NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F089948

Metagenome Family F089948

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089948
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 58 residues
Representative Sequence LGGVVVLRGGGIRSACRASSRMRERATVRGAYLVKRGWRGSRGRASGRGGCGVGLAVVAA
Number of Associated Samples 8
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 58.33 %
% of genes near scaffold ends (potentially truncated) 9.26 %
% of genes from short scaffolds (< 2000 bps) 0.93 %
Associated GOLD sequencing projects 6
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules
(71.296 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(100.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 28.41%    β-sheet: 0.00%    Coil/Unstructured: 71.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF00078RVT_1 21.30
PF00665rve 16.67
PF13456RVT_3 13.89
PF03732Retrotrans_gag 2.78
PF14223Retrotran_gag_2 2.78
PF00005ABC_tran 1.85
PF03108DBD_Tnp_Mut 1.85
PF01599Ribosomal_S27 0.93
PF07714PK_Tyr_Ser-Thr 0.93
PF031712OG-FeII_Oxy 0.93
PF12972NAGLU_C 0.93
PF01535PPR 0.93
PF08284RVP_2 0.93
PF00295Glyco_hydro_28 0.93
PF07727RVT_2 0.93
PF01058Oxidored_q6 0.93
PF14227Obsolete Pfam Family 0.93
PF04564U-box 0.93
PF03107C1_2 0.93
PF02179BAG 0.93
PF14214Helitron_like_N 0.93
PF03081Exo70 0.93
PF13963Transpos_assoc 0.93
PF02992Transposase_21 0.93
PF05970PIF1 0.93
PF14226DIOX_N 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 16.67
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 16.67
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 16.67
COG4584TransposaseMobilome: prophages, transposons [X] 16.67
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.70
COG0377NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductaseEnergy production and conversion [C] 0.93
COG0507ATPase/5’-3’ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.93
COG1740Ni,Fe-hydrogenase I small subunitEnergy production and conversion [C] 0.93
COG1941Coenzyme F420-reducing hydrogenase, gamma subunitEnergy production and conversion [C] 0.93
COG3260Ni,Fe-hydrogenase III small subunitEnergy production and conversion [C] 0.93
COG5434PolygalacturonaseCarbohydrate transport and metabolism [G] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006943|Ga0099822_1000519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata36363Open in IMG/M
3300006943|Ga0099822_1003359All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata20486Open in IMG/M
3300006943|Ga0099822_1003927All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta19231Open in IMG/M
3300006943|Ga0099822_1004128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata18832Open in IMG/M
3300006943|Ga0099822_1005188All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata17015Open in IMG/M
3300006943|Ga0099822_1007741All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata13833Open in IMG/M
3300006943|Ga0099822_1008033All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata13547Open in IMG/M
3300006943|Ga0099822_1008253All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata13344Open in IMG/M
3300006943|Ga0099822_1008493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata13118Open in IMG/M
3300006943|Ga0099822_1010484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata11487Open in IMG/M
3300006943|Ga0099822_1010643All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata11372Open in IMG/M
3300006943|Ga0099822_1013541All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata9535Open in IMG/M
3300006943|Ga0099822_1015148All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8716Open in IMG/M
