Basic Information | |
---|---|
Family ID | F090064 |
Family Type | Metagenome |
Number of Sequences | 108 |
Average Sequence Length | 45 residues |
Representative Sequence | MKVYWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGQQ |
Number of Associated Samples | 73 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 81.48 % |
% of genes near scaffold ends (potentially truncated) | 26.85 % |
% of genes from short scaffolds (< 2000 bps) | 69.44 % |
Associated GOLD sequencing projects | 71 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (81.481 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (25.926 % of family members) |
Environment Ontology (ENVO) | Unclassified (60.185 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (48.148 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.26% β-sheet: 23.91% Coil/Unstructured: 47.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF01464 | SLT | 37.04 |
PF00149 | Metallophos | 1.85 |
PF12728 | HTH_17 | 1.85 |
PF00145 | DNA_methylase | 0.93 |
PF12684 | DUF3799 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 81.48 % |
All Organisms | root | All Organisms | 18.52 % |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 25.93% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 15.74% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.04% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.26% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.48% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.48% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.63% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.70% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.85% |
Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 1.85% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.85% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.93% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.93% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.93% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.93% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.93% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020510 | Freshwater microbial communities from Lake Mendota, WI - 06JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020516 | Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
FwDRAFT_100045474 | 3300000882 | Freshwater And Marine | VKVYWTAFYGRSEYTFQGRNAKRDALRLAKRFGGRVAREKGKL* |
B570J29032_1098811026 | 3300002408 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVREKGQP* |
B570J40625_1000419143 | 3300002835 | Freshwater | MSMKTYWTVYFGKFRRSEYTFQGTNAKRDAQRLAKRLGGRVVREKGQQ* |
B570J40625_1001092258 | 3300002835 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAYRLVKRFGGRVVREIIKSHE* |
B570J40625_1014718362 | 3300002835 | Freshwater | MKVFWTVYFGKFRRSEYTLQGPNGKRDAQRLAKRLGGRVVREKGQQ* |
Ga0068876_104151284 | 3300005527 | Freshwater Lake | MSMKIYWTVYFGKFRRSEYTFQGENAKRDAQRLAKRL |
Ga0068876_106809213 | 3300005527 | Freshwater Lake | MKIYWTVYFGKFRRSEYTFQGPNAKRDAQRLAKRLSGRLVREVIQ* |
Ga0068872_105148343 | 3300005528 | Freshwater Lake | MSMKIYWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGQQ* |
Ga0049081_100186094 | 3300005581 | Freshwater Lentic | MSMKVFWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGQQ* |
Ga0049081_100287576 | 3300005581 | Freshwater Lentic | VKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVRTVMRDNPQSNG* |
Ga0075464_102449992 | 3300006805 | Aqueous | VKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVREKGNQ* |
Ga0108970_1002400918 | 3300008055 | Estuary | MKVYWTVYFGKFRRSEYTFQGPNAKRDAQRLAKRLGGRVVREKGQQ* |
Ga0108970_110399811 | 3300008055 | Estuary | VKVYWTAFYGRSEYTFQGRNAKRDALRLAKRFGGRVAREKGKLK* |
Ga0114350_10275025 | 3300008116 | Freshwater, Plankton | MKVYWKAFYGRSEYTFQGRNAKRDAYRLAKRFGGRVVREKGKL* |
Ga0114351_11888358 | 3300008117 | Freshwater, Plankton | MSMKIYWTVYFGKFRRSEYTFQGTNAKRDAQRLAKRLGGRVVREKGQQ* |
Ga0114841_10113647 | 3300008259 | Freshwater, Plankton | MSMKTYWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGQQ* |
Ga0114363_10339495 | 3300008266 | Freshwater, Plankton | MKVFWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGRQ* |
Ga0114363_11584112 | 3300008266 | Freshwater, Plankton | MKIYWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGQQ* |
Ga0114364_10079274 | 3300008267 | Freshwater, Plankton | MSMKIYWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGKQ* |
Ga0114364_10126075 | 3300008267 | Freshwater, Plankton | MKVYWTAYYGKFRKSEYTFQGRNAKRDAHRLVKRFGGRVVREIIKSHE* |
Ga0114364_10255604 | 3300008267 | Freshwater, Plankton | MKVFWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGQQ* |
Ga0114364_10813174 | 3300008267 | Freshwater, Plankton | RLYRQRERKMSMKIYWTVYFGKFRRSEYTFQGPNAKRDAQRLAKRLGGRVVREKGQQ* |
Ga0114364_10974682 | 3300008267 | Freshwater, Plankton | MSMKIYWTVYYGKFRRSEYTFQGENAKRNAQRLAKRLGGRVVREKGQQ* |
Ga0114878_10897165 | 3300008339 | Freshwater Lake | EMSMKTYWTVYFGKFRRSEYTFQGTNAKRDAQRLAKRLGGRVVREKGQQ* |
Ga0114876_11273013 | 3300008448 | Freshwater Lake | MSMKIYWTVYFGKFRRSEYTFQGENAKRNAQRLAKRLGGRVVREKGQQ* |
Ga0114876_11327151 | 3300008448 | Freshwater Lake | MKVFWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVRE |
Ga0114876_11364051 | 3300008448 | Freshwater Lake | YFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGRQ* |
Ga0114876_11569344 | 3300008448 | Freshwater Lake | MSMKIYWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVRE |
Ga0114876_11951943 | 3300008448 | Freshwater Lake | YFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGQQ* |
Ga0114880_11994613 | 3300008450 | Freshwater Lake | MKIYWTVYFGKFRRSEYTFQGENAKRNAQRLAKRLGGRVVREKGQQ* |
Ga0105152_102243282 | 3300009039 | Lake Sediment | MKVFWTVYYGKFRKSEYTFQGPNAKRDAQRLAKRFGGRAVCEKG* |
Ga0105102_102740002 | 3300009165 | Freshwater Sediment | MKVYWIAYYGRSEYTFQGRNAKRDAYRLVKRFGGRVVREKGQP* |
Ga0177922_107149873 | 3300013372 | Freshwater | MSMKIFWTVYFGKFRRSEYTFQGTNAKRDAQRLAKRLGGRVVREKGQQ* |
Ga0181338_10249883 | 3300015050 | Freshwater Lake | VKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVRKKGQQ* |
Ga0181350_10610942 | 3300017716 | Freshwater Lake | YWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVREKGNQ |
Ga0181365_10604151 | 3300017736 | Freshwater Lake | VKVYWTAFYGRSEYTFQGRNAKRDALRLAKRFGGRVARVKGNQ |
Ga0181357_10971822 | 3300017777 | Freshwater Lake | MNLKVYWTAFYGRSEYTFQGRNAKRDALRLAKRFGGRVAREKGKL |
Ga0181357_11121841 | 3300017777 | Freshwater Lake | MKVYWTAFYGRSEYTFQGRNAKRDALRLAKRFGGRVAREKGKL |
Ga0181346_11321134 | 3300017780 | Freshwater Lake | MNLKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVRTVMR |
Ga0181355_10899721 | 3300017785 | Freshwater Lake | MNLKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVA |
Ga0211735_103272822 | 3300020162 | Freshwater | MKVCWTVYYGKFRKSEYTFQGPNGKRDAQRLAKRLGGRVVRDKVN |
Ga0211729_108259052 | 3300020172 | Freshwater | MKVCWTVYYGKFRKSEYTFQGSNGKRDAQRLAKRLGGRVVRDKVN |
