| Basic Information | |
|---|---|
| Family ID | F089915 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 108 |
| Average Sequence Length | 48 residues |
| Representative Sequence | ANAFLLSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFANPTNE |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.04 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (28.704 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.481 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.481 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.11% β-sheet: 0.00% Coil/Unstructured: 57.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF12684 | DUF3799 | 89.81 |
| PF02511 | Thy1 | 3.70 |
| PF00436 | SSB | 1.85 |
| PF12705 | PDDEXK_1 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 3.70 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 1.85 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 1.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.07 % |
| Unclassified | root | N/A | 0.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109350570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 706 | Open in IMG/M |
| 3300002408|B570J29032_109644997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 984 | Open in IMG/M |
| 3300002835|B570J40625_101515173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 550 | Open in IMG/M |
| 3300003394|JGI25907J50239_1100226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 565 | Open in IMG/M |
| 3300007363|Ga0075458_10113165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 844 | Open in IMG/M |
| 3300007544|Ga0102861_1108495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 743 | Open in IMG/M |
| 3300007639|Ga0102865_1271547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 505 | Open in IMG/M |
| 3300007708|Ga0102859_1002548 | All Organisms → Viruses → Predicted Viral | 4190 | Open in IMG/M |
| 3300008448|Ga0114876_1093713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1213 | Open in IMG/M |
| 3300008448|Ga0114876_1205575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 659 | Open in IMG/M |
| 3300009068|Ga0114973_10704251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 514 | Open in IMG/M |
| 3300009081|Ga0105098_10374670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 701 | Open in IMG/M |
| 3300009085|Ga0105103_10932545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 510 | Open in IMG/M |
| 3300009159|Ga0114978_10183547 | All Organisms → Viruses → Predicted Viral | 1330 | Open in IMG/M |
| 3300009181|Ga0114969_10490824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 689 | Open in IMG/M |
| 3300009181|Ga0114969_10739153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 526 | Open in IMG/M |
| 3300009183|Ga0114974_10469032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 710 | Open in IMG/M |
| 3300010157|Ga0114964_10602878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 515 | Open in IMG/M |
| 3300010160|Ga0114967_10370864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 720 | Open in IMG/M |
| 3300010354|Ga0129333_10545270 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
| 3300011011|Ga0139556_1016153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1072 | Open in IMG/M |
| 3300012752|Ga0157629_1150311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 546 | Open in IMG/M |
| 3300012769|Ga0138279_1196037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 512 | Open in IMG/M |