3300006943|Ga0099822_1019410All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata6922Open in IMG/M
3300006943|Ga0099822_1025021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5258Open in IMG/M
3300006943|Ga0099822_1028863All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4384Open in IMG/M
3300006943|Ga0099822_1030157All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4127Open in IMG/M
3300006943|Ga0099822_1031371All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3906Open in IMG/M
3300006943|Ga0099822_1032924All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3630Open in IMG/M
3300006943|Ga0099822_1039641All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2683Open in IMG/M
3300006944|Ga0099823_1004465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta13675Open in IMG/M
3300006944|Ga0099823_1010252All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata9511Open in IMG/M
3300006944|Ga0099823_1028854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4737Open in IMG/M
3300006944|Ga0099823_1032142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4290Open in IMG/M
3300021320|Ga0214544_1000332All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata81921Open in IMG/M
3300021320|Ga0214544_1000444All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata74919Open in IMG/M
3300021320|Ga0214544_1000583All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata68686Open in IMG/M
3300021320|Ga0214544_1000980All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata57025Open in IMG/M
3300021320|Ga0214544_1001622All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna47246Open in IMG/M
3300021320|Ga0214544_1002031All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata42684Open in IMG/M
3300021320|Ga0214544_1002062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata42257Open in IMG/M
3300021320|Ga0214544_1002408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata39285Open in IMG/M
3300021320|Ga0214544_1002705All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata37125Open in IMG/M
3300021320|Ga0214544_1003467All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata32582Open in IMG/M
3300021320|Ga0214544_1003491All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata32417Open in IMG/M
3300021320|Ga0214544_1003744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata31042Open in IMG/M
3300021320|Ga0214544_1004182All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata29153Open in IMG/M
3300021320|Ga0214544_1004504All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata27965Open in IMG/M
3300021320|Ga0214544_1005134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata25724Open in IMG/M
3300021320|Ga0214544_1005465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata24574Open in IMG/M
3300021320|Ga0214544_1005617All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata24072Open in IMG/M
3300021320|Ga0214544_1006466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata21569Open in IMG/M
3300021320|Ga0214544_1006548All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata21381Open in IMG/M
3300021320|Ga0214544_1007191All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata19799Open in IMG/M
3300021320|Ga0214544_1007313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata19501Open in IMG/M
3300021320|Ga0214544_1007617All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata18832Open in IMG/M
3300021320|Ga0214544_1007651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata18749Open in IMG/M
3300021320|Ga0214544_1008051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata17951Open in IMG/M
