NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F089947

Metagenome Family F089947

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089947
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 40 residues
Representative Sequence MCSVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKEL
Number of Associated Samples 7
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 87.74 %
% of genes near scaffold ends (potentially truncated) 28.70 %
% of genes from short scaffolds (< 2000 bps) 22.22 %
Associated GOLD sequencing projects 6
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.296 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules
(63.889 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(100.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 29.27%    Coil/Unstructured: 70.73%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00078RVT_1 12.26
PF00665rve 5.66
PF03732Retrotrans_gag 4.72
PF00098zf-CCHC 2.83
PF07727RVT_2 2.83
PF01247Ribosomal_L35Ae 1.89
PF00069Pkinase 1.89
PF13976gag_pre-integrs 1.89
PF03108DBD_Tnp_Mut 0.94
PF03004Transposase_24 0.94
PF01535PPR 0.94
PF08284RVP_2 0.94
PF12171zf-C2H2_jaz 0.94
PF13456RVT_3 0.94
PF13650Asp_protease_2 0.94
PF04195Transposase_28 0.94
PF14214Helitron_like_N 0.94
PF08263LRRNT_2 0.94
PF00538Linker_histone 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 7.55
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 5.66
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 5.66
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 5.66
COG4584TransposaseMobilome: prophages, transposons [X] 5.66
COG2451Ribosomal protein L35AE/L33ATranslation, ribosomal structure and biogenesis [J] 1.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.22 %
UnclassifiedrootN/A2.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006943|Ga0099822_1001837All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna25521Open in IMG/M
3300006943|Ga0099822_1002354All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata23465Open in IMG/M
3300006943|Ga0099822_1002391All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata23318Open in IMG/M
3300006943|Ga0099822_1003964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna19147Open in IMG/M
3300006943|Ga0099822_1008517All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata13102Open in IMG/M
3300006943|Ga0099822_1009854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata11951Open in IMG/M
3300006943|Ga0099822_1010931All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata11188Open in IMG/M
3300006943|Ga0099822_1015038All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8765Open in IMG/M
3300006943|Ga0099822_1017461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max7663Open in IMG/M
3300006943|Ga0099822_1018061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta7409Open in IMG/M
3300006943|Ga0099822_1018216Not Available7346Open in IMG/M
3300006943|Ga0099822_1018400All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7277Open in IMG/M
3300006943|Ga0099822_1022018All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata6077Open in IMG/M
3300006943|Ga0099822_1023630All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5625Open in IMG/M
3300006943|Ga0099822_1028127All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4540Open in IMG/M
3300006943|Ga0099822_1031388All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3903Open in IMG/M
3300006943|Ga0099822_1031432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3896Open in IMG/M
3300006943|Ga0099822_1032305All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max3739Open in IMG/M
3300006943|Ga0099822_1035335All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3244Open in IMG/M
3300006943|Ga0099822_1036404All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3093Open in IMG/M
3300006943|Ga0099822_1037461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2950Open in IMG/M
3300006943|Ga0099822_1039463All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2703Open in IMG/M
3300006943|Ga0099822_1042023All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2417Open in IMG/M
3300006943|Ga0099822_1044304All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2208Open in IMG/M
3300006943|Ga0099822_1045064All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2141Open in IMG/M
3300006943|Ga0099822_1045812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2080Open in IMG/M
3300006943|Ga0099822_1045872All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2075Open in IMG/M
3300006943|Ga0099822_1051852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1661Open in IMG/M