Ga0211729_110373038 | 3300020172 | Freshwater | MKVFWTVYFGKFRRSEYTFQGPNGKRDAQRLAKRLGGRVVREKGQQ |
Ga0211729_114236401 | 3300020172 | Freshwater | MKVYWTVYYGKFRKSEYTFQGSNGKRDAQRLAKRLGGRAVCEKGQQ |
Ga0208050_10083802 | 3300020498 | Freshwater | MKVYCWTAFYGKFRKSEYTFQGRNAKRDAHRLVKRFGGRVVREIIKSHE |
Ga0208086_10208573 | 3300020510 | Freshwater | MKVYCWTAFYGKFRKSEYTFQGRNAKRDAYRLVKRFGGRVVREIIKSNE |
Ga0207935_10047046 | 3300020516 | Freshwater | MSMKTYWTVYFGKFRRSEYTFQGTNAKRDAQRLAKRLGGRVVREKGQQ |
Ga0208359_10600872 | 3300020541 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAHRLAKRFGGRVVREIIKSNE |
Ga0208222_100140111 | 3300020566 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVREIIKSHE |
Ga0222713_106931851 | 3300021962 | Estuarine Water | WTAFYGRSEYTFQGRNAKRDALRLAKRFGGRVAREKGKL |
Ga0181353_10142136 | 3300022179 | Freshwater Lake | MKVYWTVIYGKGRGSFYTFQGPNAKRDAQRLAKRLNGKVVCDKGNP |
Ga0209182_102365762 | 3300025843 | Lake Sediment | MKVFWTVYYGKFRKSEYTFQGPNAKRDAQRLAKRFGGRAVCEKG |
Ga0255090_10152315 | 3300027123 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVREKGQP |
Ga0208975_10535345 | 3300027659 | Freshwater Lentic | MSMKVFWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGQQ |
Ga0209297_10222176 | 3300027733 | Freshwater Lake | VKVYWTAFYGRSEYTFQGRNAKRDALRLAKRFGGRVAREKGKL |
Ga0209246_101250162 | 3300027785 | Freshwater Lake | VKVYWTAFYGRSEYTFHGRNAKRDALRLAKRFGGRVAREKGKL |
Ga0209246_102224413 | 3300027785 | Freshwater Lake | VKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVRKKGQQ |
Ga0209536_10005829812 | 3300027917 | Marine Sediment | MKVYWTAYYGKFRRSEYTFQGRNAKRDAHRLVKRFGGRVVREIISKAKGEL |
Ga0209820_11950613 | 3300027956 | Freshwater Sediment | MKVYWIAYYGRSEYTFQGRNAKRDAHRLVKRFGGRVVREKGQP |
(restricted) Ga0247843_12327152 | 3300028569 | Freshwater | MKVYWTVYYGKFRRSEYTFQGPNGKRDAQRLAKRLGGRVVRDKVN |
Ga0315291_116184021 | 3300031707 | Sediment | VKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVRTVMRDNP |
Ga0315907_100235075 | 3300031758 | Freshwater | MKVYWKAFYGRSEYTFQGRNAKRDAYRLAKRFGGRVVREKGKL |
Ga0315907_100680946 | 3300031758 | Freshwater | MSMKIYWTVYFGKFRRSEYTFQGTNAKRDAQRLAKRLGGRVVREKGQQ |
Ga0315907_102741144 | 3300031758 | Freshwater | MKVFWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGQQ |
Ga0315907_111369832 | 3300031758 | Freshwater | MSMKTYWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGQQ |
Ga0315899_111245623 | 3300031784 | Freshwater | MSMKIYWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGKQ |
Ga0315900_102279152 | 3300031787 | Freshwater | MKIYWTVYFGKFRRSEYTFQGPNAKRDAQRLAKRLSGRLVREVIQ |
Ga0315909_101300087 | 3300031857 | Freshwater | GRRRGSKFRARLHCKRERKMSMKIYWTVYFGKFRRSEYTFQGTNAKRDAQRLAKRLGGRVVREKGQQ |
Ga0315909_101865124 | 3300031857 | Freshwater | MKVYWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGQQ |
Ga0315909_102966924 | 3300031857 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVREIVKSHE |
Ga0315909_107587362 | 3300031857 | Freshwater | MKVYWTAYYGKFRTSLYAFQGRNAKRDAHRLVKRFGGRVVREKGQL |
Ga0315285_109117902 | 3300031885 | Sediment | YWTAFYGRSEYTYQGRNAKRDAHRLVKRFGGRVVRTVMRDNPQSNR |
Ga0315904_102708064 | 3300031951 | Freshwater | MSMKIYWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGRQ |
Ga0315904_108000141 | 3300031951 | Freshwater | EMSMKTYWTVYFGKFRRSEYTFQGTNAKRDAQRLAKRLGGRVVREKGQQ |
Ga0315901_101684296 | 3300031963 | Freshwater | MSMKTYWTVYFGKFRRSEYTFQGTNAKRDAQRLAKRLGGRVVREK |