3300021320|Ga0214544_1008348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata17310Open in IMG/M
3300021320|Ga0214544_1009004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata16049Open in IMG/M
3300021320|Ga0214544_1009244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata15604Open in IMG/M
3300021320|Ga0214544_1009798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata14684Open in IMG/M
3300021320|Ga0214544_1009976All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata14394Open in IMG/M
3300021320|Ga0214544_1010016All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata14325Open in IMG/M
3300021320|Ga0214544_1010874All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata13043Open in IMG/M
3300021320|Ga0214544_1011780All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata11857Open in IMG/M
3300021320|Ga0214544_1011883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata11736Open in IMG/M
3300021320|Ga0214544_1012277All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata11268Open in IMG/M
3300021320|Ga0214544_1012431All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata11076Open in IMG/M
3300021320|Ga0214544_1012701All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata10746Open in IMG/M
3300021320|Ga0214544_1012720All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata10729Open in IMG/M
3300021320|Ga0214544_1012763All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata10690Open in IMG/M
3300021320|Ga0214544_1013717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata9618Open in IMG/M
3300021320|Ga0214544_1013814All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata9511Open in IMG/M
3300021320|Ga0214544_1013986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata9340Open in IMG/M
3300021320|Ga0214544_1014095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata9233Open in IMG/M
3300021320|Ga0214544_1014507All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8779Open in IMG/M
3300021320|Ga0214544_1015825All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7633Open in IMG/M
3300021320|Ga0214544_1015915All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7554Open in IMG/M
3300021320|Ga0214544_1016011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7476Open in IMG/M
3300021320|Ga0214544_1016975All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata6764Open in IMG/M
3300021320|Ga0214544_1020948All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4453Open in IMG/M
3300021320|Ga0214544_1023393All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3460Open in IMG/M
3300021321|Ga0214542_1003777All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata30472Open in IMG/M
3300021321|Ga0214542_1004420All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata27876Open in IMG/M
3300021321|Ga0214542_1007542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata18857Open in IMG/M
3300021321|Ga0214542_1007858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata18192Open in IMG/M
3300021321|Ga0214542_1011118All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata12551Open in IMG/M
3300021321|Ga0214542_1011436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata12157Open in IMG/M
3300021321|Ga0214542_1015440All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7967Open in IMG/M
3300021321|Ga0214542_1022809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3915Open in IMG/M
3300021324|Ga0214545_1000668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna57384Open in IMG/M
3300021324|Ga0214545_1004345All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta26597Open in IMG/M
