Basic Information | |
---|---|
Family ID | F089985 |
Family Type | Metagenome |
Number of Sequences | 108 |
Average Sequence Length | 42 residues |
Representative Sequence | LYDNISEFIHNFEENKRKKKEGKTKGLEKFLEEDLP |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 94.44 % |
% of genes from short scaffolds (< 2000 bps) | 88.89 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (70.370 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.222 % of family members) |
Environment Ontology (ENVO) | Unclassified (73.148 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (73.148 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF00149 | Metallophos | 60.19 |
PF12850 | Metallophos_2 | 9.26 |
PF13476 | AAA_23 | 9.26 |
PF04325 | DUF465 | 7.41 |
PF02945 | Endonuclease_7 | 2.78 |
PF01467 | CTP_transf_like | 2.78 |
PF05050 | Methyltransf_21 | 1.85 |
PF02463 | SMC_N | 1.85 |
PF14090 | HTH_39 | 0.93 |
PF14236 | DUF4338 | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.96 % |
Unclassified | root | N/A | 12.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001838|RCM33_1004984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300001842|RCM30_1060193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300002395|B570J29621_106203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
3300003394|JGI25907J50239_1030178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1162 | Open in IMG/M |
3300003411|JGI25911J50253_10143618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
3300003411|JGI25911J50253_10213479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300004804|Ga0007796_10214517 | Not Available | 563 | Open in IMG/M |
3300005580|Ga0049083_10173014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300005580|Ga0049083_10198317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300005581|Ga0049081_10067865 | All Organisms → Viruses → Predicted Viral | 1341 | Open in IMG/M |
3300005581|Ga0049081_10184974 | Not Available | 752 | Open in IMG/M |
3300005581|Ga0049081_10200638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Ackermannviridae → unclassified Ackermannviridae → Rhizobium phage RHph_I1_18 | 715 | Open in IMG/M |
3300005581|Ga0049081_10288753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300005582|Ga0049080_10196860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300005585|Ga0049084_10206412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300006875|Ga0075473_10132352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
3300007544|Ga0102861_1082697 | Not Available | 849 | Open in IMG/M |
3300007627|Ga0102869_1164582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300008114|Ga0114347_1130482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
3300008116|Ga0114350_1003755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11622 | Open in IMG/M |
3300008116|Ga0114350_1037840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2716 | Open in IMG/M |
3300008116|Ga0114350_1052466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1474 | Open in IMG/M |
3300008117|Ga0114351_1043821 | All Organisms → Viruses → Predicted Viral | 2834 | Open in IMG/M |
3300008259|Ga0114841_1176958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
