG/M
3300032893\|Ga0335069_10796834	Not Available	1065	Open in IMG/M
3300032897\|Ga0335071_11464592	Not Available	627	Open in IMG/M
3300033412\|Ga0310810_10544149	All Organisms → cellular organisms → Bacteria	1137	Open in IMG/M
3300034268\|Ga0372943_0184672	Not Available	1286	Open in IMG/M
3300034965\|Ga0370497_0042997	Not Available	984	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	80.56%
Host-Associated	Host-Associated	19.44%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	71.30%
Plants	Host-Associated → Plants	19.44%
Aquatic	Environmental → Aquatic	9.26%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	68.52%
Rhizosphere	Host-Associated → Plants → Rhizosphere	13.89%
Sediment	Environmental → Aquatic → Sediment	6.48%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.56%
Peat	Environmental → Terrestrial → Peat	2.78%
Freshwater	Environmental → Aquatic → Freshwater	1.85%
Marine	Environmental → Aquatic → Marine	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	41.67%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	13.89%
Loam	Environmental → Terrestrial → Soil → Loam	12.96%
Soil	Host-Associated → Plants → Rhizosphere → Soil	11.11%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.48%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.63%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.78%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.93%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.93%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.93%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.15%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	12.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	11.11%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.19%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.48%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.56%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.56%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.63%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.63%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.78%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.78%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.85%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.93%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.93%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.93%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.93%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.93%

Habitat	Taxonomy	Distribution
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	9.26%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.41%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	5.56%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	5.56%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	5.56%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.56%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	5.56%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	4.63%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	4.63%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.70%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.78%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	2.