3300021324|Ga0214545_1005012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata24337Open in IMG/M
3300021324|Ga0214545_1005109All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata24044Open in IMG/M
3300021324|Ga0214545_1006093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata21225Open in IMG/M
3300021324|Ga0214545_1012164All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata11413Open in IMG/M
3300021324|Ga0214545_1012957All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata10605Open in IMG/M
3300021324|Ga0214545_1015559All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8260Open in IMG/M
3300021324|Ga0214545_1015688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8158Open in IMG/M
3300021324|Ga0214545_1018998All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata6042Open in IMG/M
3300021324|Ga0214545_1019996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5522Open in IMG/M
3300021324|Ga0214545_1020538All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5245Open in IMG/M
3300021324|Ga0214545_1023780All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3943Open in IMG/M
3300021324|Ga0214545_1035988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1598Open in IMG/M
3300021327|Ga0214543_1000338All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata75042Open in IMG/M
3300021327|Ga0214543_1000513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata65763Open in IMG/M
3300021327|Ga0214543_1009460All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata15118Open in IMG/M
3300021327|Ga0214543_1014298All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata9417Open in IMG/M
3300021327|Ga0214543_1028507All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2637Open in IMG/M
3300021327|Ga0214543_1030161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2323Open in IMG/M
3300027296|Ga0209389_1003767All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata12364Open in IMG/M
3300027296|Ga0209389_1028978All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4723Open in IMG/M
3300027296|Ga0209389_1054548All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2653Open in IMG/M
3300027296|Ga0209389_1057723All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2487Open in IMG/M
3300027357|Ga0209589_1004268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata24778Open in IMG/M
3300027357|Ga0209589_1021071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5913Open in IMG/M
3300027357|Ga0209589_1025348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4301Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Root NodulesHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules71.30%
Root NodulesHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules28.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006943Root nodule microbial communities of legume samples collected from California USA - Cow pea white BWHost-AssociatedOpen in IMG/M
3300006944Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BWHost-AssociatedOpen in IMG/M
3300021320Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3Host-AssociatedOpen in IMG/M
3300021321Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1Host-AssociatedOpen in IMG/M
3300021324Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4Host-AssociatedOpen in IMG/M
3300021327Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2Host-AssociatedOpen in IMG/M
3300027296Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes)Host-AssociatedOpen in IMG/M