3300008267|Ga0114364_1192424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300009183|Ga0114974_10441336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
3300009184|Ga0114976_10308317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
3300009184|Ga0114976_10583882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300011010|Ga0139557_1000249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13794 | Open in IMG/M |
3300012012|Ga0153799_1050952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300012017|Ga0153801_1042817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300012666|Ga0157498_1022810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
3300013004|Ga0164293_10070571 | All Organisms → Viruses | 2752 | Open in IMG/M |
3300013004|Ga0164293_10137377 | All Organisms → Viruses → Predicted Viral | 1831 | Open in IMG/M |
3300013005|Ga0164292_10774902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300013372|Ga0177922_11071218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300017701|Ga0181364_1047227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300017722|Ga0181347_1088322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
3300017723|Ga0181362_1082585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300017736|Ga0181365_1023238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1562 | Open in IMG/M |
3300017764|Ga0181385_1193852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300017766|Ga0181343_1048672 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
3300017766|Ga0181343_1138447 | Not Available | 680 | Open in IMG/M |
3300017773|Ga0181386_1114490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
3300017774|Ga0181358_1151700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300017774|Ga0181358_1265465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300017777|Ga0181357_1308883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300017780|Ga0181346_1009421 | All Organisms → Viruses → Predicted Viral | 4198 | Open in IMG/M |
3300017784|Ga0181348_1224358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
3300017785|Ga0181355_1372381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300017785|Ga0181355_1373135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300017956|Ga0181580_10314990 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
3300019784|Ga0181359_1098405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
3300020083|Ga0194111_10087519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2546 | Open in IMG/M |
3300020159|Ga0211734_10427275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
3300020161|Ga0211726_10618145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300020162|Ga0211735_10169614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
3300020196|Ga0194124_10376239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
3300020221|Ga0194127_10922598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300020557|Ga0208231_1021467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1111 | Open in IMG/M |
3300020571|Ga0208723_1006247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 2177 | Open in IMG/M |
