| Basic Information | |
|---|---|
| Family ID | F089992 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LTNADQTVVYFLMVHCTNSCYSQNQNNINTVMSSFTVGSPT |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.07 % |
| % of genes from short scaffolds (< 2000 bps) | 99.07 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.481 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (37.037 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.630 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.111 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF00004 | AAA | 25.00 |
| PF07690 | MFS_1 | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.48 % |
| All Organisms | root | All Organisms | 43.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10357194 | Not Available | 894 | Open in IMG/M |
| 3300001867|JGI12627J18819_10189021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 833 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10115590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium → Cryptosporangium arvum | 1074 | Open in IMG/M |
| 3300005542|Ga0070732_10395330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 833 | Open in IMG/M |
| 3300005610|Ga0070763_10348498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 824 | Open in IMG/M |
| 3300005618|Ga0068864_102414344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300005921|Ga0070766_11224080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300005921|Ga0070766_11229371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300005950|Ga0066787_10080153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
| 3300006028|Ga0070717_11436109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 626 | Open in IMG/M |
| 3300006871|Ga0075434_100768698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 980 | Open in IMG/M |
| 3300006954|Ga0079219_10357079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 942 | Open in IMG/M |
| 3300007788|Ga0099795_10211923 | Not Available | 821 | Open in IMG/M |
| 3300009545|Ga0105237_11167974 | Not Available | 776 | Open in IMG/M |
| 3300010359|Ga0126376_10561224 | Not Available | 1071 | Open in IMG/M |
| 3300010361|Ga0126378_11157879 | Not Available | 872 | Open in IMG/M |
| 3300010371|Ga0134125_10389481 | Not Available | 1546 | Open in IMG/M |
| 3300010371|Ga0134125_10738552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1084 | Open in IMG/M |
| 3300010376|Ga0126381_102873504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 686 | Open in IMG/M |
| 3300010379|Ga0136449_104098556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300010398|Ga0126383_13600411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 506 | Open in IMG/M |
| 3300010937|Ga0137776_1473420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300010937|Ga0137776_1695390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 548 | Open in IMG/M |
| 3300011120|Ga0150983_10394402 | Not Available | 765 | Open in IMG/M |