3300027357Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0099822_1000519193300006943Root NodulesMRSACRASSRMRERATIRGAYLVKWGWRGSCGQVSGRGGCGVGLAVVAA*
Ga0099822_1003359343300006943Root NodulesVLRGRGIRSACKASSRMRERATIRGAYLVKRGWRGLRGRASGRGLGCGVGLAVVDA*
Ga0099822_1003927463300006943Root NodulesMRGGGMRSACRASSRMRDRAIIRGVYLVKRGWRGSRGRVSGQGGCGVGLAVVAA*
Ga0099822_1004128373300006943Root NodulesMSVLGGVVVLRGGGIRSACRASSRMRERAMVRGAYLVKRGWRGSRGRVSGRGGCGVGLAVVAA*
Ga0099822_100518853300006943Root NodulesLVISALGGVVVLRGGGIRSACRASSRMRERATVRAAYLVKRGWRGSRGRVSGRGLGCGVGLAVVAT*
Ga0099822_100774193300006943Root NodulesMRSACRGSSRMREQATVRGAYLVKRGWRGSHGRVSERGGCGVGLAVVAA*
Ga0099822_100803343300006943Root NodulesVVLRGGGMRSACRVSSRMRDRATVRGAYLVKRGWQGSRGRVSGQGGCGVGWEVVAA*
Ga0099822_100825393300006943Root NodulesVVLRGGGMRSACRASSRMRDRATVRGAYLVKRGWRGSHGRVSGRGGCGVGLTVVAA*
Ga0099822_1008493233300006943Root NodulesMSALGDVVVLRGGGIRSAWRASSRMREQATVKGAYLVKRGWRGSRERVSGRGLGCGLGLVGVAA*
Ga0099822_101048443300006943Root NodulesMSTLGGVVVLRGGGIRSASRASPRIRERATVKGVYLVKRGWRGSRGRVSGRGLGCGVGLAVVAA*
Ga0099822_1010643203300006943Root NodulesMRLAYRTSSRMRDRATIRGAYLVKRGWRGSRGRVSGWGGCGVGLAVVAA*
Ga0099822_1013541133300006943Root NodulesVVLRGGGMRSACRTSLRMRDRATVRGAYLVKRGWRGLRGRVSGRGGCGVGLAVVAA*
Ga0099822_101514853300006943Root NodulesVILCGGGMRSACRASSRMRDRATVRRAYLVKRGWQGSRGRVSGRGGCGVGLAVVAA*
Ga0099822_101941053300006943Root NodulesVVVLRGGGIRSACRASSRMRERAMVRGAYLVKRGWRGSRGRVSGRGLGCGVGLAVVAA*
Ga0099822_102502143300006943Root NodulesMRSACRASSRMRDRATVRGAYLVKRGWRGSRGRVSGRGGCGVGLAEVGA*
Ga0099822_102886353300006943Root NodulesMRSAYRASSRMRERATIRGAYMVKRGWRGSRGQVSGRGGCGVGLAVLAA*
Ga0099822_103015763300006943Root NodulesMSSACRASTRRRERAIVRGAYLVKRGWQGSRGRVSGQGGCGVGLAEVVA*
Ga0099822_103137143300006943Root NodulesMRSACRASSRMRERATVRGAHLVKRGCQGSRGRVSGRGGCRVGLAVVAA*
Ga0099822_103292443300006943Root NodulesLVISALGGVVVLRGGGIRSACRASSRMQERATVRGAYLVKRGWRGSRGQVSGRGLGCGVGLAVVAA*
Ga0099822_103964163300006943Root NodulesMSALGGVVVLRGGGIRSACRASSRMRERATVRGAYLVKRGWRGSRGRASGRGGCGVGLAVVAA*
Ga0099823_1004465183300006944Root NodulesLVISALGGVVVLRGEGIRSACRASLRMRERATVRGAYLVKRGWRGSRGRASGHGLGCGVGLAVVAA*
Ga0099823_101025243300006944Root NodulesMRSTCRASSRMRERATVRGAYLVKRGWKGSHGRVSGRGGCGLGLAMVAV*
Ga0099823_102885443300006944Root NodulesMRSVCKASSRMRERATVRGAYLVKRSWRGSRGPVLERGGCGVGLAVVTA*
Ga0099823_103214263300006944Root NodulesLVISALGGVVVLRGGGIRSACRALSRMRERATVRGEYLVKRGWRGSRGRVSRRGLGFGVGLAVVAA*
Ga0214544_1000332183300021320Root NodulesMRSACRASSRMQERATVRGAYRVKRGWRGSRGRVSGQGGCGVGLVVVAA
Ga0214544_1000444563300021320Root NodulesVVVLRGGGIRSACKASSRMRERDTVRGAYLVKRDWRGSCGRVSGRGGGGVGLAVVAA
Ga0214544_100058373300021320Root NodulesLVISALGGVVVLRGGGIRSACRASSRMRERATMRGAYLVKRGWRGSRGRVSGRGLGSGVGLAVVAA
Ga0214544_1000980323300021320Root NodulesVVLHGRGMRSVCRVSSRMRNRVTVRGAYLVKRGWRGSRGRVSGRGGCGLGLAGVAA
Ga0214544_1001622233300021320Root NodulesMRGGGMRSACRASSRMRDRAIIRGVYLVKRGWRGSRGRVSGQGGCGVGLAVVAA
Ga0214544_100203193300021320Root NodulesLVISALGGVVVLHGGGIRSACRASSRMRERATVRGAHMVKRGWRGSRGRVSGRGLGCGVGLAVVAA
Ga0214544_100206273300021320Root NodulesMRSTCRASSRMRERATVRGAYLVKRGWKGSHGRVSGRGGCGLGLAMVAV
Ga0214544_1002408243300021320Root NodulesVLRGRGIRSACKASSRMRERATIRGAYLVKRGWRGLRGRASGRGLGCGVGLAVVDA
Ga0214544_1002705253300021320Root NodulesMRSACRVSSRMRDRAIVRGAYLVKRGWRGSRGRVSGQGGCGVGLAVVVA
Ga0214544_1003467233300021320Root NodulesVVLRGGGMRSACRASSRMRDRVTVRGAYLVKRGWGGSRGRVSGRGGCGVGLAVVAA
Ga0214544_1003491113300021320Root NodulesLVISALGGVVVLRGGGIRSACRASSRMQERATVRGAYLVKRGWRGSRGQVSGRGLGCGVGLAVVAA
Ga0214544_1003744163300021320Root NodulesMRSACRASLRMRDRATVRGAYLVKRGRRGSRGRVSERGGCGVELAVVAA
Ga0214544_1004182183300021320Root NodulesMRSACRASSRMRERATIRGAYLVKWGWRGSCGQVSGRGGCGVGLAVVAA