3300020571|Ga0208723_1036239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300020572|Ga0207909_1058974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300021091|Ga0194133_10556691 | Not Available | 572 | Open in IMG/M |
3300021093|Ga0194123_10096058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1729 | Open in IMG/M |
3300021602|Ga0194060_10235244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
3300022179|Ga0181353_1026414 | All Organisms → Viruses → Predicted Viral | 1537 | Open in IMG/M |
3300023174|Ga0214921_10299286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Atlauavirus → Synechococcus virus AC2014fSyn7803C8 | 897 | Open in IMG/M |
3300025732|Ga0208784_1085166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
3300026187|Ga0209929_1074785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
3300027144|Ga0255102_1033914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
3300027608|Ga0208974_1110067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Ackermannviridae → unclassified Ackermannviridae → Rhizobium phage RHph_I1_18 | 727 | Open in IMG/M |
3300027732|Ga0209442_1176963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300027736|Ga0209190_1097497 | All Organisms → Viruses → Predicted Viral | 1362 | Open in IMG/M |
3300027759|Ga0209296_1305239 | Not Available | 631 | Open in IMG/M |
3300027770|Ga0209086_10413963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300027772|Ga0209768_10089469 | All Organisms → Viruses → Predicted Viral | 1534 | Open in IMG/M |
3300027777|Ga0209829_10082304 | All Organisms → Viruses → Predicted Viral | 1604 | Open in IMG/M |
3300027782|Ga0209500_10456293 | Not Available | 502 | Open in IMG/M |
3300027785|Ga0209246_10280048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300027798|Ga0209353_10291127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Ackermannviridae → unclassified Ackermannviridae → Rhizobium phage RHph_I1_18 | 694 | Open in IMG/M |
3300027805|Ga0209229_10104771 | All Organisms → Viruses → Predicted Viral | 1274 | Open in IMG/M |
3300027805|Ga0209229_10512437 | Not Available | 511 | Open in IMG/M |
3300027808|Ga0209354_10100489 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
3300027808|Ga0209354_10184334 | Not Available | 848 | Open in IMG/M |
3300029933|Ga0119945_1012714 | All Organisms → Viruses | 1071 | Open in IMG/M |
3300031758|Ga0315907_10109697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2361 | Open in IMG/M |
3300031758|Ga0315907_10930408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300031787|Ga0315900_10225049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1631 | Open in IMG/M |
3300031857|Ga0315909_10974208 | Not Available | 515 | Open in IMG/M |
3300032050|Ga0315906_10299039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1451 | Open in IMG/M |
3300032092|Ga0315905_10559495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1041 | Open in IMG/M |
3300032093|Ga0315902_10093172 | All Organisms → Viruses → Predicted Viral | 3285 | Open in IMG/M |
3300032116|Ga0315903_10252166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1524 | Open in IMG/M |
3300033994|Ga0334996_0520258 | Not Available | 528 | Open in IMG/M |