| 3300012209|Ga0137379_10580785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1028 | Open in IMG/M |
| 3300012351|Ga0137386_11263963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 513 | Open in IMG/M |
| 3300012357|Ga0137384_11328945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300012683|Ga0137398_10223654 | Not Available | 1247 | Open in IMG/M |
| 3300012948|Ga0126375_10924038 | Not Available | 703 | Open in IMG/M |
| 3300012971|Ga0126369_12666253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
| 3300012971|Ga0126369_13224512 | Not Available | 534 | Open in IMG/M |
| 3300013105|Ga0157369_10796660 | Not Available | 971 | Open in IMG/M |
| 3300014169|Ga0181531_10159362 | Not Available | 1366 | Open in IMG/M |
| 3300014658|Ga0181519_10277618 | Not Available | 1043 | Open in IMG/M |
| 3300016270|Ga0182036_11170207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300017970|Ga0187783_10703729 | Not Available | 729 | Open in IMG/M |
| 3300020076|Ga0206355_1007952 | Not Available | 728 | Open in IMG/M |
| 3300020078|Ga0206352_10345752 | Not Available | 1012 | Open in IMG/M |
| 3300020581|Ga0210399_11416719 | Not Available | 542 | Open in IMG/M |
| 3300021388|Ga0213875_10200383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 939 | Open in IMG/M |
| 3300021401|Ga0210393_10947423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 698 | Open in IMG/M |
| 3300021404|Ga0210389_10517494 | Not Available | 938 | Open in IMG/M |
| 3300021406|Ga0210386_11787383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300021407|Ga0210383_10463331 | Not Available | 1094 | Open in IMG/M |
| 3300021478|Ga0210402_11821436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300021559|Ga0210409_11354673 | Not Available | 587 | Open in IMG/M |
| 3300022501|Ga0242645_1010179 | Not Available | 737 | Open in IMG/M |
| 3300022502|Ga0242646_1008142 | Not Available | 831 | Open in IMG/M |
| 3300022506|Ga0242648_1062434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300022508|Ga0222728_1112938 | Not Available | 526 | Open in IMG/M |
| 3300022513|Ga0242667_1018855 | Not Available | 708 | Open in IMG/M |
| 3300022523|Ga0242663_1010250 | Not Available | 1246 | Open in IMG/M |
| 3300022523|Ga0242663_1138077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 515 | Open in IMG/M |
| 3300022527|Ga0242664_1056558 | Not Available | 729 | Open in IMG/M |
| 3300022528|Ga0242669_1041869 | Not Available | 757 | Open in IMG/M |
| 3300022528|Ga0242669_1067499 | Not Available | 642 | Open in IMG/M |
| 3300022529|Ga0242668_1144388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300022530|Ga0242658_1247710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300022531|Ga0242660_1186532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
| 3300022532|Ga0242655_10253288 | Not Available | 558 | Open in IMG/M |
| 3300022708|Ga0242670_1018302 | Not Available | 815 | Open in IMG/M |