Ga0315901_110828763 | 3300031963 | Freshwater | FGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGRQ |
Ga0315906_108048043 | 3300032050 | Freshwater | MSMKVFWTVYFGKFRRSEYTFQGENAKRDAQRLGGRVVREKGQQ |
Ga0315903_106740854 | 3300032116 | Freshwater | VYFGKFRRSEYTFQGTNAKRDAQRLAKRLGGRVVREKGQQ |
Ga0315903_108976243 | 3300032116 | Freshwater | EREMSMKTYWTVYFGKFRRSEYTFQGENAKRDAQRLAKRLGGRVVREKGQQ |
Ga0315277_117977332 | 3300032118 | Sediment | VKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVRTVMRDN |
Ga0315271_117298821 | 3300032256 | Sediment | VKVYWTVYYGKFRKSEYTFQGPNGKRDAHRLVKRFGGRVVRTVMRDNPQSNR |
Ga0334980_0032186_117_254 | 3300033816 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAYRLVKRFGGRVVREIIKSNE |
Ga0334980_0035513_921_1052 | 3300033816 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAYRLVKRFGGRVVREKGQP |
Ga0334980_0128642_652_798 | 3300033816 | Freshwater | MKVYWTACYGKFRKSEYTFQGRNAKRDAHRLAKRFGGRVVREIIKSNE |
Ga0334980_0203071_501_641 | 3300033816 | Freshwater | MKVYWTAFYGKFRKSEYTFQGRNAKRDAHRLVKRFGGRVVREKGQQ |
Ga0334978_0045168_437_577 | 3300033979 | Freshwater | MKVFWTVYFGKFRRSEYTLQGPNGKRDAQRLAKRLGGRVVREKGQQ |
Ga0334994_0115516_1277_1408 | 3300033993 | Freshwater | MKVYWTAFYGQSEYTFQGRNAKRDAHRLVKRFGGRVVREKGQP |
Ga0334994_0130224_997_1128 | 3300033993 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVRKKGQL |
Ga0334998_0008145_3551_3700 | 3300034019 | Freshwater | MKVYYWTAFYGKFRKSEYTFQGRNAKRDAYRLVKRFGGRVVREIIKSHE |
Ga0334998_0205611_304_444 | 3300034019 | Freshwater | MKVYWTVIYGKGRGSFYTFQGPNAKRDAKRLAKRLNGKVVCDKGNP |
Ga0335004_0266988_901_1029 | 3300034021 | Freshwater | MSMKTFWTVYFVKFRRSEYTFQGSNAKRDAQRLAKRLGGRVVR |
Ga0334995_0043726_115_255 | 3300034062 | Freshwater | MKVYWTAFYGKFRKSEYTFQGRNAKRDAHRLVKRFGGRVVREKGQP |
Ga0335020_0529152_1_135 | 3300034082 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVRTVMRDNP |
Ga0335010_0630417_3_125 | 3300034092 | Freshwater | YGKFRKSEYTFQGRNAKRDAYRLVKRFGGRVVREIIKSHE |
Ga0335022_0291183_2_133 | 3300034095 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVREGPAIK |
Ga0335027_0142370_1541_1684 | 3300034101 | Freshwater | MKVYCWTAFYGKFRKSEYTFQGRNAKRDAYRLVKRFGGRVVREKGQP |
Ga0335029_0623425_438_578 | 3300034102 | Freshwater | MKVYWTVYFGKFRRSEYTFQGENAKRDAQRLAKRFGGRAVCEKGQQ |
Ga0335030_0193334_165_305 | 3300034103 | Freshwater | MKVYWTAYYGKFRKSEYTFQGRNAKRDAHRLVKRFGGRVVREKGQL |
Ga0335031_0014162_191_322 | 3300034104 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVREKCQP |
Ga0335031_0423359_711_830 | 3300034104 | Freshwater | MKVYWTAFYGKFRKSEYTFQGRNAKRDAYRLVKRFGGRVV |
Ga0335036_0055282_1428_1565 | 3300034106 | Freshwater | VKVYWTAFYGRSEYTFQGRNAKRDAHRLVKRFGGRVVREIIKSNE |
Ga0335051_0044352_2274_2387 | 3300034109 | Freshwater | MKVYWTAFYGKFRKSEYTFQGRNAKRDAYRLVKRFGGR |
Ga0335054_0403278_660_779 | 3300034119 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAYRLVKRFGGRVVREI |
Ga0335056_0167733_3_107 | 3300034120 | Freshwater | MKVYWTAFYGRSEYTFQGRNAKRDAHRLAKRFGGR |
Ga0334997_0059694_1073_1219 | 3300034280 | Freshwater | MKVYWTAFYGKFRKSEYTFQGRNAKRDAHRLAKRFGGRVVREIIKSHE |
Ga0334997_0114228_1690_1809 | 3300034280 | Freshwater | MKVYWTACYGKFRKSEYTFQGRNAKRDAHRLAKRFGGRVV |
Ga0335007_0089347_1709_1855 | 3300034283 | Freshwater | MKVYWTAYYGKFRKSEYTFQGRNAKRDAYRLVKRFGGRVVREIIKSHE |
Ga0335007_0124432_1436_1582 | 3300034283 | Freshwater | MKVYWIAYYGKFRKSEYTFQGRNAKRDAYRLVKRFGGRVVREIIKSHE |
⦗Top⦘ |