3300033996|Ga0334979_0541194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300034020|Ga0335002_0652760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300034104|Ga0335031_0735186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300034105|Ga0335035_0643772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300034106|Ga0335036_0048359 | All Organisms → Viruses → Predicted Viral | 3264 | Open in IMG/M |
3300034106|Ga0335036_0474063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
3300034111|Ga0335063_0238911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
3300034112|Ga0335066_0158929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1373 | Open in IMG/M |
3300034117|Ga0335033_0177066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1166 | Open in IMG/M |
3300034121|Ga0335058_0301703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
3300034122|Ga0335060_0226363 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
3300034283|Ga0335007_0427500 | Not Available | 819 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.22% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.74% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 8.33% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.33% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.41% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.48% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.56% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.63% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.70% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.85% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.85% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.85% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.85% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.85% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.85% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.93% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.93% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.93% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.93% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.93% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.93% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
3300002395 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
RCM33_10049841 | 3300001838 | Marine Plankton | GNMKQFELYDNISEFIHTFEENKRKKKEGKAKGLEKFLDEELPE* |
RCM30_10601933 | 3300001842 | Marine Plankton | ELYDNISEFIHNFEENKKKKKEGKTKGIDQFINEDQ* |
B570J29621_1062033 | 3300002395 | Freshwater | NMRQFELYDNISEFIFNFEENKRKKKEGKTKGLEKFMEEELPE* |
JGI25907J50239_10301783 | 3300003394 | Freshwater Lake | DNISEFIQNFEDNKKKKKEGKTKGLEKFIEKLPEVPLTNT* |
JGI25911J50253_101436181 | 3300003411 | Freshwater Lake | YDNISEFIQNFEDGKKKKKEGKTKGLEKFIEELPTEPLTNS* |
JGI25911J50253_102134791 | 3300003411 | Freshwater Lake | QMYDNISEFIQNFEDGKKKKKEGKTKGLEKFIEELPTEPLTNS*DYDII* |
Ga0007796_102145172 | 3300004804 | Freshwater | QMYDNISEFIFNFEESKRKKKEGKVKGLEKFIEDIPEST* |
Ga0049083_101730141 | 3300005580 | Freshwater Lentic | MKQFELYENISEFIHNFEEGKRKKKEGKTKGLEKFIEVLPKEPLTNS* |
Ga0049083_101983171 | 3300005580 | Freshwater Lentic | ELYDNISEFIFNFEENRKKKKEKKAEGLETFLETDVE*KYVY* |