Ga0214544_1004504263300021320Root NodulesMRSACRASSRMRDRATVRGAYLVKRGWRGSRGRVSGRGGCGVGLAEVGA
Ga0214544_1005134293300021320Root NodulesMRSACRASSRMQDRATIRRAYLVKRGWRGSRGRVSGRGGCGVGLAVVAA
Ga0214544_100546533300021320Root NodulesLVISALGGVVVLRGGGIRSACSASSRMRERATVRGAYMVKRGWQGSRGQASGRGLGCGVGLAVVVA
Ga0214544_1005617383300021320Root NodulesMSALGGVVVLRGGGIRSACRASSRMRERATVREAYLVKRGWRGSRGRASGRGGCGVGLAVVAA
Ga0214544_1006466253300021320Root NodulesMRSACRASLRRRDRATVRGAYMVKRGWRGSRRRVSGRWGCGVGLAEVVA
Ga0214544_1006548153300021320Root NodulesVVLRGGGMRSACRASSRMRDRATVRGAYLVKRGWRGSHGRVSGRGGCGVGLTVVAA
Ga0214544_1007191223300021320Root NodulesMSALGGVVVLCGGGIRSACRASSRMRERATVRGAYLVKRGWRGSRGRASGQGGCGVGLAVVAA
Ga0214544_100731373300021320Root NodulesMRSACRGSSRMREQATVRGAYLVKRGWRGSHGRVSERGGCGVGLAVVAA
Ga0214544_1007617293300021320Root NodulesLVISALGGVVVLRGGGIRSACRASSRMWEWATVRGAYLVKRGWRGSRGRASGRELGCEVGLAVAAT
Ga0214544_100765173300021320Root NodulesLVISALGGVVVLRGGGIRSACRASSRMRERATVRAAYLVKRGWRGSRGRVSGRGLGCGVGLAVVAT
Ga0214544_100805143300021320Root NodulesLVISALGGVVVLRGGGIRSACRASSRMRERATVRGAYLVKRGWRGSHGRVSGRGLGCGVGLAVVAA
Ga0214544_1008348163300021320Root NodulesVVLRGGGMRSACRASSKMRDRATVREAYLVKRAWRGSRGRVSGRGGCGVGLAVVVA
Ga0214544_100900473300021320Root NodulesMRSVCKASSRMRERATVRGAYLVKRSWRGSRGPVLERGGCGVGLAVVTA
Ga0214544_100924483300021320Root NodulesMSALGGMVVLRGGGIRSAWRASSRMRERAYVRGAYLVKRGWRGSRGRVSGRGLGCGVGLEVVAA
Ga0214544_1009798163300021320Root NodulesLVISALGGVVVLRGGGIRSACRASSRMRKRATIRGVYLVKRGWRGSRGRVLGCGLGCGVGLAVVVA
Ga0214544_100997683300021320Root NodulesMSTLGGVVVLRGGGIRSASRASPRIRERATVKGVYLVKRGWRGSRGRVSGRGLGCGVGLAVVAA
Ga0214544_1010016233300021320Root NodulesVVLRGGGMRSACRVSSRMRDRATVRGAYLVKRGWQGSRGRVSGQGGCGVGWEVVAA
Ga0214544_101087483300021320Root NodulesMLALGGVVVLRGGGIRSACRASSRMLERSTVRRAYLVKRGWRGSRGSASRWGGCGVGLAVVAT
Ga0214544_101178073300021320Root NodulesMRSACRASSRMRERATVREAYLVKQGWRGSCGWVSGWGGCGVGLAVVAA
Ga0214544_1011883143300021320Root NodulesVVLRGGGMRSACRTSLRMRDRATVRGAYLVKRGWRGLRGRVSGRGGCGVGLAVVAA
Ga0214544_1012277153300021320Root NodulesLVISALGGVVVLRCGGIRSACRASSRMREQATVRGAYLVKRGWRGSRGRVSGRGLGCGVGLAVLAA
Ga0214544_101243163300021320Root NodulesLVISALGGVVVLRGGGIRSACRALSRMRERATVRGEYLVKRGWRGSRGRVSRRGLGFGVGLAVVAA
Ga0214544_1012701183300021320Root NodulesMRSACRASSRMRDRATVRGAYLVKRGWRSSRGRVSGRGGYGVGLAVVAA
Ga0214544_101272083300021320Root NodulesMRSTCRASSRMRERATVRGAHLVKRGWRGSHGWVSRRAGCGVGFAEVVA
Ga0214544_101276353300021320Root NodulesMRSACRASSRMRDRATVRGEYLVKRGWRGSRGRVSGKGGCGVGLAVVAA
Ga0214544_1013717113300021320Root NodulesMSTLGGVVVLRGGGIRLAWRASSRMRERATGRGAYLVKRGWRGSRGRVSGRGLGCGLGCGVGLAGVAA
Ga0214544_101381473300021320Root NodulesMSALGGVIVLRGGGIRSTWRASSRMRERATVMGAYLVKRGWRGSRERVSGRGLGYGLGCGVGLAGVAA
Ga0214544_101398623300021320Root NodulesLVISALGGVVVLRGGGIRSACRASSRMRERATVRRAYLVKRGWRGSRGRVSGRGLGYGVGFAVVVA
Ga0214544_1014095103300021320Root NodulesVILCGGGMRSACRASSRMRDRATVRRAYLVKRGWQGSRGRVSGRGGCGVGLAVVAA
Ga0214544_1014507113300021320Root NodulesMSSACRASTRRRERAIVRGAYLVKRGWQGSRGRVSGQGGCGVGLAEVVA
Ga0214544_101582573300021320Root NodulesVVVLRGGGIRSACRASSRMRERAMVRGAYLVKRGWRGSRGRVSGRGLGCGVGLAVVAA
Ga0214544_1015915163300021320Root NodulesMLALGGVVVLRGGGIRSAWRASSSIQERATVRGAYLVKRGWRGLRGWGSGRGLGCRVGLAVVAA
Ga0214544_101601143300021320Root NodulesGIRSAWRASSRMRERATVRGAYLVKRGWRGSRGRVSGRGLGCGVGLEVVAA
Ga0214544_101697523300021320Root NodulesMSALGGVVVLRGGGIRSAWRAPSRMRERATMRGAYLVKRGWRGSRGWVSGRGLGCGVGLEVVAA
Ga0214544_102094853300021320Root NodulesMRSAYRASSRMRERATIRGAYMVKRGWRGSRGQVSGRGGCGVGLAVLAA
Ga0214544_102339323300021320Root NodulesMSALGGVVVLRGGGIRSAWRASSRMRERATVRGAYLVKRGWRGSRGRVSGRGLDCGVGLEVVAA