| 3300022713|Ga0242677_1006260 | Not Available | 1179 | Open in IMG/M |
| 3300022714|Ga0242671_1016696 | Not Available | 976 | Open in IMG/M |
| 3300022716|Ga0242673_1071794 | Not Available | 623 | Open in IMG/M |
| 3300022717|Ga0242661_1025772 | Not Available | 982 | Open in IMG/M |
| 3300022720|Ga0242672_1040003 | Not Available | 751 | Open in IMG/M |
| 3300022720|Ga0242672_1101738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 564 | Open in IMG/M |
| 3300022724|Ga0242665_10123493 | Not Available | 793 | Open in IMG/M |
| 3300025909|Ga0207705_10530870 | Not Available | 915 | Open in IMG/M |
| 3300025915|Ga0207693_10219558 | Not Available | 1493 | Open in IMG/M |
| 3300025917|Ga0207660_10730550 | Not Available | 808 | Open in IMG/M |
| 3300025929|Ga0207664_11980247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300026489|Ga0257160_1095400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300026555|Ga0179593_1208175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2003 | Open in IMG/M |
| 3300027002|Ga0209110_1029762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
| 3300027058|Ga0209111_1024665 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300027505|Ga0209218_1130587 | Not Available | 530 | Open in IMG/M |
| 3300027652|Ga0209007_1017247 | Not Available | 1872 | Open in IMG/M |
| 3300027889|Ga0209380_10493543 | Not Available | 714 | Open in IMG/M |
| 3300027908|Ga0209006_10616663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
| 3300028015|Ga0265353_1005601 | Not Available | 1057 | Open in IMG/M |
| 3300029701|Ga0222748_1091844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 580 | Open in IMG/M |
| 3300029882|Ga0311368_10472258 | Not Available | 908 | Open in IMG/M |
| 3300029943|Ga0311340_11354897 | Not Available | 564 | Open in IMG/M |
| 3300030007|Ga0311338_10355570 | Not Available | 1591 | Open in IMG/M |
| 3300030007|Ga0311338_10947286 | Not Available | 841 | Open in IMG/M |
| 3300030520|Ga0311372_12063161 | Not Available | 664 | Open in IMG/M |
| 3300030524|Ga0311357_11177156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
| 3300030596|Ga0210278_1019512 | Not Available | 1023 | Open in IMG/M |
| 3300030677|Ga0302317_10328420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300030738|Ga0265462_10839241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
| 3300031028|Ga0302180_10430287 | Not Available | 656 | Open in IMG/M |
| 3300031231|Ga0170824_121510685 | Not Available | 921 | Open in IMG/M |
| 3300031543|Ga0318516_10408293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 782 | Open in IMG/M |
| 3300031708|Ga0310686_110007516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 605 | Open in IMG/M |
| 3300031708|Ga0310686_112494790 | Not Available | 632 | Open in IMG/M |
| 3300031770|Ga0318521_10114471 | Not Available | 1500 | Open in IMG/M |
| 3300031782|Ga0318552_10602814 | Not Available | 560 | Open in IMG/M |