Ga0049081_100678653 | 3300005581 | Freshwater Lentic | NKQFQLYENISEFIYNFEENKKKKKESKTKGLEKFIEEIDEDK* |
Ga0049081_101849742 | 3300005581 | Freshwater Lentic | NISEFIHNFEESKRKKKEGKVKGLEKFIEDIPESA* |
Ga0049081_102006383 | 3300005581 | Freshwater Lentic | FQLYENISEFIYNFEENKKKKKESKTKGLEKFIEEIDEEK* |
Ga0049081_102887533 | 3300005581 | Freshwater Lentic | DNISEFIFNFEESKRKKKEGKTKGLEKFLDEELPDSA* |
Ga0049080_101968602 | 3300005582 | Freshwater Lentic | QRQFQLYDNISEFIHNFEESKRKKKEGKAKGLEKFIEEA*N* |
Ga0049084_102064122 | 3300005585 | Freshwater Lentic | EMYEDSDGNMKQFVLYENISEFIQNFEESKKKKKEGKTKGLEKFI* |
Ga0075473_101323523 | 3300006875 | Aqueous | QLYDNISEFIYNFEESKRKKKESKIKGLEKFMEEDLP* |
Ga0102861_10826971 | 3300007544 | Estuarine | NISEFIHTFEEAKKKKKEGKTKGVEKFLEELPEQPLTNL* |
Ga0102869_11645821 | 3300007627 | Estuarine | NISEFIHNFEEGKRKKKEGKTKGLEKFIEELPKEPLTNS* |
Ga0114347_11304822 | 3300008114 | Freshwater, Plankton | MKQFELYDNISEFIHNFEENKKKKKEKKSEGLEQFLDDDIE* |
Ga0114350_100375513 | 3300008116 | Freshwater, Plankton | ENISEFIYNFEENKKKKKESKTKGLEKFIEEIDEDK* |
Ga0114350_10378404 | 3300008116 | Freshwater, Plankton | MRQFELYDNISEFIFNFEENKRKKKEGKTKGLEKFMEEQLPE* |
Ga0114350_10524663 | 3300008116 | Freshwater, Plankton | MRQFELYDNISEFIFNFEENKRKKKEGKTKGLEKFMEEELPE* |
Ga0114351_10438213 | 3300008117 | Freshwater, Plankton | KQFELYDNIAEFIETFEEAKEKKKKSKTKGLEKFLDADELDIPKEL* |
Ga0114841_11769581 | 3300008259 | Freshwater, Plankton | YDNISEFIHNFEENKKKKKVKKLIGLDNFLDDDII* |
Ga0114364_11924241 | 3300008267 | Freshwater, Plankton | FEDSDGNMKQFQLYDNISEFIHNFEESKRKKKEGKVKGVEKFMKDLPE* |
Ga0114974_104413361 | 3300009183 | Freshwater Lake | NYKQFEMYENISEFIQTFEENKKKKKAKTIKGVDNFIENDVE* |
Ga0114976_103083171 | 3300009184 | Freshwater Lake | KQFELYANISEFIFNFEERKKKKKDNKPAKGVDQFIEDL* |
Ga0114976_105838822 | 3300009184 | Freshwater Lake | YENISEFIHNFEEGKRKKKEGKTKGLEKFIEELPTEPLTNS* |
Ga0114971_104628392 | 3300009185 | Freshwater Lake | AEGNMKQFELYDNISEFIENFEESREKKKKIKVKGLEKFIEPTDLDIPKEL* |
Ga0139557_100024917 | 3300011010 | Freshwater | HMKQFELYDNIAEFIETFEQAKEKKKKSKTKGLEKFLDADELDIPKEL* |
Ga0153799_10509521 | 3300012012 | Freshwater | DSDGNIKQFQMYDNISEFIQNFEESKQKKKDGKTKGLEKFIEELPTEPLTNI* |
Ga0153801_10428172 | 3300012017 | Freshwater | MFEDENGNMRQFELYDNISEFIFNFEENKKKKKEKKAEGLESFLQNDVE* |
Ga0157498_10228101 | 3300012666 | Freshwater, Surface Ice | YDNISEFIHNFEESKKKKKEDKVKGLDQFIGEDL* |
Ga0164293_100705711 | 3300013004 | Freshwater | LYDNISEFIHNFEESKRKKKEGKAKGLEKFIEEA* |
Ga0164293_101373771 | 3300013004 | Freshwater | DNISEFIHTFEEAKKKKKESKTKGVEKFLEELPEQPLTNL* |
Ga0164292_107749022 | 3300013005 | Freshwater | SDGTMKQFQMYYNISEFIQNFEESKKKKKDGKTKGLEKFIEELPIKPLTNS* |
Ga0177922_110712182 | 3300013372 | Freshwater | FQLYDNISEFIHNFEESKRKKKEGKAKGLEKFIEEI* |
Ga0181364_10472271 | 3300017701 | Freshwater Lake | QMYDNISEFIQNFEESKQKKKDGKTKGLEKFIEELPTEPLTNS |
Ga0181347_10883222 | 3300017722 | Freshwater Lake | RQFQLYDNISEFIFNFEESKRKKKEGKTKGLEKFIEQT |
Ga0181362_10825851 | 3300017723 | Freshwater Lake | QFELYDNISEFIFNFEESKRKKKEGKTKGLEKFLDEELPDSA |
Ga0181365_10232381 | 3300017736 | Freshwater Lake | DNISEFIQNFEDNKKKKKEGKTKGLEKFIEKLPEVPLTNT |
Ga0181385_11938521 | 3300017764 | Seawater | EDENGNQRQFELYDNISEFIHNFEENKKKKKQKTLKGLDNFVEKDV |