| 3300013005|Ga0164292_10836711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 580 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10070409 | All Organisms → Viruses → Predicted Viral | 2272 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10374136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 895 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10902354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 512 | Open in IMG/M |
| 3300013295|Ga0170791_13145827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 927 | Open in IMG/M |
| 3300013372|Ga0177922_10023973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1512 | Open in IMG/M |
| 3300015050|Ga0181338_1022100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 992 | Open in IMG/M |
| 3300017701|Ga0181364_1074048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 520 | Open in IMG/M |
| 3300017747|Ga0181352_1017473 | All Organisms → Viruses → Predicted Viral | 2246 | Open in IMG/M |
| 3300017747|Ga0181352_1072039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 975 | Open in IMG/M |
| 3300017747|Ga0181352_1190913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 529 | Open in IMG/M |
| 3300017774|Ga0181358_1091705 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300017784|Ga0181348_1191314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 740 | Open in IMG/M |
| 3300019781|Ga0181360_114426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 651 | Open in IMG/M |
| 3300019783|Ga0181361_110730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 712 | Open in IMG/M |
| 3300019783|Ga0181361_113316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 645 | Open in IMG/M |
| 3300019783|Ga0181361_120253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 527 | Open in IMG/M |
| 3300019784|Ga0181359_1049563 | All Organisms → Viruses → Predicted Viral | 1620 | Open in IMG/M |
| 3300020162|Ga0211735_10194644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 550 | Open in IMG/M |
| 3300020550|Ga0208600_1059366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 562 | Open in IMG/M |
| 3300021093|Ga0194123_10519406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 526 | Open in IMG/M |
| 3300021963|Ga0222712_10182649 | All Organisms → Viruses → Predicted Viral | 1388 | Open in IMG/M |
| 3300022179|Ga0181353_1159020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 515 | Open in IMG/M |
| 3300023174|Ga0214921_10323373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 841 | Open in IMG/M |
| 3300024348|Ga0244776_10924817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 514 | Open in IMG/M |
| 3300024502|Ga0255181_1054691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 678 | Open in IMG/M |
| 3300025732|Ga0208784_1119478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 785 | Open in IMG/M |
| 3300025896|Ga0208916_10250529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 769 | Open in IMG/M |
| 3300027123|Ga0255090_1011025 | All Organisms → Viruses → Predicted Viral | 1765 | Open in IMG/M |
| 3300027123|Ga0255090_1028169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 927 | Open in IMG/M |
| 3300027127|Ga0255071_1011691 | All Organisms → Viruses → Predicted Viral | 1441 | Open in IMG/M |
| 3300027128|Ga0255099_1004468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 3673 | Open in IMG/M |
| 3300027137|Ga0255092_1002436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 5510 | Open in IMG/M |
| 3300027141|Ga0255076_1008291 | All Organisms → Viruses → Predicted Viral | 2050 | Open in IMG/M |
| 3300027141|Ga0255076_1022269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1170 | Open in IMG/M |
| 3300027337|Ga0255087_1010042 | All Organisms → Viruses → Predicted Viral | 2308 | Open in IMG/M |