3300006943|Ga0099822_1053078All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1590Open in IMG/M
3300006943|Ga0099822_1053396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1573Open in IMG/M
3300006943|Ga0099822_1055978All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1448Open in IMG/M
3300006943|Ga0099822_1057186All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1395Open in IMG/M
3300006943|Ga0099822_1059774All Organisms → Viruses → Predicted Viral1291Open in IMG/M
3300006943|Ga0099822_1060205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1275Open in IMG/M
3300006943|Ga0099822_1062450All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1200Open in IMG/M
3300006943|Ga0099822_1062766All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1190Open in IMG/M
3300006943|Ga0099822_1067208All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1060Open in IMG/M
3300006943|Ga0099822_1081915All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata783Open in IMG/M
3300006943|Ga0099822_1093928All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata650Open in IMG/M
3300006943|Ga0099822_1102021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata587Open in IMG/M
3300006943|Ga0099822_1103836All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata575Open in IMG/M
3300006944|Ga0099823_1003237All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata15285Open in IMG/M
3300006944|Ga0099823_1010755All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata9288Open in IMG/M
3300006944|Ga0099823_1010901All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta9223Open in IMG/M
3300006944|Ga0099823_1011493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8964Open in IMG/M
3300006944|Ga0099823_1011980All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae8787Open in IMG/M
3300006944|Ga0099823_1023599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5623Open in IMG/M
3300006944|Ga0099823_1033565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4115Open in IMG/M
3300006944|Ga0099823_1044692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max2992Open in IMG/M
3300006944|Ga0099823_1046999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2807Open in IMG/M
3300006944|Ga0099823_1050320All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2569Open in IMG/M
3300006944|Ga0099823_1069025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1616Open in IMG/M
3300006944|Ga0099823_1076840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1366Open in IMG/M
3300006944|Ga0099823_1077455All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1350Open in IMG/M
3300006944|Ga0099823_1086254All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1132Open in IMG/M
3300006944|Ga0099823_1128291All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata621Open in IMG/M
3300006944|Ga0099823_1130060All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata610Open in IMG/M
3300021320|Ga0214544_1000926All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata57937Open in IMG/M
3300021320|Ga0214544_1000926All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata57937Open in IMG/M
3300021320|Ga0214544_1005101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata25795Open in IMG/M
3300021320|Ga0214544_1005382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata24835Open in IMG/M
3300021320|Ga0214544_1005722All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae23761Open in IMG/M
3300021320|Ga0214544_1005784All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata23566Open in IMG/M
3300021320|Ga0214544_1006673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta21023Open in IMG/M
3300021320|Ga0214544_1007744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata18518Open in IMG/M
3300021320|Ga0214544_1009465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata15236Open in IMG/M
3300021320|Ga0214544_1010623All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata13393Open in IMG/M
3300021320|Ga0214544_1011910All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta11708Open in IMG/M
3300021320|Ga0214544_1013129All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata10274Open in IMG/M
3300021320|Ga0214544_1013968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata9353Open in IMG/M
3300021320|Ga0214544_1014064All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae9264Open in IMG/M
3300021320|Ga0214544_1017831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6174Open in IMG/M
3300021320|Ga0214544_1018392All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta5818Open in IMG/M
3300021320|Ga0214544_1019143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5364Open in IMG/M
3300021320|Ga0214544_1019772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5022Open in IMG/M
3300021320|Ga0214544_1021170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4337Open in IMG/M
3300021320|Ga0214544_1021607All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4147Open in IMG/M
3300021320|Ga0214544_1021607All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata4147Open in IMG/M
3300021320|Ga0214544_1024323All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3166Open in IMG/M
3300021320|Ga0214544_1024642All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3074Open in IMG/M
3300021320|Ga0214544_1027837All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Cajanus → Cajanus cajan2291Open in IMG/M
3300021320|Ga0214544_1029181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2064Open in IMG/M
3300021320|Ga0214544_1038478All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1135Open in IMG/M
3300021321|Ga0214542_1003619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna31329Open in IMG/M
3300021321|Ga0214542_1005635All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata23608Open in IMG/M
3300021321|Ga0214542_1008771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata16325Open in IMG/M
3300021321|Ga0214542_1010112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae14032Open in IMG/M
3300021321|Ga0214542_1014606All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8670Open in IMG/M
3300021321|Ga0214542_1039004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1276Open in IMG/M
3300021324|Ga0214545_1007922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata17372Open in IMG/M
3300021324|Ga0214545_1009205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata15176Open in IMG/M
3300021324|Ga0214545_1015041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max8671Open in IMG/M
3300021324|Ga0214545_1015723All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8134Open in IMG/M
3300021324|Ga0214545_1020611All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata5207Open in IMG/M
3300021327|Ga0214543_1015673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata8281Open in IMG/M
3300027296|Ga0209389_1002621All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta13964Open in IMG/M
3300027296|Ga0209389_1005182All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata11039Open in IMG/M
3300027296|Ga0209389_1005715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata10654Open in IMG/M
3300027296|Ga0209389_1012013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata7845Open in IMG/M
3300027296|Ga0209389_1036973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3900Open in IMG/M
3300027296|Ga0209389_1037235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata3876Open in IMG/M
3300027296|Ga0209389_1050816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max2870Open in IMG/M
3300027296|Ga0209389_1050980All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2860Open in IMG/M
3300027296|Ga0209389_1056462All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata2552Open in IMG/M
3300027296|Ga0209389_1073110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1826Open in IMG/M
3300027296|Ga0209389_1075641All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata1736Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Root NodulesHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules63.89%
Root NodulesHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules36.11%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006943Root nodule microbial communities of legume samples collected from California USA - Cow pea white BWHost-AssociatedOpen in IMG/M
3300006944Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BWHost-AssociatedOpen in IMG/M
3300021320Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3Host-AssociatedOpen in IMG/M
3300021321Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1Host-AssociatedOpen in IMG/M
3300021324Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4Host-AssociatedOpen in IMG/M
3300021327Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2Host-AssociatedOpen in IMG/M
3300027296Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0099822_1001837203300006943Root NodulesMCLVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKEL*
Ga0099822_100235413300006943Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVITCVGRTMGK
Ga0099822_100239113300006943Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMMIACVGRTMGKE
Ga0099822_100396443300006943Root NodulesMMGMELVEFSLATNGRGVLSMVIACVERTMGKEL*
Ga0099822_1008517283300006943Root NodulesMCLVVGHMMSMELVEFPLATNGRGVLSMVIACVGRTMDKEL*
Ga0099822_1009854193300006943Root NodulesMCSVVGHMMSMELVGFPSATNGRGVLSMVIACVGRTMDKEL*
Ga0099822_101093163300006943Root NodulesMCLMVGHMMGMELVEFPSATNGRGVLGMVITYVERTMGKEL*
Ga0099822_101503893300006943Root NodulesMCSVVGHMMGMKLVEFPLATNGRGVLSMVIACVGRTMKKEL*
Ga0099822_1017461113300006943Root NodulesMCSVVRHMMGMELVEFPLATIGRGILSMVIACVGCTMGKEL*
Ga0099822_1018061133300006943Root NodulesMCLVVGHMMGMELVEFPSATNGRGVLSMVITCVGRTMGK
Ga0099822_1018216133300006943Root NodulesMCLVVGHMMGMELVEFPSATNGRGVLSMVIACVGCTMGKEL*
Ga0099822_1018400103300006943Root NodulesMCSVVGHMMGMELVEFPPATIGRGVLSMVIACVGRTMGKEL*
Ga0099822_102201843300006943Root NodulesMCLVVGHMMGMELVEFPLATNGRGILSMVIACVGRTMGKEL*
Ga0099822_102363013300006943Root NodulesMCLMVGHMMGMELVEFPLATNMRGVLGMVITCVGRTMGKEL*
Ga0099822_102812733300006943Root NodulesMFSEVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKEL*
Ga0099822_103138843300006943Root NodulesMCSVVGHMMGMELVEFPLATNGRGVLSMVIACVGRTMGKEL*
Ga0099822_103143233300006943Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVELTMGKEL*
Ga0099822_103230513300006943Root NodulesMMGMELVEFPSATNGRGVLSMVIACVGRMMGKKL*
Ga0099822_103533533300006943Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLNMVIACVGRTMGKEL*
Ga0099822_103640443300006943Root NodulesMCSVVGHMMGMELVEFPSANIGRGVLSMVIACVGRTIGKEL*
Ga0099822_103746183300006943Root NodulesMCSVVGHMMGMELVEFPSATIGRGVLSIVIACVGRTMGKEL*
Ga0099822_103946333300006943Root NodulesMCSEVGHMMGMELVEFLSTTNGRGVLSMVIACVGRMMGKEL*
Ga0099822_104202323300006943Root NodulesMCSVSGHMMGMKLVEFPLATNGRGVLGMVIACVGRTMDKEL*
Ga0099822_104430433300006943Root NodulesMYSVVGHMMGMELVEFPSATNGRGVLSMVIACVGCTMGKEL*
Ga0099822_104506453300006943Root NodulesGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKEL*
Ga0099822_104581213300006943Root NodulesMCSVVGHMMGMELVEFPSATIGRGVLSMVIACVERTMGKEL*
Ga0099822_104587213300006943Root NodulesMCSVGGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKEL*
Ga0099822_105185243300006943Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVGR
Ga0099822_105307813300006943Root NodulesMCSEVGNMMGMELVEFPSATNGRGVLSMVIACVGRMMGKEL*
Ga0099822_105339613300006943Root NodulesMCLVVGHMMGMELVEFPSATNGRGILSMGIACVRSTMGKEL*
Ga0099822_105597813300006943Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVTACVGRTMGKEL*
Ga0099822_105718633300006943Root NodulesMCSVVGHMMGMELVEFPSATIGRGVLSMVIACVGRMMGKEL*
Ga0099822_105977443300006943Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVGHTIGKEL*
Ga0099822_106020523300006943Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGK
Ga0099822_106245023300006943Root NodulesMCSVVGHMMGMELVEFPLATNGREVLSMVIACVGRTMGKEL*
Ga0099822_106276613300006943Root NodulesMCLVVGHMMGMELVEFPLATNGRGVLSIVIACVGRTMGKEL*
Ga0099822_106720813300006943Root NodulesMCLVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGK
Ga0099822_108191523300006943Root NodulesMCSVVGHMMGMELVEFPSATIGRGVLSMMIACVGRTMGKEL*
Ga0099822_109392813300006943Root NodulesGMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKEL*
Ga0099822_110202113300006943Root NodulesMCSEVGHMMGMELVEFPLANNGRGVLSMVIACVRRTMGKEL*
Ga0099822_110383613300006943Root NodulesMCSEVGHMMDMELVEFPSATNGRGVLSMVIACVGRTMGKKL*
Ga0099823_1003237153300006944Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVGCMMGKEL*
Ga0099823_1010755203300006944Root NodulesMCLVVGHMMGMELVEFPSATNGRGVLSMVITCVGR
Ga0099823_1010901193300006944Root NodulesEVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKKL*
Ga0099823_101149313300006944Root NodulesMMSMELVGFPSATNGRGVLSMVIACVGRTMDKEL*
Ga0099823_101198013300006944Root NodulesMCLGVGHMMSMELVEFPFPSATNGRGVLSMVITCVGRTMG
Ga0099823_1023599133300006944Root NodulesMCLMVGHMMGMELVEFPLATNRRGVLGMVITCVGRTMGKEL*
Ga0099823_103097213300006944Root NodulesMCSVVRHMMGMELVEFPSATIGRGILSMVIACVGCTMGKEL*
Ga0099823_103356523300006944Root NodulesMCLVGGHMMGMELIEFPSATNGRGVLSMVIACVGRTMGKEL*
Ga0099823_104469213300006944Root NodulesMMGMKLVEFPLATNGRGVLSMVIACVGRTMKKEL*
Ga0099823_104699953300006944Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMMIACVGRTMGKEL*
Ga0099823_105032023300006944Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVRRTMGKEL*
Ga0099823_106902513300006944Root NodulesHIMGMELVEFPSATNGRGVLSMVIACVGRTMGKKL*
Ga0099823_107684013300006944Root NodulesMCSVVGHIMGMELVEFPSATNGRGVLSMVIACVGRTMGKKL*
Ga0099823_107745513300006944Root NodulesMCLVVGHMMGMELVEFPSATNGRGVLSMVITCVGRTMGKELLCSRR
Ga0099823_108625413300006944Root NodulesVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKEL*
Ga0099823_112829123300006944Root NodulesGHMMGMELVEFPSATNGRGVLSMVIACVGHTIGKEL*
Ga0099823_113006013300006944Root NodulesMCLVVGHMMGMELVEFPSATNGRGVLSMVITCVGRTMGKE
Ga0214544_1000926183300021320Root NodulesMCSVVGHMMGMELVEFPPATIGRGVLSMVIACVGRTMGKEL
Ga0214544_1000926283300021320Root NodulesMCSVVGHMMGMELVEFPSATIGRGVLSMVIACVGRMMGKEL
Ga0214544_1005101213300021320Root NodulesMCLVVGHMMSMELVEFPLATNGRGVLSMVIACVGRTMDKEL
Ga0214544_1005382183300021320Root NodulesMCSVVGHMMGMKLVEFPLATNGRGVLSMVIACVGRTMKKEL
Ga0214544_1005722263300021320Root NodulesMCLVVGHMMGMELVEFPSATNGRGILSMGIACVRSTMGKEL
Ga0214544_100578443300021320Root NodulesMCLMVGHMMGMELVEFPSATNGRGVLGMVITYVERTMGKEL
Ga0214544_1006673253300021320Root NodulesMCSVVGHMMGMELVEFPSANIGRGVLSMVIACVGRTIGKEL
Ga0214544_100774453300021320Root NodulesMYSVVGHMMGMELVEFPSATNGRGVLSMVIACVGCTMGKEL
Ga0214544_1009465123300021320Root NodulesMCLVVGHMMGMELVEFPSATNGRGVLSMVIACVGRMMGKKL
Ga0214544_1010623133300021320Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKEL
Ga0214544_101191013300021320Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVTACVGRTMGKEL
Ga0214544_1013129103300021320Root NodulesMCSVVGHMMGMELVEFPSATIGRGVLSMMIACVGRTMGKEL
Ga0214544_1013968133300021320Root NodulesMCLVVGHMMGMELVEFPSATNGRGVLSMVIACVGR
Ga0214544_101406453300021320Root NodulesMYSVVGHMMGMELVEFPSATNGRGVLSMVITCVERTMGKEL
Ga0214544_101783143300021320Root NodulesSVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKEL
Ga0214544_101839243300021320Root NodulesMCSVSGHMMGMKLVEFPLATNGRGVLGMVIACVGRTMDKEL
Ga0214544_101914333300021320Root NodulesMCLVVGHMMGMELVEFPSATNGRGVLSMVIACVGCTMGKEL
Ga0214544_101977243300021320Root NodulesMCSEVGNMMGMELVEFPSATNGRGVLSMVIACVGRMMGKEL
Ga0214544_102117013300021320Root NodulesMCSVGGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKEL
Ga0214544_102160713300021320Root NodulesMCSVIGDMMGMESVEFPSATNGRGVLGMVIACVGRMMGKEL
Ga0214544_102160733300021320Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVGHTIGKEL
Ga0214544_102432323300021320Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVRRTMGKEL
Ga0214544_102464273300021320Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVITCVGRTMGKEL
Ga0214544_102783733300021320Root NodulesMCSVGGHMMGMELVEFPSATNGRGVLSMVIACVGHTIGKEL
Ga0214544_102918113300021320Root NodulesMCLVVGHMMGMELVEFPLATNGRGVLSIVIACVGRTMGKEL
Ga0214544_103847813300021320Root NodulesVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKEL
Ga0214542_1003619223300021321Root NodulesMCSVVGHMMGMELVEFPLATNGREVLSMVIACVGRTMGKEL
Ga0214542_100563513300021321Root NodulesVGHMMGMELVEFPSATNGRGVLSMVITCVGRTMGKEL
Ga0214542_100877183300021321Root NodulesMCSVVGHMMSMELVGFPSATNGRGVLSMVIACVGRTMDKEL
Ga0214542_1010112183300021321Root NodulesMCLVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKE
Ga0214542_1014606103300021321Root NodulesMCSVVGHMMGMELVEFPSVNIGRGVLSMVIACVERTMGKEL
Ga0214542_103900413300021321Root NodulesLVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKEL
Ga0214545_100792283300021324Root NodulesMCSVVGHMMGMELVEFPSATNRRGVLSMVIACVGRTMGKQL
Ga0214545_100890233300021324Root NodulesMCSVVGHMMGMELVEFPSATIGRGVLSMVIACVERTMGKEL
Ga0214545_100920513300021324Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVGRT
Ga0214545_101504113300021324Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVTACVGRTMGK
Ga0214545_1015723113300021324Root NodulesMCLVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKEL
Ga0214545_102061133300021324Root NodulesMCSVVGHMMGMELVEFPSATIGRGVLSIVIACVGRTMGKEL
Ga0214543_101567313300021327Root NodulesVCLVVGHMMGMELVEFPSATNGRGVLSMVIACVGRMMGKKL
Ga0209389_1002621133300027296Root NodulesMCLEVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKKL
Ga0209389_100518243300027296Root NodulesMCLVGGHMMGMELIEFPSATNGRGVLSMVIACVGRTMGKEL
Ga0209389_1005715133300027296Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVGCMMGKEL
Ga0209389_101201363300027296Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLNMVIACVGRTMGKEL
Ga0209389_103697333300027296Root NodulesMCSVVGHMMGMELVEFPLATNGRGVLSMVIACVGRTMGKEL
Ga0209389_103723523300027296Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMDKEVLCS
Ga0209389_105081613300027296Root NodulesMCLVVGHMMGMELVEFPLATNGRGILSMVIACVGRTMGKEL
Ga0209389_105098033300027296Root NodulesMCSVVGHMMGMELVEFPSATNGRRVLSMVITCFGRTMGMEM
Ga0209389_105646213300027296Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMG
Ga0209389_107311013300027296Root NodulesVVGHMMGMELVEFPSATNGRGVLSMVIACVGRMMGKKL
Ga0209389_107564113300027296Root NodulesMCSVVGHMMGMELVEFPSATNGRGVLSMVIACVGRTMGKE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.