| 3300031954|Ga0306926_12551471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 559 | Open in IMG/M |
| 3300032001|Ga0306922_11473092 | Not Available | 682 | Open in IMG/M |
| 3300032025|Ga0318507_10034529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus | 1911 | Open in IMG/M |
| 3300032039|Ga0318559_10205489 | Not Available | 906 | Open in IMG/M |
| 3300032059|Ga0318533_11094801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300032063|Ga0318504_10614909 | Not Available | 522 | Open in IMG/M |
| 3300032756|Ga0315742_11537636 | Not Available | 713 | Open in IMG/M |
| 3300032829|Ga0335070_11439718 | Not Available | 629 | Open in IMG/M |
| 3300032895|Ga0335074_10820663 | Not Available | 863 | Open in IMG/M |
| 3300032895|Ga0335074_11589200 | Not Available | 512 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 37.04% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.33% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.78% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.85% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 1.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027002 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030596 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_103571941 | 3300001593 | Forest Soil | ADQTEVYLLQVHCTAACYTQNQNAINTVMTSFTVGSPT* |
| JGI12627J18819_101890211 | 3300001867 | Forest Soil | FDEVVLTNADQTVLYTLQVHCTDSCYSQNQNNINTVMSSFTVGSPT* |
| JGIcombinedJ51221_101155901 | 3300003505 | Forest Soil | LTNAAGTTIYFLLVHCTTSCYSQAQTAIDAVMSSFTVRSP* |
| Ga0070732_103953301 | 3300005542 | Surface Soil | ALTNADQTEVYLLVIHCTTACYSTDQAEINDVMTSFTIGSP* |
| Ga0070763_103484981 | 3300005610 | Soil | VTDTFDEEVLTNADQTILYSLEVHCTKACYTQNQNSINTVMSSFTVGSPT* |
| Ga0068864_1024143442 | 3300005618 | Switchgrass Rhizosphere | DVLTNANQTVVYFLMVHCTNACYTGNQTNINTVMSSFTVGSPT* |
| Ga0070766_112240801 | 3300005921 | Soil | FDEEVLTNADQTILYTLQVHCSETCYSQNQNNINTVMSSFTVGSPT* |
| Ga0070766_112293711 | 3300005921 | Soil | VLTNADQTVVYFLMVHCTNACYTSNQTNINTVMSSFTVGSPT* |
| Ga0066787_100801531 | 3300005950 | Soil | EDSLTNADQTVVYYLLVHCTNSCYEQNQNAINTVMTSFTIGSPT* |
| Ga0070717_114361091 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FDEAVLTNANQTVVYFLMVHCTNSCYSQNQNKIDTVMSSFTVGSPA* |
| Ga0075434_1007686981 | 3300006871 | Populus Rhizosphere | TNADQTVVYFLMVHCTNSCYSQNQNNINTVMSSFTVGSPT* |
| Ga0079219_103570791 | 3300006954 | Agricultural Soil | EEVLTNADQTELYLLQVHCTQTCYTKYQNNIDTVMSSFTVGSPT* |
| Ga0099795_102119232 | 3300007788 | Vadose Zone Soil | GGVTDTFDEEVLTNADQTILYTVQVHCSETCYSQNQNNINTVMSSFTVGSPT* |
| Ga0105237_111679742 | 3300009545 | Corn Rhizosphere | FDEDVLTNADQTQVYFLMVHCTDSCYSSNQNSIDTVMSSFTVGSPT* |
| Ga0126376_105612242 | 3300010359 | Tropical Forest Soil | LTNAQQTIVFFLMVHCTNSCYSMDQKNIDTVMTSFTVGSPT* |
| Ga0126378_111578792 | 3300010361 | Tropical Forest Soil | QTALYILQVHCTATCYSQNQNDINTVMSSFTVGSPR* |