Ga0214542_100377713300021321Root NodulesVVVLRGGGIRSACRASSRMQERATVRGAYLVKQGWRGSRGRASRQGGCGVGLAVVVA
Ga0214542_100442073300021321Root NodulesLVISALGGVVVLRGGGIRSACRASSRIRERATIRGAYMVKRGWRGSRGRVSGRGLGFGVGLAVVAA
Ga0214542_100754233300021321Root NodulesLVISALRGVVVLRGGGIRSTCRASSRMRERAMVRGAYMVKRGSRGSRGRVSGRGLGCGVRLAVVAA
Ga0214542_100785863300021321Root NodulesVLGGVIVLRGGGMRSACRASSRMRERATVRGAYLVKRGWQGSRGRVSGRGGCGVGLAVVA
Ga0214542_101111863300021321Root NodulesMRLAYRTSSRMRDRATIRGAYLVKRGWRGSRGRVSGWGGCGVGLAVVAA
Ga0214542_101143643300021321Root NodulesMLALGGVVILRGGGIKSAWRASSRMRERATVRGAYLVKRGWRGSRGRVSGRG
Ga0214542_101544083300021321Root NodulesMSALGGVVVLRGGGIRSAWRASSRMRERATVRGAYLVKRGWRGSRGRVSGRGLGCGVGLEVVAA
Ga0214542_102280943300021321Root NodulesMSALGGVVVLRGGGIRSACRASSRMRERATVRGAYLVKRGWRGSRGRASGRGGCGVGLAVVAA
Ga0214545_1000668503300021324Root NodulesVVVLRGGGIRSACRASSRMRERATVRGANLVKRGWRGLRGRVSGRGLGCGVGLAVVAA
Ga0214545_1004345233300021324Root NodulesLVISALGGVVVLRGEGIRSACRASLRMRERATVRGAYLVKRGWRGSRGRASGHGLGCGVGLAVVAA
Ga0214545_100501263300021324Root NodulesMSALGGVVVLRGGGIKSAWRASPRMRERATVRGAYLVKRGWRGSRGRVSGCGLGCGVGLEVVAA
Ga0214545_1005109113300021324Root NodulesMSVLGGVVVLRGGGIRSACRASSRMRERAMVRGAYLVKRGWRGSRGRVSGRGGCGVGLAVVAA
Ga0214545_100609343300021324Root NodulesMSTLGGVVVLRGGGIRSTCRASSRMRERATVRGAYLVKQGWRGSRGRASGRGGCEVGLAVVAA
Ga0214545_101216473300021324Root NodulesLVISTLGGVVVLRGGGIKSTCRASSRMRERATVRGAYLVKRGWRGSCGRVSRRGLGCGVGLAVVAA
Ga0214545_101295793300021324Root NodulesLVISALGGVVVLRGGGIRSACRSSSRMRERATVRGAYLVKRGWRGSRGRVSGRGLGCGVGLAVVAA
Ga0214545_101555933300021324Root NodulesMAALGGVVVLRGGGIRSAWRASSRMREQATVRGAYLVKRGWRGSRGRVSGRGLGYGVGLELVAA
Ga0214545_101568823300021324Root NodulesMSALGGVVVLRGGGIRSAWRASSRMRERAIVRGAYLVKRGWRGSRGQVSGRGLGCGVGLEVVAA
Ga0214545_101899813300021324Root NodulesYLVMSALGGVVVLRGGGIRSAWRASSRMRERATVRGAYLVKRGWRGSRGRVSGRGLDCGVGLEVVAA
Ga0214545_101999663300021324Root NodulesMSALEGVVVLRGGGIRSAWRASSRMRERATMRGAYLVKRGWRGSRGRVSGCGLGCGVGLEVEAA
Ga0214545_102053813300021324Root NodulesVLRGGGIRSAWRASSRMRERATVRGAYLVKRGWRGSRCGYQLRGLGCGVGLEVVAV
Ga0214545_102378063300021324Root NodulesMSALGGVVVLRGGGIRSACRASSRMRERATVRGAYMVKRGRQASRWRASGRGGCGVGLAVVAA
Ga0214545_103598843300021324Root NodulesMSALGGVVFLRGGGIRSAWRASSRMRERATVRGAYLVKRGWRGSRGRVSGRGLGCGVGLEVVA
Ga0214543_1000338573300021327Root NodulesMRSACKASSRMRDRATVRGAYLVKQGWRGSRGRISGRGACGVGLAVVAA
Ga0214543_1000513333300021327Root NodulesMSALGDVVVLRGGGIRSAWRASSRMREQATVKGAYLVKRGWRGSRERVSGRGLGCGLGLVGVAA
Ga0214543_100946073300021327Root NodulesLVISALGGVVVLRGGGIRSACRASSRIREQATVRGAYLVKRGWRGSCGRVSRRGLGCGVGLAVVAA
Ga0214543_1014298123300021327Root NodulesMSALGGVVVLRGGGIRLAWRTSSRMRERATVRRAYLVKRGWRGSRGRVSGRGLGCGVGLELVAA
Ga0214543_102850743300021327Root NodulesVLRGGGIRSACRASSRMRERATVRGAYLVKRGWRGSRGRASGRGGCGVGLAVVAA
Ga0214543_103016153300021327Root NodulesMSVLGGVVVLRGRGIRSGWRASSRMRERATVRGAYLVKRGWRGSRGRVSGRGLGCVVGLA
Ga0209389_100376713300027296Root NodulesVISALGGVVVLRGGGIRSACRASSRMRERATVRGAYLVKRGWWGSRGWVSRCGLGCGVGLAVVAA
Ga0209389_102897893300027296Root NodulesMKSACRASSRRRDRATVRGAYLVKRGWRGSRGRVSGRGAFGVGLAEVAA
Ga0209389_105454813300027296Root NodulesLGGVVVLRGGGIRSACRASSRMRERATVRGAYLVKRGWRGSRGRASGRGGCGVGLAVVAA
Ga0209389_105772313300027296Root NodulesVVLRGGGIRSACRASSRMREQATVRGAYLVKRGWWGSRGRASERGLGCGVGLAVVAA
Ga0209589_1004268213300027357Root NodulesMSALGGVVVLRGGGIRSACRASSRMRKRATVRGAYLVNRGWWGSRGRVSGQGGCGVGLVVMAA
Ga0209589_102107143300027357Root NodulesMRSACRASSRMRERATVRGAHLVKRGCQGSRGRVSGRGGCRVGLAVVAA
Ga0209589_102534853300027357Root NodulesGGGIRSAWRASSRMRERATVRGAYLVKRGWRGSRGRVSGRGLGCGVGLEVVAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.