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.78%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.78%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	2.78%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	2.78%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.85%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.85%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.85%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.93%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.93%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.93%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.93%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.93%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.93%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.93%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.93%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908006	Soil microbial communities from sample at FACE Site Metagenome WIR_Oz2	Environmental	Open in IMG/M
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300003992	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005994	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010856	Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010857	Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010858	Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010861	Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010862	Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010865	Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010880	Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013772	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M	Environmental	Open in IMG/M
3300014322	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015171	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine)	Environmental	Open in IMG/M
3300015197	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)	Environmental	Open in IMG/M
3300021858	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026300	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026312	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)	Environmental	Open in IMG/M
3300027039	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes)	Environmental	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Host-Associated	Open in IMG/M
3300029987	I_Fen_E3 coassembly	Environmental	Open in IMG/M
3300029990	I_Fen_N2 coassembly	Environmental	Open in IMG/M
3300030997	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Host-Associated	Open in IMG/M
3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Host-Associated	Open in IMG/M
3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Host-Associated	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300032897	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental	Open in IMG/M
3300034965	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FWIROz_02660930	2124908006	Soil	SCGGRVMSVIDFFEYLAASDHTVDLAHELADVWVARQMFDVYQPAA
C688J18823_102544932	3300001686	Soil	MSVIDFFEYLAAHRQTCELAHELADIWTEHELAKLYESAA*
Ga0055470_102049892	3300003992	Natural And Restored Wetlands	MNVIDFLEYLASSANTFDLAHDLADVWAAHQIADVYEPAA*
Ga0062593_1030117262	3300004114	Soil	GGRVMSVIDFFEYLAASDYTVDLAHELADVWVANQLGGVYRQPAA*