| Ga0134125_103894811 | 3300010371 | Terrestrial Soil | NADQTVVYFLMVHCTNSCYSQNQNNINTVMSSFTVGSPT* |
| Ga0134125_107385522 | 3300010371 | Terrestrial Soil | ADTWDEAVLTNANETVVYFLMVHCTNSCYRQNQADINTVMSSFTVGSS* |
| Ga0126381_1028735041 | 3300010376 | Tropical Forest Soil | ELYLLQVHCTQTCYTKYQNNIDTVMSSFTVGSPT* |
| Ga0136449_1040985561 | 3300010379 | Peatlands Soil | GVADTFDEDVLTNADQTTVYFLIVHCTKTCYSQNQNDINTVMSSFTVGSS* |
| Ga0126383_136004111 | 3300010398 | Tropical Forest Soil | LGGVTDVWDEDVLTNANQTTVYFLIVHCTNSCYTQNRKDIDTVLSSFTVGSS* |
| Ga0137776_14734202 | 3300010937 | Sediment | FDEDVLTNADQTVVYFLMVHCTNACYTKSQTNINTVMSSFTVGSPT* |
| Ga0137776_16953901 | 3300010937 | Sediment | VVYFLMVHCTNSCYTQNQNKIDTVMSSFTVGSPT* |
| Ga0150983_103944021 | 3300011120 | Forest Soil | NGVAVTFDEDVLTNADQTVVYFLMVHCTNACYTSNQTNINTVMSSFTVGSPT* |
| Ga0137379_105807851 | 3300012209 | Vadose Zone Soil | NGIADTFDESVLTNANQTVVYFLMVHCTNTCYSKNQDKIDTVMSSFTVGSPT* |
| Ga0137386_112639631 | 3300012351 | Vadose Zone Soil | FDEDVLTNSDQTAVYFLMVHCTNACYSQNQNNINTVMSSFTVGSPT* |
| Ga0137384_113289452 | 3300012357 | Vadose Zone Soil | DTVYFLIVHCTQSCYSQNQADINTVMSSFTVGSS* |
| Ga0137398_102236541 | 3300012683 | Vadose Zone Soil | TFSGVTDTFDEEVLTNADQTILYTVQVHCSETCYSQNQNNINTVMSSFTVGSPT* |
| Ga0126375_109240382 | 3300012948 | Tropical Forest Soil | FDQVALTNAQQTIVYFLMVHCTNACYNQNRDKIDTVVSSFTVGSPT* |
| Ga0126369_126662531 | 3300012971 | Tropical Forest Soil | TNANQTVVYFLMVHCTNACYSQNHDKIDTVMTSFTVGSPR* |
| Ga0126369_132245121 | 3300012971 | Tropical Forest Soil | NADQTVVYFLMVHCTNACYSKNQGNIDTVMSSFTVGSPT* |
| Ga0157369_107966601 | 3300013105 | Corn Rhizosphere | TVVYFLMVHCTNSCYSQNQNNINTVMSSFTVGSPT* |
| Ga0181531_101593622 | 3300014169 | Bog | LTNADQTILYSLEVHCTKACYTQNQNSINTVMSSFTVGSPT* |
| Ga0181519_102776181 | 3300014658 | Bog | TNADQTVVYFLMVHCTATCYSQDQNNIDTVMSSFTVGSPT* |
| Ga0182036_111702071 | 3300016270 | Soil | GIADTFDESVLTNADQTVVYFLMVHCTNACYGHNQDKIDTVMSSFTVGSPT |
| Ga0187783_107037292 | 3300017970 | Tropical Peatland | DTFDEDVLTNADQTVVYFLMVHCTDACYSQNQNNINTVMTSFTVGSPT |
| Ga0206355_10079521 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | TVLTNDDQTVVYFLMVHCTNSCYSQNQNNINTVMSSFTVGSPT |
| Ga0206352_103457521 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | FDEDVLTNADQTQVYFLMVHCTNSCYSDNATNINTVMSSFTVGSPT |
| Ga0210399_114167192 | 3300020581 | Soil | QTVVYFLMVHCTNACYTKSQTNINTVMSSFTVGSPT |
| Ga0213875_102003832 | 3300021388 | Plant Roots | NGTSDTFDEDVLTNADQTVVYFLMVHCTNSCYTSNQTNIDTVMSSFTVGSPT |
| Ga0210393_109474231 | 3300021401 | Soil | DTFDEVVLTNADQTVLYTLQVHCTDSCYSQNQNNINTVMSSFTVGSPT |
| Ga0210389_105174942 | 3300021404 | Soil | TVVYFLMVHCTNSCYSQNQNNINTVMSSFTVGSPT |
| Ga0210386_117873832 | 3300021406 | Soil | QTVVYFLMVHCTNSCYSQNQSNINTVMSSFTVGSPT |
| Ga0210383_104633312 | 3300021407 | Soil | DQTVVYFLMVHCTATCYSQAQNNIDTVMSSFTVGSPT |
| Ga0210402_118214361 | 3300021478 | Soil | DTFDEDVLTNADQTVVYFLMVHCMATCYSQDQTNINTVMSSFTVGSPT |
| Ga0210409_113546731 | 3300021559 | Soil | EDVLTNADQTVVYFLMLHCTNACYTKNQTNINTVMSSFTVGSPT |
| Ga0242645_10101791 | 3300022501 | Soil | DQTVVYFLLVHCTNACYTKNQTNINTVMSSFTVGSPT |
| Ga0242646_10081421 | 3300022502 | Soil | NADQTVVYFLMLHCTNACYTKNQTNINTVMSSFTVGSPT |
| Ga0242648_10624341 | 3300022506 | Soil | TILYSLEVHCTKACYTQNQNNINTVMSSFTVGSPT |
| Ga0222728_11129382 | 3300022508 | Soil | TFDEVVLTNADQTELYTVQVHCTRTCYSQNENNINTVMTSFTVGSPT |
| Ga0242667_10188551 | 3300022513 | Soil | NADQTVLYLLEVHCTEACYSKNENNINTIMSSFTVGSPT |
| Ga0242663_10102501 | 3300022523 | Soil | EDVLTNADQTVVYFLMVHCTNACYTKNQTNINTVMSSFTVGSPT |
| Ga0242663_11380772 | 3300022523 | Soil | GGAVNTFDEDVLTNADQTEVYLLQVHCTAACYTQNQNAINTVMTSFTVGSPT |
| Ga0242664_10565582 | 3300022527 | Soil | TNADQTVLYSVQVHCTATCYSDNENNINTVMSSFTVGSPT |
| Ga0242669_10418692 | 3300022528 | Soil | DEDVLTNADQTEVYLLQVHCTSTCYTQNQNAINTVMTSFTVGSST |
| Ga0242669_10674992 | 3300022528 | Soil | DEDVLTNAYQTIVYFLILHCTNACYSQNQNEINTIMSSFTVGSPT |
| Ga0242668_11443881 | 3300022529 | Soil | GAVNTFDEDVLTNADQTEVYLLQVHCTAACYTQNQNAINTVMTSFTVGSST |
| Ga0242658_12477101 | 3300022530 | Soil | EDVLTNADQTVVYFLMVHCTDSCYSQNQNNINTVMSSFTVGSPT |
| Ga0242660_11865321 | 3300022531 | Soil | ADQTVVYFLMVHCTATCYSQAQTNIDTVMSSFTVGSPT |
| Ga0242655_102532881 | 3300022532 | Soil | NADQTVVYFLMLHCTNACYSKNQTNINTVMSSFTVGSPT |
| Ga0242670_10183022 | 3300022708 | Soil | TNADQTELYTVQVHCTRTCYSQNENNINTVMTSFTVGSPT |
| Ga0242677_10062602 | 3300022713 | Soil | VLTNADQTEVYLLQVHCTAACYTQNQNAINTVMTSFTVGSPT |
| Ga0242671_10166961 | 3300022714 | Soil | LTNADQTVVYFLLVHCTNACYEQDQDAINTVMTSFTIGSPT |
| Ga0242673_10717942 | 3300022716 | Soil | EEVLTNADQTVLYSVQVHCTATCYSDNENNINTVMSSFTVGSPT |
| Ga0242661_10257722 | 3300022717 | Soil | DVLTNADQTVVYFLMVHCTNACYSKNQTNINTVMSSFTVGSPT |
| Ga0242672_10400031 | 3300022720 | Soil | DEDVLTNADQTVVYFLILHCTNACYTKNQTNINTVMSSFTVGSPT |
| Ga0242672_11017381 | 3300022720 | Soil | WDEDVLTNANQTVVYFLMVHCTDSCYSQNQADINTVMSSFTVGSP |
| Ga0242665_101234931 | 3300022724 | Soil | VLTNADQTVVYFLMVHCTATCYSQDQASINTVMSSFTVGSPT |
| Ga0207705_105308701 | 3300025909 | Corn Rhizosphere | NADQTVVYFLMVHCTNSCYSQNQNNINTVMSSFTVGSPT |
| Ga0207693_102195582 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DADQTVVYFLMIHCKDSCYSQNQNSINTVMSSFTVGSPT |
| Ga0207660_107305502 | 3300025917 | Corn Rhizosphere | LTNADQTVVYFLMVHCTNSCYSQNQNNINTVMSSFTVGSPT |
| Ga0207664_119802471 | 3300025929 | Agricultural Soil | DTFDETVLTNADQTVVYFLMVHCTNSCYSQNQNNINTVMSSFTVGSPT |
| Ga0257160_10954001 | 3300026489 | Soil | GVADTFDEDVLTNADQTVVYFLMVHCTNACYTKNQTNINTVMSSFTVGSPT |
| Ga0179593_12081753 | 3300026555 | Vadose Zone Soil | VTDTFDEEVLTNADQTILYTVQVHCSETCYSQNQNNINTVMSSFTVGSPT |
| Ga0209110_10297622 | 3300027002 | Forest Soil | TFPGGVVDTFDEDVLTNADQTEVYFLMVHCTDSCFSQNQNNINTVMSSFTVGSPT |
| Ga0209111_10246652 | 3300027058 | Forest Soil | TNADQTEVYFLMVHCTDSCFSQNQNNIDTVMSSFTVGSPT |
| Ga0209218_11305871 | 3300027505 | Forest Soil | ADTFDEDVLTNADQTVVYFLLVHCTNACYTKNQTNINTVMSSFTVGSPT |
| Ga0209007_10172472 | 3300027652 | Forest Soil | NADQTEVYLLQVHCTATCYTQNQNAINTVMTSFTVGSPT |
| Ga0209380_104935431 | 3300027889 | Soil | FDEEVLTNADQTILYTLQVHCSETCYSQNQNNINTVMSSFTVGSPT |
| Ga0209006_106166632 | 3300027908 | Forest Soil | FPGGAANTFDEDVLTNADQTEVYLLMVHCTNTCYSQNQNAINTVMSSFTVGSPT |
| Ga0265353_10056011 | 3300028015 | Soil | EDVLTNADQTVVYFLLVHCTNACYTKNQTNINTVMSSFTVGSPT |
| Ga0222748_10918442 | 3300029701 | Soil | DTFDEEVLTNADQTILYTVQVHCTDSCYSQNQNNINTVMSSFTVGSPT |
| Ga0311368_104722582 | 3300029882 | Palsa | EDSLTNADQTVVYFLLVHCTNTCYTQNQNAINTVMTSFTIGSPT |
| Ga0311340_113548972 | 3300029943 | Palsa | ADQTQVYLLMVHCTSTCYTQNQNAINTVMTSFTVGSPT |
| Ga0311338_103555702 | 3300030007 | Palsa | EALTNADQTVVYFLLVHCTNSCYAQNQNDINTVMTSFTIGSPT |
| Ga0311338_109472862 | 3300030007 | Palsa | QANTFDEAVLTNADQTVVYFLMVHCTATCYSQNQSKINTVMSSFTVGSPT |
| Ga0311372_120631612 | 3300030520 | Palsa | DQTVVYFLVLHCTQACYSQNETSINTVMSSFTVGSPT |
| Ga0311357_111771562 | 3300030524 | Palsa | PTTGQTDTFDQEALTNADQTVVYFLLVHCTNSCYAQNQNDINTVMTSFTIGSPT |
| Ga0210278_10195122 | 3300030596 | Soil | FDEVVLTNADQTELYTLQVHCTQTCYSQNQNNINTVISSFTVGSPT |
| Ga0302317_103284201 | 3300030677 | Palsa | GIVDTFDEDVLTNADQTVVYFLILHCTQSCYSQNQVKINTVMSSFTVGSPT |
| Ga0265462_108392412 | 3300030738 | Soil | AVNTFDEDVLTNADQTEVYLLMVHCTSTCYTQNQNAINTVMTSFTVGSST |
| Ga0302180_104302871 | 3300031028 | Palsa | LTNADQTEVYLLMVHCTSTCYTQNQNAINTVMTSFTVGSST |
| Ga0170824_1215106851 | 3300031231 | Forest Soil | VLTNADQTVVYFLMVHCTATCYSQAQNNIDTVMSSFTVGSPT |
| Ga0318516_104082932 | 3300031543 | Soil | DTFDEDVLTNADQTVVYFLMVHCTNSCYSQNQTNIDTVMSSFTVGSPT |
| Ga0310686_1100075162 | 3300031708 | Soil | EDVLTNADQTQVYFLMVHCTNSCYSQNQNNINTIMSSFTVGSPT |
| Ga0310686_1124947901 | 3300031708 | Soil | EDVLTNADQTVVYFLMVHCTDTCYSQNQTSINTVMSSFTIGSPTS |
| Ga0318521_101144712 | 3300031770 | Soil | TNADQTVVYFLMVHCTNSCYSQNQDKINTVMSSFTVGSPT |
| Ga0318552_106028142 | 3300031782 | Soil | VLTNANQTVVYFLMLHCTNACYSQNRDKIDTVMTSFTVGSPT |
| Ga0306926_125514712 | 3300031954 | Soil | ANQTVVYFLLVHCTNSCYTQNQNNIETVMSSFTVGSPT |
| Ga0306922_114730921 | 3300032001 | Soil | TVVYFLMVHCTNSCYTSNQTNINTVMSSFTVGSPT |
| Ga0318507_100345292 | 3300032025 | Soil | TFPNGIADTFDESVLTNANQTVVYFLMLHCTNACYSQNRDKIDTVMTSFTVGSPT |
| Ga0318559_102054892 | 3300032039 | Soil | LTNADQTVVYFLMVHCTNSCYTQSQDKINTVMSSFTVGSPR |
| Ga0318533_110948012 | 3300032059 | Soil | ADTFDESVLTNADQTVVYFLMVHCTNACYSHNQDKIDTVMSSFTVGSPT |
| Ga0318504_106149092 | 3300032063 | Soil | SDTFDEDVLTNADQTVVYFLMVHCTNSCYTQSQDKINTVMSSFTVGSPR |
| Ga0315742_115376361 | 3300032756 | Forest Soil | DVLTNADQTEVYLLQVHCTAACYTQNQNAINTVMTSFTVGSPT |
| Ga0335070_114397181 | 3300032829 | Soil | LTNADQTVVYFLMVHCTDACYTKNQTNINTVMSSFTVGSPT |
| Ga0335074_108206631 | 3300032895 | Soil | TNADQTVVYFLMVHCTNACYSQNQTNIDAVMTSFTVGSPT |
| Ga0335074_115892001 | 3300032895 | Soil | FDEDVLTNADQTVVYFLMVHCTNACYTQNQTNINTVMSSFTVGSPT |
| ⦗Top⦘ |