Ga0181343_10486721 | 3300017766 | Freshwater Lake | DENGNMRQFELYDNISEFIYNFEENKKNKKKKKSEGLEQFIDEDLED |
Ga0181343_11384471 | 3300017766 | Freshwater Lake | QLYDNISEFIHTFEEAKKKKKEGKTKGVEKFLEELPEQPLTNL |
Ga0181386_11144901 | 3300017773 | Seawater | ENGNQRQFELYDNISEFIHNFEENKKKKKQKTLKGLDNFVEKDV |
Ga0181358_11517002 | 3300017774 | Freshwater Lake | MYEDADGHSRQFQLYDNISEFIFNFEESKRKKKEGKTKGLEKFIEQT |
Ga0181358_12654651 | 3300017774 | Freshwater Lake | KQFELYENISEFIHNFEEGKRKKKEGKTKGLEKFIEELPTEPLTNS |
Ga0181357_13088832 | 3300017777 | Freshwater Lake | FELYENISEFIHNFEEGKRKKKEGKTKGLEKFIEELPTEPLTNS |
Ga0181346_10094217 | 3300017780 | Freshwater Lake | YDNISEFIHNFEESKRKKKEGKVKGVEKFMEDLPE |
Ga0181348_12243581 | 3300017784 | Freshwater Lake | DGHQKQFQLYDNISEFIFNFEESKRKKKEGKTKGLEKFIEQT |
Ga0181355_13723811 | 3300017785 | Freshwater Lake | QFELYANISEFIFNFEENKKKKKDNKPAKGVDQFIGEDL |
Ga0181355_13731351 | 3300017785 | Freshwater Lake | NMKQFVLYENISEFIQNFEESKKKKKEGKTKGLEKFI |
Ga0181580_103149901 | 3300017956 | Salt Marsh | FELYDNISQFIQDFEESKQKKKDAKVKGLDKFLDE |
Ga0181359_10984052 | 3300019784 | Freshwater Lake | IELYDNIAEFIETFEDAKEKKKKAKTKGLEKFLDADELDIPKEL |
Ga0194111_100875194 | 3300020083 | Freshwater Lake | KLYENISEFIHNFEENKRKKKEGKIKGLEKFMEEELP |
Ga0211734_104272753 | 3300020159 | Freshwater | QKQFQLYDNISEFIHNFEESKRKKKEGKVKGVEKFMEDLPE |
Ga0211726_106181452 | 3300020161 | Freshwater | QKQFQLYDNISEFIHNFEESKRKKKEGKAKGLEKFIEET |
Ga0211735_101696141 | 3300020162 | Freshwater | QMYDNISEFIQNFEESKKKKKEGKTKGLEKFIEELPTEPLTNI |
Ga0194124_103762393 | 3300020196 | Freshwater Lake | KQFELYDNISEFIHNFEENKKKRKENKTKGLDKFFSEDL |
Ga0194127_109225983 | 3300020221 | Freshwater Lake | LYDNISEFIHNFEENKRKKKEGKTKGLEKFLEEDLP |
Ga0208231_10214672 | 3300020557 | Freshwater | ELYDNISEFIHNFEENKKKKKEKKSEGLEQFLDDELE |
Ga0208723_10062471 | 3300020571 | Freshwater | MMEDENGNMRQFELYENISEFIYNFEENKRKKKEGKTKGLEKFLDEELPDSA |
Ga0208723_10362392 | 3300020571 | Freshwater | QFQLYDNISEFIQTFEENKRKKKENKTKGLEKFIDEI |
Ga0207909_10589741 | 3300020572 | Freshwater | MRQFELYDNISEFIFNFEENKRKKKEGKTKGLEKFMEEQLPE |
Ga0194133_105566912 | 3300021091 | Freshwater Lake | NISEFIYNFEENKKNKKKKKAEGLEQFIDEDDIEN |
Ga0194123_100960584 | 3300021093 | Freshwater Lake | EDSEGNMRQFELYDNISEFIHNFEENKRKKKEGKTKGLEKFLEEDLP |
Ga0194060_102352441 | 3300021602 | Anoxic Zone Freshwater | GNIRQFEMYNNISDFIFTFEEAKKKKKDLKAKGLEKFISQIPEIA |
Ga0181353_10264143 | 3300022179 | Freshwater Lake | FELYDNISEFIYNFEENKKNKKKKKSEGLEQFIDEDLED |
Ga0214921_102992861 | 3300023174 | Freshwater | DGHMKQFELYDNIAEFIETFEEAKEKKKKSKTKGLEKFLDAEEIVSEDDLEK |
Ga0208784_10851661 | 3300025732 | Aqueous | QLYDNISEFIYNFEESKRKKKESKIKGLEKFMEEDLP |
Ga0209929_10747853 | 3300026187 | Pond Water | FELLEDSDGNTRQFELYDNISEFIQNFEESKKKKKEAKVKGVDKFVDK |
Ga0255102_10339141 | 3300027144 | Freshwater | FQLYENISEFIYNFEENKKKKKESKTKGLEKFIEEIDEDK |
Ga0208974_11100673 | 3300027608 | Freshwater Lentic | LYENISEFIYNFEENKKKKKESKTKGLEKFIEEIDEDK |
Ga0209442_11769631 | 3300027732 | Freshwater Lake | FIQNFEDGKKKKKEGKTKGLEKFIEELPTEPLTNS |
Ga0209190_10974971 | 3300027736 | Freshwater Lake | QFQLYDNISEFIHTFEEAKKKKKEGKTKGVEKFLEELPEQPLTNL |
Ga0209296_13052392 | 3300027759 | Freshwater Lake | GHMKQFQMYDNISEFIHNFEESKRKKKEGKVKGLEKFIEDIPEST |