Ga0063455_1003221492	3300004153	Soil	MSVIDFFEYLAAHRQTCELAHELADVWTEHELAKLYESAA*
Ga0062595_1007558762	3300004479	Soil	MSVIDFFEYLEAHRQTSALARELADIWTDREVRARYEPAA*
Ga0062595_1013860322	3300004479	Soil	MSVIDFFDYLAVHDQTAELAHQLADAWAEHALADVYEPAA*
Ga0066683_106387722	3300005172	Soil	MSVIDFFEYLAASAHTVDLAHELADVWVARQVVDVCLPAA*
Ga0066671_101332862	3300005184	Soil	MSVIDFFEYLAAHRQTNALAHELAEIWTEHEIARYEPAA*
Ga0066388_1071291991	3300005332	Tropical Forest Soil	MSVLEFFEYLAANEQTEQLAYELADVWVARQLAEFYVPAA*
Ga0070667_1021012292	3300005367	Switchgrass Rhizosphere	MSVIDFFEYLAASDHTVELAHELADVWVARQVSDVYQPAA*
Ga0070709_105015422	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MSVIDFFEYLAAHRQTNALAHELAEIWTEHEIAARYEPAA*
Ga0070713_1002221413	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MSVIDFFEYLATNDDTVELAHQLADVWVARQIADVYQPAA*
Ga0070713_1003411902	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MNVLEFFEYLAANEQTEHLAHELADVWVSRQLAEFVTAA*
Ga0066682_109609641	3300005450	Soil	MSVIDFFEYLAASDHTVDLAHELADVWVAHQMVDVYQPAA*
Ga0066687_106577661	3300005454	Soil	MSVIDFFEYLAASDHTVDLAHELADVWVARQMFDVYRPAA*
Ga0070663_1009936772	3300005455	Corn Rhizosphere	MSVIDFFEYLATSEDTSDLAHELADVWVAHQITDSYEPAA*
Ga0066700_104212242	3300005559	Soil	MSVIDFFEYLAASDHTVDLAHELADVWVARQMFDVYQPAA*
Ga0066670_102068231	3300005560	Soil	MSVIDFFEYLAASAHTVDLAHDLADVWVARQVVAVCQPAA*
Ga0068855_1016065472	3300005563	Corn Rhizosphere	MSVIDFFEYLAAHDQTVELAHELADVWVSHQIADVYEPAA*
Ga0066903_1012927283	3300005764	Tropical Forest Soil	MTVLDFFEYLAAHEQTEDLAYELADVWVTRQLTEIFAPAA*
Ga0066903_1041115211	3300005764	Tropical Forest Soil	MSVIDFFEYLANYDQTNQLAHELADAWTEHELSARYEPAA*
Ga0066903_1071271332	3300005764	Tropical Forest Soil	MNVLDFFEYLAAHEQTEQLAYELADVWVVRQLADVILPAA*
Ga0074470_114139901	3300005836	Sediment (Intertidal)	MSVIDFFEYLAANDDTAELAHELADVWVARQLSDVWLP
Ga0066789_103097972	3300005994	Soil	MSVIDFFEYLVASEQTVDLAHDLADVWVARQVVDVFEPAA*
Ga0075024_1000047685	3300006047	Watersheds	MNVIDFFEYLASSEATVELAHELADVWVDRQLSDVYLPAA*
Ga0075024_1002107372	3300006047	Watersheds	MSVIDFFEYLATSDDTAELAHELADVWVAHQIVDVYEPAA*
Ga0075026_1006883842	3300006057	Watersheds	MSVIDFFEYLAANDATVGLAHELADLWESRQVVDVYRPAA*
Ga0075017_1000239384	3300006059	Watersheds	MSVIDFFEYLASSEATVELAHELADVWVDRQLSDVYLPAA*
Ga0066659_111430352	3300006797	Soil	MSVIDFFEYLAASAHTIDLAHELADVWVARQVVDVCLPAA*
Ga0066710_1015218952	3300009012	Grasslands Soil	MSVIDFFEYLAASAHTVDLAHELADVWVARQVVDVCQPAA
Ga0099827_107706002	3300009090	Vadose Zone Soil	MSVIDFFEYLAASAHTVDLAHELADVWVARQVVDMCQPAA*
Ga0099827_117746272	3300009090	Vadose Zone Soil	DFFEYLAASDHTVDLAHELADVWVAHQMVDIYRPAA*
Ga0105245_109191142	3300009098	Miscanthus Rhizosphere	MSVIDFFEYLAASDHTVDLAHELADVWVANQLGGVYRQPAA*
Ga0134126_114812492	3300010396	Terrestrial Soil	MSVIDFFEYLASSDDTVELAHDLADVWVARQVADLFEPAA*
Ga0134122_116551652	3300010400	Terrestrial Soil	MSVIDFFEYLAASDHTVELAHELADVWVARQMFDVYQPAA*
Ga0126358_11738511	3300010856	Boreal Forest Soil	PVLMAGTHSGGGRVMSVIDFFEYLAAHDQSVELAHELADVWVARQLSDVFEPAA*
Ga0126354_10499031	3300010857	Boreal Forest Soil	MSVMDFFEYLASSEETNELAYELADVWVAHVIVDSYEPAA*
Ga0126345_12131022	3300010858	Boreal Forest Soil	RGMSVIDFFEYLVASEQTVDLAHDLADLWVARQLVDVFEPAA*
Ga0126349_10090491	3300010861	Boreal Forest Soil	QGNVHPNDFRRRRVMSVIDFFEYLATGEDTTELAHELADVWVAHQIVDSYVPAA*