| 3300027487|Ga0255091_1033185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 868 | Open in IMG/M |
| 3300027491|Ga0255097_1044082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 852 | Open in IMG/M |
| 3300027494|Ga0255094_1012390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 2020 | Open in IMG/M |
| 3300027529|Ga0255077_1022453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1144 | Open in IMG/M |
| 3300027538|Ga0255085_1002830 | Not Available | 4558 | Open in IMG/M |
| 3300027588|Ga0255101_1023540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 897 | Open in IMG/M |
| 3300027597|Ga0255088_1002014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 7309 | Open in IMG/M |
| 3300027675|Ga0209077_1072753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 945 | Open in IMG/M |
| 3300027693|Ga0209704_1091085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 862 | Open in IMG/M |
| 3300027743|Ga0209593_10283678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 571 | Open in IMG/M |
| 3300027756|Ga0209444_10055585 | All Organisms → Viruses → Predicted Viral | 1765 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1194791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 779 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1194793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 779 | Open in IMG/M |
| (restricted) 3300029286|Ga0247841_10008034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 15364 | Open in IMG/M |
| (restricted) 3300029286|Ga0247841_10566949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 709 | Open in IMG/M |
| 3300029349|Ga0238435_100897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 6228 | Open in IMG/M |
| 3300031758|Ga0315907_10131246 | All Organisms → Viruses → Predicted Viral | 2132 | Open in IMG/M |
| 3300031758|Ga0315907_10238054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1513 | Open in IMG/M |
| 3300031784|Ga0315899_10848078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 830 | Open in IMG/M |
| 3300031885|Ga0315285_10607804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 723 | Open in IMG/M |
| 3300031885|Ga0315285_10863046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 559 | Open in IMG/M |
| 3300031952|Ga0315294_10768909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 834 | Open in IMG/M |
| 3300032093|Ga0315902_10890734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 686 | Open in IMG/M |
| 3300032118|Ga0315277_10572237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1115 | Open in IMG/M |
| 3300032143|Ga0315292_11050201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 675 | Open in IMG/M |
| 3300032275|Ga0315270_10629140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 699 | Open in IMG/M |
| 3300033233|Ga0334722_10129787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1896 | Open in IMG/M |
| 3300033816|Ga0334980_0132362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1026 | Open in IMG/M |
| 3300033979|Ga0334978_0048219 | All Organisms → Viruses → Predicted Viral | 2211 | Open in IMG/M |
| 3300033980|Ga0334981_0070505 | All Organisms → Viruses → Predicted Viral | 1775 | Open in IMG/M |
| 3300033980|Ga0334981_0344566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 649 | Open in IMG/M |
| 3300033981|Ga0334982_0344371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 690 | Open in IMG/M |
| 3300033994|Ga0334996_0153869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1276 | Open in IMG/M |
| 3300034012|Ga0334986_0240333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 990 | Open in IMG/M |
| 3300034018|Ga0334985_0606865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 609 | Open in IMG/M |
| 3300034019|Ga0334998_0239217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1106 | Open in IMG/M |
| 3300034061|Ga0334987_0243871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1229 | Open in IMG/M |
| 3300034061|Ga0334987_0275786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1129 | Open in IMG/M |
| 3300034062|Ga0334995_0137312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1785 | Open in IMG/M |
| 3300034092|Ga0335010_0121302 | All Organisms → Viruses → Predicted Viral | 1703 | Open in IMG/M |
| 3300034103|Ga0335030_0877343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 518 | Open in IMG/M |
| 3300034105|Ga0335035_0687498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 527 | Open in IMG/M |
| 3300034109|Ga0335051_0598950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 504 | Open in IMG/M |
| 3300034117|Ga0335033_0322532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 785 | Open in IMG/M |
| 3300034121|Ga0335058_0302842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 927 | Open in IMG/M |
| 3300034166|Ga0335016_0175511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 1428 | Open in IMG/M |
| 3300034279|Ga0335052_0486158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 641 | Open in IMG/M |
| 3300034283|Ga0335007_0804402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 510 | Open in IMG/M |
| 3300034284|Ga0335013_0794364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | 530 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 28.70% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 14.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.41% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.41% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.70% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.70% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.78% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.85% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.93% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012752 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012769 | Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024502 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027128 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300027137 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027487 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300027491 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d | Environmental | Open in IMG/M |
| 3300027494 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027538 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027588 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
| 3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1093505702 | 3300002408 | Freshwater | IANAFLISKNLIKEGQNFRDVSTKVANMIVSDPDSFLIKAKAFSSPTLE* |
| B570J29032_1096449971 | 3300002408 | Freshwater | IANAFLLSKNLIKEGQNFRDVSTKVANMIVSDPDGFISKAKAFSAPTLE* |
| B570J40625_1015151732 | 3300002835 | Freshwater | LEPHSDIANAFLISKNLIKEGQNFRDVSTKVANMIIADADGFISKAKAFSSPTNE* |
| JGI25907J50239_11002262 | 3300003394 | Freshwater Lake | AFLISKNLIKEGQNFRDVSTKVANMIVADPDSFISKAKAFANPPTE* |
| Ga0075458_101131652 | 3300007363 | Aqueous | KNLIKEGQNFRDVSTKVANMIISDADGFLAKAKAFSSPTIE* |
| Ga0102861_11084951 | 3300007544 | Estuarine | IANAFLVSKNLIKADQNFRDVSTKVANMILADSEGFISKAKAFANPPTE* |
| Ga0102865_12715472 | 3300007639 | Estuarine | IKEGQNFRDVSTKVANMILADATGFITKATAFANPPTE* |
| Ga0102859_10025481 | 3300007708 | Estuarine | KNLIKADQNFRDVSTKVANMILADSEGFISKAKAFANPPTE* |
| Ga0114876_10937131 | 3300008448 | Freshwater Lake | QILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIIADSDSFLIKAKAFSNPVTE* |
| Ga0114876_12055752 | 3300008448 | Freshwater Lake | IKEGQNFRDVSTKVANMIISDSDSFLIKAKAYSNPTIE* |
| Ga0114973_107042511 | 3300009068 | Freshwater Lake | QNFRDVSTKVANMILADSEGFISKAKAFANPPTE* |
| Ga0105098_103746701 | 3300009081 | Freshwater Sediment | AFLLSKNLIKEGQNFRDVSTKVANMIVSDPDSFIIKAKAFSAPTLE* |
| Ga0105103_109325451 | 3300009085 | Freshwater Sediment | ISKNLIKEGQNFRDVSTKVANMIVSDPDGFISKAKAFSAPTLE* |
| Ga0114978_101835471 | 3300009159 | Freshwater Lake | KLEQILEPHSDIANAFLVSKNLIKEGQNFRDVSTKVANMIVADADGFISKAKAFANPPTE |
| Ga0114969_104908241 | 3300009181 | Freshwater Lake | KNLIKESQNFRDVSTKVANMILADSEGFISKAKAFANPPTE* |
| Ga0114969_107391531 | 3300009181 | Freshwater Lake | DIANAFLLSKNLIKEGQNFRDVSTKVANMILADSEGFISKAKAFANPPTE* |
| Ga0114974_104690322 | 3300009183 | Freshwater Lake | EPHSDIANAFLVSKNLIKEGQNFRDVSTKVANMILADSEGFISKAKAFANPPTE* |
| Ga0114964_106028782 | 3300010157 | Freshwater Lake | LIKEGQNFRDVSTKVANMILADSEGFISKAKAFANPPTE* |
| Ga0114967_103708641 | 3300010160 | Freshwater Lake | LIKEGQNFRDVSTKVANMIVADPDSFISKAKAFSNPPTE* |
| Ga0129333_105452702 | 3300010354 | Freshwater To Marine Saline Gradient | SKNLIKEGQNFRDVSTKVANMIVSDPDGFIAKAKAFSSPTIE* |
| Ga0139556_10161531 | 3300011011 | Freshwater | GQNFRDVSTKVANMILADSEGFISKAKAFANPPTE* |
| Ga0157629_11503111 | 3300012752 | Freshwater | NLIKEGQNFRDVSTKVANMIVSDPDSFLIKAKAFSAPTLE* |
| Ga0138279_11960372 | 3300012769 | Freshwater Lake | KNLIKAEQNFRDVSTKVANMIVADPDSFISKAKAFANPPTE* |
| Ga0164292_108367112 | 3300013005 | Freshwater | FLLSKNLIKEGQNFRDVSTKVANMIIADSDSFLIKAKAFSEPTIE* |
| (restricted) Ga0172365_100704096 | 3300013127 | Sediment | EQALEPHSEIANAFLFSKKLIAEDQNFRDVSTKVANMILADVDGFVAKAKAFKPNPVAE* |
| (restricted) Ga0172373_103741363 | 3300013131 | Freshwater | SKKLIAEDQNFRDVSTKVANMILADVDGFVAKAKAFQPNPVAE* |
| (restricted) Ga0172373_109023542 | 3300013131 | Freshwater | LEQALEPHSEIANAFLMSKKLIAEDQNFRDVSTKVANMILADVDGFVAKAKAFQPNPVAE |
| Ga0170791_131458272 | 3300013295 | Freshwater | SKSLIKEGQNFRDVSTKVANMILADANGFITKATAFANPPTE* |
| Ga0177922_100239731 | 3300013372 | Freshwater | LEQILEPHSETANAFLISKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFANPTNE* |
| Ga0181338_10221001 | 3300015050 | Freshwater Lake | SKNLIKEGQNFRDVSTKVANMIVADADGFISKAKAFANPPTE* |
| Ga0181364_10740482 | 3300017701 | Freshwater Lake | KAEQNFRDVSTKVANMIVADPDSFISKAKVFANPPTE |
| Ga0181352_10174735 | 3300017747 | Freshwater Lake | ISKNLIKEGQNFRDVSTKVANMIVSDPDSFLIKAKAFSAPTIE |
| Ga0181352_10720391 | 3300017747 | Freshwater Lake | ANAFLLSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFANPTNE |
| Ga0181352_11909132 | 3300017747 | Freshwater Lake | NLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSSPTLE |
| Ga0181358_10917051 | 3300017774 | Freshwater Lake | SKNLIKEGQNFRDVSTKVANMIVADADGFISKAKAFANPPTE |
| Ga0181348_11913141 | 3300017784 | Freshwater Lake | EGQNFRDVSTKVANMILADSEGFISKAKAFANPSNE |
| Ga0181360_1144262 | 3300019781 | Freshwater Lake | KAEQNFRDVSTKVANMILADADGFISKAKAFANPPTE |
| Ga0181361_1107302 | 3300019783 | Freshwater Lake | EAANAFLISKNLIKEGQNFRDVSTKVANMIVSDPDGFISKAKAFANPPTE |
| Ga0181361_1133161 | 3300019783 | Freshwater Lake | DIANAFLVSKNLIKEGQNFRDVSTKVANMILADSEGFISKAKAFANPPTE |
| Ga0181361_1202531 | 3300019783 | Freshwater Lake | FLVSKNLIKESQNFRDVSTKVANMIFADSEGFISKAKAFANPPTE |
| Ga0181359_10495631 | 3300019784 | Freshwater Lake | EAANAFLISKNLIKAEQNFRDVSTKVANMILADADGFISKAKAFANPPTE |
| Ga0211735_101946442 | 3300020162 | Freshwater | ILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMILADSEGFISKAKAFSNPPTE |
| Ga0208600_10593662 | 3300020550 | Freshwater | HSEIANAFLISKNLIKEGQNFRDVSTKVANMIVSDPDSFLIKAKAFSSPTLE |
| Ga0194123_105194062 | 3300021093 | Freshwater Lake | IANAFLLSKNLIKPDQNFRDVSTKVANMILNDVDGFVAKAKAFQPPPVAE |
| Ga0222712_101826493 | 3300021963 | Estuarine Water | AFLVSKSLIKEGQNFRDVSTKVANMIIADSEGFISKAKAFVNIPTE |
| Ga0181353_11590202 | 3300022179 | Freshwater Lake | IKEGQNFRDVSTKVANMIIADADGFISKAKAFSAPTLE |
| Ga0214921_103233731 | 3300023174 | Freshwater | ANAFLVSKNLIKEGQNFRDVSTKVANMIIADSDGFISKAKTFANPPTE |
| Ga0244776_109248172 | 3300024348 | Estuarine | NAFLVSKNLIKADQNFRDVSTKVANMILADSEGFISKAKAFANPPTE |
| Ga0255181_10546911 | 3300024502 | Freshwater | QILEPYSEMANAFLVSKNLIKPDQNFRDVSTKVANMILADADGFIAKAKAFANPTTE |
| Ga0208784_11194782 | 3300025732 | Aqueous | AQRLEDALEDHAEKANAFLLSKNLIKEGQNFRDVSAKVANMILSDVEAFIAKIQ |
| Ga0208916_102505292 | 3300025896 | Aqueous | EQILEPHSEAANAFLLSKNLIKAEQNFRDVSTKVANMILADASGFITKATAFANPPTE |
| Ga0255090_10110251 | 3300027123 | Freshwater | SEQNFRDVSTKVANMIIADADGFISKAKAFSAPTLE |
| Ga0255090_10281692 | 3300027123 | Freshwater | SEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE |
| Ga0255071_10116911 | 3300027127 | Freshwater | ANAFLISKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFSAPTLE |
| Ga0255099_10044689 | 3300027128 | Freshwater | HSEAANAFLISKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE |
| Ga0255092_100243617 | 3300027137 | Freshwater | IANAFLLSKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFSAPTLE |
| Ga0255076_10082914 | 3300027141 | Freshwater | FLLSKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFSAPTLE |
| Ga0255076_10222691 | 3300027141 | Freshwater | PHSETANAFLISKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSAPTIQ |
| Ga0255087_10100421 | 3300027337 | Freshwater | LIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE |
| Ga0255091_10331852 | 3300027487 | Freshwater | SKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE |
| Ga0255097_10440822 | 3300027491 | Freshwater | ILEPHSEAANAFLISKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE |
| Ga0255094_10123904 | 3300027494 | Freshwater | NLIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE |
| Ga0255077_10224531 | 3300027529 | Freshwater | SEAANAFLISKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE |
| Ga0255085_10028301 | 3300027538 | Freshwater | IKSEQNFRDVSTKVANMIIADADGFISKAKAFSAPTLE |
| Ga0255101_10235402 | 3300027588 | Freshwater | LEQILEPHSEAANAFLISKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFANPVTE |
| Ga0255088_100201423 | 3300027597 | Freshwater | EKLEQILEPHSEIANAFLLSKNLIKSEQNFRDVSTKVANMIIADADGFISKAKAFSAPTL |
| Ga0209077_10727531 | 3300027675 | Freshwater Sediment | FLLSKNLIKEGQNFRDVSTKVANMIVSDPDSFIIKAKAFSAPTLE |
| Ga0209704_10910852 | 3300027693 | Freshwater Sediment | QILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIVSDPDGFISKAKAFSAPTLE |
| Ga0209593_102836781 | 3300027743 | Freshwater Sediment | NLIKEGQNFRDVSTKVANMIVSDPDGFISKAKAFSAPTIE |
| Ga0209444_100555851 | 3300027756 | Freshwater Lake | NAFLVSKNLIKAEQNFRDVSTKVANMIVADPDSFISKAKVFANPPTE |
| (restricted) Ga0247843_11947911 | 3300028569 | Freshwater | NLEKILEPHSEAANAFLLSKNLIKEGQNFRDVSTKVANMIIADANGFITKATAFSNPPTE |
| (restricted) Ga0247843_11947932 | 3300028569 | Freshwater | NLEKILEPHSEAANAFLLSKNLIKEGQNFRDVSTKVANMIIADADGFISKAKAFANPVTE |
| (restricted) Ga0247841_100080341 | 3300029286 | Freshwater | ANAFLLSKNLIKEGQNFRDVSTKVANMIIADANGFITKATAFSNPPTE |
| (restricted) Ga0247841_105669492 | 3300029286 | Freshwater | KEGQNFRDVSTKVANMIIADADGFISKAKAFANPVTE |
| Ga0238435_1008971 | 3300029349 | Freshwater | IKEGQNFRDVSTKVANMIVSDPDSFLIKAKAFSEPTIE |
| Ga0315907_101312466 | 3300031758 | Freshwater | LEAHAEKANAFLLSKNLIKEGQNFRDVSTKVANMILSDIPAFIAKIQ |
| Ga0315907_102380541 | 3300031758 | Freshwater | ANAFLISKNLIKEGQNFRDVSTKVANMIISDADGFIAKAKAFSSPTIE |
| Ga0315899_108480781 | 3300031784 | Freshwater | NAFLLSKNLIKEGQNFRDVSTKVANMIIADSDSFLIKAKAFSNPVTE |
| Ga0315285_106078041 | 3300031885 | Sediment | PHSDIANAFLASKNLIKADQNFRDVSTKVANMILADSEGFISKAKAFANPPTE |
| Ga0315285_108630461 | 3300031885 | Sediment | PHSDIANAFLASKNLIKADQNFRDVSTKVANMILADAEGFISKAKTFANPSNE |
| Ga0315294_107689092 | 3300031952 | Sediment | IKADQNFRDVSTKVANMILADSEGFISKAKAFANPPTE |
| Ga0315902_108907343 | 3300032093 | Freshwater | NAFLISKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSAPTLE |
| Ga0315277_105722371 | 3300032118 | Sediment | LEQILEPHSDIANAFLLSKNLIKADQNFRDVSTKVANMILADSEGFISKAKAFSNPPTE |
| Ga0315292_110502013 | 3300032143 | Sediment | LEPHSDIANAFLVSKNLIKADQNFRDVSTKVANMILADAEGFISKAKAFANPSNE |
| Ga0315270_106291402 | 3300032275 | Sediment | PEISIIEKLEKVLEPISEIANAFLVHKNLIKEGQNFRDVSGKVAKIILADVEDFVTKAKAFSNPITE |
| Ga0334722_101297871 | 3300033233 | Sediment | EKVLEPISEIANAFLVHKNLIKEGQNFRDVSGKVAKIILADVEDFVTKAKAFSNPITE |
| Ga0334980_0132362_865_1026 | 3300033816 | Freshwater | PHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSAPTLE |
| Ga0334978_0048219_3_191 | 3300033979 | Freshwater | VEKLEQILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIIADSDSFLIKAKAFSEPTIE |
| Ga0334981_0070505_1654_1773 | 3300033980 | Freshwater | LIKEGQNFRDVSTKVANMIIADADGFISKAKAFVIPPTE |
| Ga0334981_0344566_2_181 | 3300033980 | Freshwater | LEQILEPHSEAANAFLLSKNLIKAEQNFRDVSTKVANMILADASGFIAKATAFANPPTE |
| Ga0334982_0344371_1_174 | 3300033981 | Freshwater | QILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIVSDPDSFISKAKAFSAPTLE |
| Ga0334996_0153869_1128_1274 | 3300033994 | Freshwater | ANAFLLSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSAPTLE |
| Ga0334986_0240333_859_990 | 3300034012 | Freshwater | LSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSSPTIE |
| Ga0334985_0606865_423_608 | 3300034018 | Freshwater | EKLEQILEPHSDIANAFLVSKNLIKAEQNFRDVSTKVANMILADASGFITKATAFANPPT |
| Ga0334998_0239217_971_1105 | 3300034019 | Freshwater | LLSKNLIKEGQNFRDVSTKVANMIIADADGFISKANAFANPPTE |
| Ga0334987_0243871_1053_1229 | 3300034061 | Freshwater | EQILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIISDADGFLAKAKAFSAPTLE |
| Ga0334987_0275786_960_1127 | 3300034061 | Freshwater | LEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIIADADGFISKAKAFSAPTIE |
| Ga0334995_0137312_1659_1784 | 3300034062 | Freshwater | KNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFANPTNE |
| Ga0335010_0121302_1557_1703 | 3300034092 | Freshwater | ANAFLVSKNLIKEGQNFRDVSTKVANMIVADPDSFISKAKAFANPPTE |
| Ga0335030_0877343_371_517 | 3300034103 | Freshwater | ANAFLVSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSAPTLE |
| Ga0335035_0687498_2_166 | 3300034105 | Freshwater | EPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIISDSDSFLIKAKAYSNPTIE |
| Ga0335051_0598950_2_166 | 3300034109 | Freshwater | EPHSEAANAFLVSKNLIKEAQNFRDVSTKVANMILADADGFISKAKTFANPPTE |
| Ga0335033_0322532_638_784 | 3300034117 | Freshwater | ANAFLISKNLIKEGQNFRDVSTKVANMIVSDPDSFIIKAKAFSSPTIE |
| Ga0335058_0302842_815_925 | 3300034121 | Freshwater | EGQNFRDVSTKVANMILADAEGFISKAKAFANPPTE |
| Ga0335016_0175511_1248_1427 | 3300034166 | Freshwater | LEQILEPHSDIANAFLISKNLIKEGQNFRDVSTKVANMIIADADGFISKAKAFSSPTNE |
| Ga0335052_0486158_459_641 | 3300034279 | Freshwater | KLEQILEPHSDIANAFLLSKNLIKEGQNFRDVSTKVANMIISDADGFISKAKAFSAPTLE |
| Ga0335007_0804402_3_116 | 3300034283 | Freshwater | KEGQNFRDVSTKVANMILADSEGFISKAKTFANPPTE |
| Ga0335013_0794364_2_133 | 3300034284 | Freshwater | LSKNLIKEGQNFRDVSTKVANMIVSDPDGFISKAKAFSAPTLE |
| ⦗Top⦘ |