Ga0209086_104139632 | 3300027770 | Freshwater Lake | MKQFELYDNISEFIHNFEESKKKKKGKVVKGLDNFLEDPV |
Ga0209768_100894691 | 3300027772 | Freshwater Lake | KQFELYDNIAEFIETFEQAKEKKKKSKTKGLEKFLDADELDIPKEL |
Ga0209829_100823041 | 3300027777 | Freshwater Lake | NISEFIFNFEESKRKKKEGKVKGLEKFIEDIPEST |
Ga0209500_104562932 | 3300027782 | Freshwater Lake | HMQQFQMYDNISEFIHTFEETKKNKKKVKIKGIENFIQLDVKELPEI |
Ga0209246_102800482 | 3300027785 | Freshwater Lake | GNMKQFVLYENISEFIQNFEESKKKKKEGKTKGLEKFI |
Ga0209353_102911273 | 3300027798 | Freshwater Lake | ENISEFIYNFEENKKKKKESKTKGLEKFIEEIDEDK |
Ga0209229_101047712 | 3300027805 | Freshwater And Sediment | MKQFELYDNIAEFIETFEEAKEKKKKSKTKGLEKFLDAEELDIPKDL |
Ga0209229_105124371 | 3300027805 | Freshwater And Sediment | GHMKQFELYDNIAEFIETFEEAKEKKKKSKTKGLEKFLDADELDIPKEL |
Ga0209354_101004892 | 3300027808 | Freshwater Lake | DSDGNMKQFELYENISEFIHNFEEGKRKKKEGKTKGLEKFIEELPKEPLTNS |
Ga0209354_101843342 | 3300027808 | Freshwater Lake | YDNISEFIHNFEESKRKKKEGKVKGLEKFIEDIPESA |
Ga0119945_10127143 | 3300029933 | Aquatic | QFELYDNISEFIYNFEENKKKKKEKKSEGLEQFIEDDISDEDRI |
Ga0315907_101096971 | 3300031758 | Freshwater | ENGNMRQFELYDNISEFIFNFEENKRKKKEGKTKGLEKFMEEQLPE |
Ga0315907_109304083 | 3300031758 | Freshwater | EDSDGNMKQFQLYDNISEFIHNFEESKRKKKEGKAKGLEKFMEEDSPE |
Ga0315900_102250494 | 3300031787 | Freshwater | LYDNISEFIFNFEESKRKKKEGKTKGLEKFLDEELPDSA |
Ga0315909_109742083 | 3300031857 | Freshwater | DSDGVAKQFELYDNISEFIHNFEESKKKKKEGKVKGLDQFIGEDL |
Ga0315906_102990391 | 3300032050 | Freshwater | ADGHQRQFQLYDNISEFIHNFEESKRKKKEGKAKGLEKFIEEA |
Ga0315905_105594951 | 3300032092 | Freshwater | RQFELYDNISEFIFNFEESKRKKKEGKTKGLEKFLDEELPDSA |
Ga0315902_100931721 | 3300032093 | Freshwater | NKQFQLYENISEFIYNFEENKKKKKESKTKGLEKFIEEIDEDK |
Ga0315903_102521661 | 3300032116 | Freshwater | GHSRQFELYDNISEFIFNFEENKRKKKEGKTKGLEKFLDEELPDSA |
Ga0334996_0520258_4_147 | 3300033994 | Freshwater | MRQFQLYDNISEFIHTFEEAKKKKKEGKTKGVEKFLEELPEQPLTNL |
Ga0334979_0541194_490_624 | 3300033996 | Freshwater | SDGVAKQFELYDNISEFIHNFEESKKKKKEGKVKGLDQFIGEDL |
Ga0335002_0652760_5_148 | 3300034020 | Freshwater | MYEDADGHQKQFQLYDNISEFIHNFEESKRKKKEGKAKGLEKFIEEA |
Ga0335031_0735186_2_130 | 3300034104 | Freshwater | MYDNISEFIQNFEDSKKKKKEGKTKGLEKFIEELPVEPLTNT |
Ga0335035_0643772_1_111 | 3300034105 | Freshwater | NISEFIFNFEESKRKKKEGKTKGLEKFLDEELPDSA |
Ga0335036_0048359_3138_3263 | 3300034106 | Freshwater | KQFELYDNISEFIHNFEENKKNKKKKKSEGLEQFIDEDEQE |
Ga0335036_0474063_619_762 | 3300034106 | Freshwater | MYEDADGHQRQFQLYDNISEFIHNFEESKRKKKEGKAKGLEKFIEEA |
Ga0335063_0238911_842_997 | 3300034111 | Freshwater | FEDENGNMRQFELYDNISEFIFNFEENKRKKKEGKTKGLEKFLDEELPDSA |
Ga0335066_0158929_1229_1360 | 3300034112 | Freshwater | MKQFVIYDNISEFIHNFEEKKRNKKKNKKGLEQFFEEELTNEG |
Ga0335033_0177066_20_145 | 3300034117 | Freshwater | MKQFELYDNISEFIFNFEENKKKKKIKAVKGLENFIQDDVE |
Ga0335058_0301703_802_927 | 3300034121 | Freshwater | GHQRQFQLYDNISEFIHNFEESKRKKKEGKAKGLEKFIEEA |
Ga0335060_0226363_10_126 | 3300034122 | Freshwater | MKQFELYDNISEFIQNFEENKRKKKEGKTKGIDNFVEE |
Ga0335007_0427500_3_125 | 3300034283 | Freshwater | QFELYDNISEFIHNFEENKKNKKKKKSEGLEQFIDEDEQE |
⦗Top⦘ |