Ga0126349_11365632	3300010861	Boreal Forest Soil	CGGRVMSVIDFFEYLASSAHTADLAHELADVWVAHQIADVYEPAA*
Ga0126349_11367491	3300010861	Boreal Forest Soil	MSVIDFFEYLATSEDTTDLAQQLADVWVAHQIVDSYEPAA*
Ga0126348_10474831	3300010862	Boreal Forest Soil	IGQFCGGRVMSVIDFFEYLASSAHTADLAHELADVWVAHQIADVYEPAA*
Ga0126348_12327242	3300010862	Boreal Forest Soil	GQSCGGRVMSVIDFFEYLAASAQTVDLAHDLADVWVARQVVEMCQPAA*
Ga0126346_13233413	3300010865	Boreal Forest Soil	ETPHTGGGRVMSVIDFFEYLAESNATTELAHELADVWVARQLADVHQPAA*
Ga0126350_118973061	3300010880	Boreal Forest Soil	NDFRRRRVMSVIDFFEYLATGEDTTDLAYELADVWVAHQIVDSYDPAA*
Ga0150983_164520422	3300011120	Forest Soil	MNVIDFFEYLATHEQTVELAHELADVWVAHQIADVYEPAA*
Ga0150985_1025520381	3300012212	Avena Fatua Rhizosphere	VIDFFEYLAAHNETTELAYDLADVWTAHQLDERYEPAA*
Ga0150985_1102479172	3300012212	Avena Fatua Rhizosphere	MAGTHIGGGRVMSVIDFFEYLAVHDQTVELAHELADVWVARQLDDVFQPAA*
Ga0150985_1153629862	3300012212	Avena Fatua Rhizosphere	MSVIDFFEYLASSEQTAELAHELADVWVTRQLTDVYWPAA*
Ga0150985_1191691741	3300012212	Avena Fatua Rhizosphere	RQWEGPAMSVIDFFEYLASSEQTAELAHELADVWVTRQLTDVYWPAA*
Ga0150985_1204532252	3300012212	Avena Fatua Rhizosphere	MSVIDFFEYLAAHDQTSELAHDLADAWAEQQVAEHHEAA*
Ga0150984_1099580801	3300012469	Avena Fatua Rhizosphere	IGGGRVMSVIDFFEYLADHDQTVELAHELADVWVARQLDDVFQPAA*
Ga0150984_1115986702	3300012469	Avena Fatua Rhizosphere	MSVIDFFEYLASSEQTAELAHELADVWVTRQLSDVYWPAA*
Ga0150984_1233617302	3300012469	Avena Fatua Rhizosphere	MSVIDFFEYLAAHDQTSELAHDLADAWAEHQVAEHHEAA*
Ga0137398_110552662	3300012683	Vadose Zone Soil	MSVIDFFEYLAAHDQTVELAHELADTWVSRKIADVFRPAA*
Ga0137416_120749492	3300012927	Vadose Zone Soil	MSVIDFFEYLAASAHTVDLAHELADVWVARQIVDVCQPAA*
Ga0153915_103649522	3300012931	Freshwater Wetlands	VSVIDFLEYLAASEQTVDLAHELADVWLARQSGGRFESVA*
Ga0164309_111055772	3300012984	Soil	MSVIDCFEYLATGEDTNDLAQELADVWVAHQIVDSYDPAA*
Ga0164305_119648942	3300012989	Soil	VERVMSVIDFFEYLEAHRQTSALARELADIWTDREVRARYEPAA*
Ga0120158_101233703	3300013772	Permafrost	MSVIDFFEYLATSAHTVDLAHELADVWVARQVVDVYEPAA*
Ga0075355_10053133	3300014322	Natural And Restored Wetlands	MSVIDFFEYLATSDATVDLAHELADLWESRQVVDVYRPAA*
Ga0157379_119421872	3300014968	Switchgrass Rhizosphere	MSVIDFFEYLASSEATTELAHELADAWVNRQLSDVYLPAA*
Ga0167648_10064442	3300015171	Glacier Forefield Soil	MSVIDFFEYLAASDDTVELAHELADVWVARQVVDVYAPAA*
Ga0167638_11073511	3300015197	Glacier Forefield Soil	RRGMSVIDFFEYLVASEQTVDLAHDLADVWVARQVVDVFEPAA*
Ga0182033_104754803	3300016319	Soil	MSVIDFFEYLAAHEQTTELAYELADVWAAHQVEAYDPA
Ga0182034_108292562	3300016371	Soil	MSVIDFFEYLAAHDQTEQLAYELADVWVVRQLADVILPAA
Ga0187786_101045042	3300017944	Tropical Peatland	MSVLEFFEYLAANRQTEELAYELADVWVARQLSEIFVSAA
Ga0187779_101622572	3300017959	Tropical Peatland	MSVIDFFEYLATHDTTAELAHDLADVWAAQQLADTFEPAA
Ga0187779_102118482	3300017959	Tropical Peatland	MSVIDFFEYLARSEATADLAFDLADVWAAQQLADAFDPAA
Ga0187779_102949062	3300017959	Tropical Peatland	MSVIDFFEYLADHDQTAHLAHELADVWAARELVDQYEPAA
Ga0187777_101833992	3300017974	Tropical Peatland	MSVIDFFEYLADHDQTAHLAHELADVWAARELADRYEPAA
Ga0187765_109076592	3300018060	Tropical Peatland	MSVIDFFEYLATHDTTAELAHDLADVWAAQQLADSFEPAA
Ga0066669_107202912	3300018482	Grasslands Soil	MSVIDFFEYLAASAHTVDLAHDLADVWVARQVVAVCQPAA
Ga0197907_114998391	3300020069	Corn, Switchgrass And Miscanthus Rhizosphere	MSVIDFFEYLASSNATSELAHQLADVWVARQIADVHQPAA
Ga0206355_13459191	3300020076	Corn, Switchgrass And Miscanthus Rhizosphere	DETPTPGGGRVMSVIDFFEYLASSNATSELAHQLADVWVARQIADVHQPAA
Ga0213852_14265832	3300021858	Watersheds	DFFEYLAAGDDTAELANDLADIWVAHQIADVYEPAA
Ga0224712_102608422	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	MSVIDFFEYLASNDDTVELAHELADVWVSHQIADVYEPAA
Ga0207663_101874852	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MSVIDFFEYLAKHRQTNALAHELAEIWTEHEIAARYEPAA
Ga0207687_108236152	3300025927	Miscanthus Rhizosphere	MSVIDFFEYLAASDHTVDLAHELADVWVANQLGGVYRQPAA
Ga0207700_112096212	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MSVIDFFEYLATNDDTVELAHQLADVWVARQIADVYQPAA
Ga0207700_112670142	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MSVIDFFEYLATSEATAELAYELADVWVDRQLSDVYLPAA
Ga0209027_11575352	3300026300	Grasslands Soil	MSVIDFFEYLAAQPETSELAHELADIWTEHEVAALYEPAA
Ga0209153_12631282	3300026312	Soil	VMSVIDFFEYLAAHRQTNALAHELAEIWTEHEIARYEPAA
Ga0207855_10036462	3300027039	Tropical Forest Soil	MNVIDFFDYLAAHGQTAQLAGDLFDVWAAHQLADAYDPAA
Ga0209069_100033445	3300027915	Watersheds	MNVIDFFEYLASSEATVELAHELADVWVDRQLSDVYLPAA
Ga0209069_100819173	3300027915	Watersheds	MSVIDFFEYLATGDDTAELAHELADVWVAHQIVDVYEPAA
Ga0268266_112751292	3300028379	Switchgrass Rhizosphere	MSVIDFFEYLAASDHTVELAHELADVWVARQVSDVYQPAA
Ga0265338_104419333	3300028800	Rhizosphere	MSVIDFFEYLASSDETNELAQELADVWVAHQIVDVYEPAA
Ga0265338_111002872	3300028800	Rhizosphere	EMSVIDFFEYLASSDETNELAQELADVWVAHQIVDVYEPAA
Ga0311334_112987842	3300029987	Fen	QIYCRGGRAMSVIDFFEYLVSSEATEELAHELADVWVDRQLSDVYLPAA
Ga0311334_116275652	3300029987	Fen	MSVIDFFEYLAANDATVGLAHELADLWESRQVVDVYRPAA
Ga0311336_109614542	3300029990	Fen	MSVIDFFEYLVSSEATEELAHELADVWVDRQLSDVYLPAA
Ga0073997_120462331	3300030997	Soil	PRQAASQVERVMSVIDFFEYLAAHRQTSALAHELADIWTDHEVGARYEPAA
Ga0265332_102192702	3300031238	Rhizosphere	MSVIDFFEYLASADQTNELAHELADVWVAHQIADVYQPAA
Ga0265327_100258463	3300031251	Rhizosphere	MSVIDFFEYLASSNATNELAHDLADAWVARQVADVHQPAA
Ga0265327_101607812	3300031251	Rhizosphere	MSVIDFFEYLAGSAATVELAHELADLWVARQVVDVYAPAA
Ga0265314_106932931	3300031711	Rhizosphere	MSVIDFFEYLASSEATTELAHELADVWVNRQLSDVYMPAA
Ga0306920_1024015882	3300032261	Soil	MSVIDFFEYLAAHEQTTELAYELADVWAAHQVEAYDPAA
Ga0335085_1000228840	3300032770	Soil	MSVLEFFEYLAASKQTEQLAHELADVWVARQLSEIFVPAA
Ga0335085_100024655	3300032770	Soil	MSVIDFFEYLAASEQTAELAHELADVWVARQLADLYHPAA
Ga0335082_100354096	3300032782	Soil	MSVIDFFEYLATHDTTAELAHDLADAWAAQQVAETFEPAA
Ga0335069_104693563	3300032893	Soil	MSVIDFFEYLAAHDTTAELAHDLADVWAAQQLADAYDPAA
Ga0335069_107968343	3300032893	Soil	MSVIEFFEYLAASEHTAELAIDLADVWVAHEIADAFAA
Ga0335071_114645922	3300032897	Soil	MSVMEFFEYLAASEQTAELAHALADVWAAHEVFDAYAA
Ga0310810_105441492	3300033412	Soil	MSVIDFFDYLAVHDQTAELAHQLADAWAEHALADVYEPAA
Ga0372943_0184672_760_882	3300034268	Soil	MSDIDYFEYLAAHNQTVELAHELADVWVSHQVADVYEPAA
Ga0370497_0042997_841_963	3300034965	Untreated Peat Soil	MSVIDFFEYLASSAATVGLAHEIADLWESRQVVAVYRPAA

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.57
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.57
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F090123

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign