Metagenome / Metatranscriptome Family F089783

Basic Information
Family ID	F089783
Family Type	Metagenome / Metatranscriptome
Number of Sequences	108
Average Sequence Length	38 residues
Representative Sequence	MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQSLAV
Number of Associated Samples	79
Number of Associated Scaffolds	108

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	67.59 %
% of genes near scaffold ends (potentially truncated)	23.15 %
% of genes from short scaffolds (< 2000 bps)	79.63 %
Associated GOLD sequencing projects	65
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.28

Most Common Taxonomy
Group	Unclassified (50.926 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (34.259 % of family members)
Environment Ontology (ENVO)	Unclassified (79.630 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (89.815 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 4.48% β-sheet: 11.94% Coil/Unstructured: 83.58%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 108 Family Scaffolds
PF09694	Gcw_chp	17.59
PF00313	CSD	6.48
PF00543	P-II	5.56
PF01541	GIY-YIG	2.78
PF00149	Metallophos	2.78
PF00909	Ammonium_transp	2.78
PF04055	Radical_SAM	1.85
PF01503	PRA-PH	1.85
PF02915	Rubrerythrin	1.85
PF13609	Porin_4	1.85
PF03401	TctC	1.85
PF02585	PIG-L	0.93
PF07460	NUMOD3	0.93
PF00202	Aminotran_3	0.93
PF00196	GerE	0.93
PF00691	OmpA	0.93
PF02777	Sod_Fe_C	0.93
PF04820	Trp_halogenase	0.93

COG ID	Name	Functional Category	% Frequency in 108 Family Scaffolds
COG0347	Nitrogen regulatory protein PII	Signal transduction mechanisms [T]	5.56
COG0004	Ammonia channel protein AmtB	Inorganic ion transport and metabolism [P]	2.78
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	1.85
COG0605	Superoxide dismutase	Inorganic ion transport and metabolism [P]	0.93
COG2120	N-acetylglucosaminyl deacetylase, LmbE family	Carbohydrate transport and metabolism [G]	0.93

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
All Organisms	root	All Organisms	49.07 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Viruses	superkingdom	All Organisms → Viruses	42.59 %
cellular organisms	root	All Organisms → cellular organisms	6.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	39.81 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	5.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	39.81 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	5.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	39.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.93 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.93 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.93 %
Polynucleobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
unclassified Polynucleobacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter	0.93 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
genistoids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
core genistoids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Genisteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Lupinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.93 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	39.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.78 %
Lupinus albus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	0.93 %
Polynucleobacter sp. JS-JIR-5-A7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000176\|TB03JUN2009E_c008611	Not Available	1899	Open in IMG/M
3300000176\|TB03JUN2009E_c016446	Not Available	1186	Open in IMG/M
3300002092\|JGI24218J26658_1022332	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	843	Open in IMG/M
3300002098\|JGI24219J26650_1011399	Not Available	1443	Open in IMG/M
3300002408\|B570J29032_109928418	Not Available	2955	Open in IMG/M
3300003860\|Ga0031658_1046981	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	742	Open in IMG/M
3300004095\|Ga0007829_10018158	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1351	Open in IMG/M
3300004095\|Ga0007829_10082118	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	641	Open in IMG/M
3300004096\|Ga0066177_10218374	Not Available	787	Open in IMG/M
3300004481\|Ga0069718_15953852	Not Available	670	Open in IMG/M
3300004684\|Ga0065168_1002007	All Organisms → cellular organisms → Bacteria → Proteobacteria	3385	Open in IMG/M
3300004685\|Ga0065177_1003055	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3035	Open in IMG/M
3300004685\|Ga0065177_1017410	Not Available	1346	Open in IMG/M
3300004686\|Ga0065173_1012878	Not Available	1542	Open in IMG/M
3300004686\|Ga0065173_1089844	Not Available	552	Open in IMG/M
3300004770\|Ga0007804_1017963	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1991	Open in IMG/M
3300004773\|Ga0007795_10190526	Not Available	571	Open in IMG/M
3300004774\|Ga0007794_10013610	Not Available	2421	Open in IMG/M
3300004774\|Ga0007794_10160348	All Organisms → cellular organisms → Bacteria → Proteobacteria	672	Open in IMG/M
3300004805\|Ga0007792_10037720	Not Available	1465	Open in IMG/M
3300004805\|Ga0007792_10071561	All Organisms → Viruses → Predicted Viral	1053	Open in IMG/M
3300005580\|Ga0049083_10226313	Not Available	633	Open in IMG/M
3300006071\|Ga0007876_1011261	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2570	Open in IMG/M
3300006071\|Ga0007876_1082665	Not Available	841	Open in IMG/M
3300006072\|Ga0007881_1011023	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2727	Open in IMG/M
3300006072\|Ga0007881_1034189	Not Available	1362	Open in IMG/M
3300006101\|Ga0007810_1038032	Not Available	1032	Open in IMG/M
3300006101\|Ga0007810_1066924	Not Available	718	Open in IMG/M
3300006113\|Ga0007858_1008302	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2574	Open in IMG/M
3300006120\|Ga0007867_1004350	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3621	Open in IMG/M
3300006123\|Ga0007852_1002847	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-JIR-5-A7	4223	Open in IMG/M
3300006123\|Ga0007852_1136600	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	528	Open in IMG/M
3300006128\|Ga0007828_1055325	Not Available	824	Open in IMG/M
3300009068\|Ga0114973_10539320	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	602	Open in IMG/M
3300009151\|Ga0114962_10094771	All Organisms → Viruses → Predicted Viral	1868	Open in IMG/M
3300009151\|Ga0114962_10270311	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	961	Open in IMG/M
3300009151\|Ga0114962_10475520	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	664	Open in IMG/M
3300009151\|Ga0114962_10712122	Not Available	512	Open in IMG/M
3300009152\|Ga0114980_10422819	Not Available	763	Open in IMG/M
3300009154\|Ga0114963_10496714	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	650	Open in IMG/M
3300009159\|Ga0114978_10194620	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1284	Open in IMG/M
3300009159\|Ga0114978_10628675	Not Available	618	Open in IMG/M
3300009159\|Ga0114978_10709963	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	573	Open in IMG/M
3300009160\|Ga0114981_10160849	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1237	Open in IMG/M
3300009160\|Ga0114981_10309972	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	856	Open in IMG/M
3300009161\|Ga0114966_10182364	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1343	Open in IMG/M
3300009161\|Ga0114966_10315498	Not Available	941	Open in IMG/M
3300009168\|Ga0105104_10498470	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	685	Open in IMG/M
3300009180\|Ga0114979_10180672	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1284	Open in IMG/M
3300009181\|Ga0114969_10015842	Not Available	5400	Open in IMG/M
3300009182\|Ga0114959_10447720	Not Available	628	Open in IMG/M
3300009183\|Ga0114974_10115865	Not Available	1708	Open in IMG/M
3300009183\|Ga0114974_10124271	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1637	Open in IMG/M
3300009183\|Ga0114974_10572608	Not Available	625	Open in IMG/M
3300009184\|Ga0114976_10649091	Not Available	532	Open in IMG/M
3300009502\|Ga0114951_10044377	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2726	Open in IMG/M
3300009502\|Ga0114951_10458556	Not Available	627	Open in IMG/M
3300010157\|Ga0114964_10294151	All Organisms → cellular organisms → Bacteria → Proteobacteria	770	Open in IMG/M
3300010158\|Ga0114960_10136396	Not Available	1331	Open in IMG/M
3300010158\|Ga0114960_10148468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1262	Open in IMG/M
3300010158\|Ga0114960_10165176	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1179	Open in IMG/M
3300010160\|Ga0114967_10007119	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8702	Open in IMG/M
3300010388\|Ga0136551_1098601	Not Available	509	Open in IMG/M
3300010885\|Ga0133913_10456256	Not Available	3372	Open in IMG/M
3300011184\|Ga0136709_1004967	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1944	Open in IMG/M
3300013006\|Ga0164294_10553078	Not Available	782	Open in IMG/M
3300013094\|Ga0164297_10123849	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1061	Open in IMG/M
3300016726\|Ga0182045_1204556	Not Available	604	Open in IMG/M
3300020048\|Ga0207193_1006148	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	18494	Open in IMG/M
3300020162\|Ga0211735_11273265	Not Available	871	Open in IMG/M
3300020718\|Ga0214178_1045435	Not Available	534	Open in IMG/M
3300021138\|Ga0214164_1021610	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1796	Open in IMG/M
3300021354\|Ga0194047_10060948	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1685	Open in IMG/M
3300021354\|Ga0194047_10218914	Not Available	750	Open in IMG/M
3300021354\|Ga0194047_10276719	Not Available	647	Open in IMG/M
3300021519\|Ga0194048_10000938	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	14401	Open in IMG/M
3300021519\|Ga0194048_10317203	Not Available	559	Open in IMG/M
3300022555\|Ga0212088_10131227	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2179	Open in IMG/M
3300022555\|Ga0212088_10673626	Not Available	621	Open in IMG/M
3300023184\|Ga0214919_10001214	Not Available	42902	Open in IMG/M
3300025091\|Ga0209616_1010097	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	999	Open in IMG/M
3300025357\|Ga0208383_1025533	Not Available	692	Open in IMG/M
3300025382\|Ga0208256_1049362	Not Available	579	Open in IMG/M
3300025410\|Ga0208875_1028814	Not Available	918	Open in IMG/M
3300025413\|Ga0208614_1064046	Not Available	533	Open in IMG/M
3300025437\|Ga0208742_1062473	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	611	Open in IMG/M
3300025449\|Ga0208106_1000145	Not Available	27645	Open in IMG/M
3300025466\|Ga0208497_1029360	Not Available	1195	Open in IMG/M
3300025466\|Ga0208497_1034358	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1077	Open in IMG/M
3300025590\|Ga0209195_1014555	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2691	Open in IMG/M
3300025723\|Ga0208741_10016151	Not Available	1888	Open in IMG/M
3300027708\|Ga0209188_1000114	Not Available	92673	Open in IMG/M
3300027708\|Ga0209188_1012955	Not Available	4594	Open in IMG/M
3300027733\|Ga0209297_1190269	Not Available	820	Open in IMG/M
3300027734\|Ga0209087_1048907	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1940	Open in IMG/M
3300027734\|Ga0209087_1113974	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1128	Open in IMG/M
3300027736\|Ga0209190_1107651	All Organisms → Viruses → Predicted Viral	1273	Open in IMG/M
3300027749\|Ga0209084_1328752	Not Available	567	Open in IMG/M
3300027754\|Ga0209596_1073132	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	1697	Open in IMG/M
3300027777\|Ga0209829_10313265	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	636	Open in IMG/M
3300027782\|Ga0209500_10166275	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1024	Open in IMG/M
3300027892\|Ga0209550_10354694	Not Available	923	Open in IMG/M
3300027896\|Ga0209777_10299821	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1243	Open in IMG/M
3300027899\|Ga0209668_10001717	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9484	Open in IMG/M
(restricted) 3300028559\|Ga0247831_1264135	Not Available	594	Open in IMG/M
3300031746\|Ga0315293_10931915	Not Available	625	Open in IMG/M
3300031857\|Ga0315909_10224143	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1467	Open in IMG/M
3300032605\|Ga0316232_1142038	Not Available	1022	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	100.00%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	98.15%
Marine	Environmental → Aquatic → Marine	1.85%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	49.07%
Lentic	Environmental → Aquatic → Freshwater → Lentic	43.52%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	2.78%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.85%
Pond	Environmental → Aquatic → Freshwater → Pond	0.93%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.93%
Pelagic	Environmental → Aquatic → Marine → Pelagic	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	47.22%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	36.11%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	3.70%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	2.78%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	2.78%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.85%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.85%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.93%
Unclassified	Environmental → Aquatic → Freshwater → Pond → Unclassified	0.93%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.93%
Unclassified	Environmental → Aquatic → Marine → Pelagic → Unclassified	0.93%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	34.26%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	31.48%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	4.63%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	3.70%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	3.70%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	2.78%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	2.78%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	1.85%
Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic	1.85%
Freshwater Lake Hypolimnion	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion	1.85%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	1.85%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	0.93%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.93%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	0.93%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater	0.93%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.93%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.93%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.93%
Pond Fresh Water	Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water	0.93%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.93%
Pelagic Marine	Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000176	Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion	Environmental	Open in IMG/M
3300002092	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome	Environmental	Open in IMG/M
3300002098	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300003860	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL	Environmental	Open in IMG/M
3300004095	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09	Environmental	Open in IMG/M
3300004096	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)	Environmental	Open in IMG/M
3300004481	Combined Assembly of Gp0112041, Gp0112042, Gp0112043	Environmental	Open in IMG/M
3300004684	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2)	Environmental	Open in IMG/M
3300004685	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2)	Environmental	Open in IMG/M
3300004686	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2)	Environmental	Open in IMG/M
3300004770	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07	Environmental	Open in IMG/M
3300004773	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M	Environmental	Open in IMG/M
3300004774	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M	Environmental	Open in IMG/M
3300004805	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300006071	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09	Environmental	Open in IMG/M
3300006072	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09	Environmental	Open in IMG/M
3300006101	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09	Environmental	Open in IMG/M
3300006113	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08	Environmental	Open in IMG/M
3300006120	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08	Environmental	Open in IMG/M
3300006123	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08	Environmental	Open in IMG/M
3300006128	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009154	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental	Open in IMG/M
3300009182	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300009502	Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG	Environmental	Open in IMG/M
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental	Open in IMG/M
3300010158	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300010388	Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011184	Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG	Environmental	Open in IMG/M
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental	Open in IMG/M
3300013094	Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG	Environmental	Open in IMG/M
3300016726	Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300020718	Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion	Environmental	Open in IMG/M
3300021138	Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion	Environmental	Open in IMG/M
3300021354	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m	Environmental	Open in IMG/M
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental	Open in IMG/M
3300022555	Alinen_combined assembly	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300025091	Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes)	Environmental	Open in IMG/M
3300025357	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes)	Environmental	Open in IMG/M
3300025382	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes)	Environmental	Open in IMG/M
3300025410	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes)	Environmental	Open in IMG/M
3300025413	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes)	Environmental	Open in IMG/M
3300025437	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 (SPAdes)	Environmental	Open in IMG/M
3300025449	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (SPAdes)	Environmental	Open in IMG/M
3300025466	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes)	Environmental	Open in IMG/M
3300025590	Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes)	Environmental	Open in IMG/M
3300025723	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes)	Environmental	Open in IMG/M
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027777	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027892	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027896	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300028559 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m	Environmental	Open in IMG/M
3300031746	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300032605	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.28
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.28
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F089783

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
TB03JUN2009E_0086112	3300000176	Freshwater	MTVNQANLVNAKASTGEVTVSGKNVKFSARTAKADSFAV*
TB03JUN2009E_0164462	3300000176	Freshwater	MTVNQAKSVNANANTGEVTVSGKNVKFSARSVKRQSLAV*
JGI24218J26658_10223321	3300002092	Lentic	MTVNQATLVNANANTGEVTVSGKGVKFSARTAQRQSLAV*
JGI24219J26650_10113991	3300002098	Lentic	TTWSKTQKTLNANASKGEVTVSGKNIKFSARTAQRQSLAV*
B570J29032_1099284184	3300002408	Freshwater	MTVNQANLVNAKANTGEVTVSGKNVKFSTRSVKRQSLAV*
Ga0031658_10469811	3300003860	Freshwater Lake Sediment	MTVNQAKLVNAKASTGEVTVSGKGVKFSARTAKAESFAV*
Ga0007829_100181581	3300004095	Freshwater	MTVNQANLVNAKANTGEVTVSGKNIKFSARSAQRQSLAV*
Ga0007829_100821182	3300004095	Freshwater	MTVNQAKLVNANANTGEVTVSAKNVKFRTLAAKGQSLAV*
Ga0066177_102183742	3300004096	Freshwater Lake	MTVNQANLVNAKANTGEVTVSGKNIKFSARSVKRQSFAV*
Ga0069718_159538522	3300004481	Sediment	MTVNQANYVNAKTSTGEVTVSGKNVKFSARSAQRQSLAV*
Ga0065168_10020071	3300004684	Freshwater	MTVNQAKLVNANANTGEVAVSGKNIKFSARTVRATSFAV*
Ga0065177_10030557	3300004685	Freshwater	MTVNQAKNLNANASKGEVTVSGKGIRFSARTAQRQTLAV*
Ga0065177_10174101	3300004685	Freshwater	MTLNQAKLVNANANTKSGTVTVNGKGVKFSARTAKVALV*
Ga0065173_10128781	3300004686	Freshwater	MTVNQAKSVNANANTGEVTVSGKNVKFSARSVKSQSLAV*
Ga0065173_10898441	3300004686	Freshwater	MTVNQAKLVNANANTGEVTVSAKNLKFRTLAAKGQSLAV*
Ga0007804_10179633	3300004770	Freshwater	MIVNQANLVNAKASTGEVTVSGKNIKFRTLAAKGQSLAV*
Ga0007795_101905262	3300004773	Freshwater	MTVNQAKLVNANANTGEVTVSGKNIKFRTLAAKGQSLAV*
Ga0007794_1001361010	3300004774	Freshwater	MILNQANLVNAKASTGEVTVSGKNVKFSARSVKAESFAV*
Ga0007794_101603481	3300004774	Freshwater	MTVNQAKLVNAKASTGEVTVSGKNVKFSARSAQRQSLAV*
Ga0007792_100377203	3300004805	Freshwater	MILNQAKLVNANANTGEVTVSGKNVKFSARTAQRQSLAV*
Ga0007792_100715613	3300004805	Freshwater	MTVNQATYVNAKANTGEVTVSGKNVKFSARSAQRQSLAV*
Ga0049083_102263131	3300005580	Freshwater Lentic	MTVNQANLVNAKANTGEVTVSGKNIKFSTRSVKRQSFAV*
Ga0007876_10112615	3300006071	Freshwater	MTVNQANKVNANANTTVTVSGKNIKFSARAAKESLAV*
Ga0007876_10826652	3300006071	Freshwater	MTVNQANLVNAKANTGEVTVSGKNVKFSARTAQRQSLAV*
Ga0007881_10110232	3300006072	Freshwater	MTVNQANLVNAKASTGEVTVSGKGVKFSARTAKAESFAV*
Ga0007881_10341893	3300006072	Freshwater	AKLVNANANTGEVTVSAKNVKFRTLAAKGQSLAV*
Ga0007810_10380322	3300006101	Freshwater	EAKLVNANANTGEVTVSGKNIKFSARSAQRQSLAV*
Ga0007810_10669242	3300006101	Freshwater	MILNQAKLVNAKASTGEVTVSGKGVKFSARTVKAESFAV*
Ga0007858_10083021	3300006113	Freshwater	NQAKLVNANANTKSGTVTVNGKGVKFSARTAKVALV*
Ga0007867_10043502	3300006120	Freshwater	MTVNQANLVNANANTTVTVSGKNIKFSARAAKESLAV*
Ga0007852_10028475	3300006123	Freshwater	MTVNQAKLVNANANTGEVTVSGKNVKFSARSAKATLAV*
Ga0007852_11366001	3300006123	Freshwater	LGQPVEEANLVNAKASTGEVTFSAKNVKFRALTAKAESFAV*
Ga0007828_10553252	3300006128	Freshwater	MTVNQAKLVNANANTGEVTVSGKNIKFSARSAQRQSLAV*
Ga0114973_105393201	3300009068	Freshwater Lake	MTANQAKLVNAKASTGEVTVSGKNLKFRTLAAKGQSLAV*
Ga0114962_100947713	3300009151	Freshwater Lake	MTVNQANLVNANANTGEVTVSGKNIKFRTLAAKGQSLAV*
Ga0114962_102703111	3300009151	Freshwater Lake	MTVNQANLVNATASTGEVTVKANKGIRFSARSTAKAEAFAV*
Ga0114962_104755202	3300009151	Freshwater Lake	MTVNQAKLVNANANTGEVTVSGKNVKFRTLAAKGQLLAV*
Ga0114962_107121221	3300009151	Freshwater Lake	MTVNQANLVNAKASTGEVTVSAKNIKFRTLAAKGQSLAV*
Ga0114980_104228192	3300009152	Freshwater Lake	MTVNQAKLVNAKANTGEVTVSGKNVKFSARTAQRQSLAV*
Ga0114963_104967142	3300009154	Freshwater Lake	AMTVNQAKLVNANANTGEVTVSGKNLKFSARTVKAESFAV*
Ga0114978_101946201	3300009159	Freshwater Lake	MTVNQAKLVNAKANTGEVTVSGKNVKFSTRAVKRQTLAV*
Ga0114978_106286751	3300009159	Freshwater Lake	QAKLVNAKANTGEVTVSGKNVKFSARSVKRQSLAV*
Ga0114978_107099631	3300009159	Freshwater Lake	MTANQAKLVNAKASTGEVTVSAKNLKFRTLAAKGQSLAV*
Ga0114981_101608491	3300009160	Freshwater Lake	MTVNQAKLVNAKANTGEVTVSGKNVKFSARTAQRQS
Ga0114981_103099721	3300009160	Freshwater Lake	QAKLVNAKANTGEVTVSGKNVKFSARTAQRQSLAV*
Ga0114966_101823643	3300009161	Freshwater Lake	MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQSLAV*
Ga0114966_103154981	3300009161	Freshwater Lake	NQANQVNAKASTGEVTVSGKNVKFSARTVKAESFAV*
Ga0105104_104984701	3300009168	Freshwater Sediment	MTVNQANYVNAKTSTGEVTVSGKNVKFSARTAKATLAV*
Ga0114979_101806721	3300009180	Freshwater Lake	MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQSLSV*
Ga0114969_1001584213	3300009181	Freshwater Lake	MILNQANLVNANANTGEVTVSGKNIKFRTLAAKGQSLAV*
Ga0114959_104477202	3300009182	Freshwater Lake	NQAKIVNANANTTVTVSGKNVKFKARTAKASLAV*
Ga0114974_101158651	3300009183	Freshwater Lake	MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQS
Ga0114974_101242712	3300009183	Freshwater Lake	MTVNQANFVNAKTSTGEVTVSGKNVKFSARSAQRQSLAV*
Ga0114974_105726081	3300009183	Freshwater Lake	MTVNQAKLVNAKASTGEVTVSGKNVKFSARTVKAESFAV
Ga0114976_106490912	3300009184	Freshwater Lake	MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQ
Ga0114951_100443778	3300009502	Freshwater	MTVNQANLVNAKASTGEVTVSAKNLKFRTLAAKGQSLAV*
Ga0114951_104585561	3300009502	Freshwater	MTVNQANLVNAKANTGEVTVSGKGVKFSARTAKAESFAV*
Ga0114964_102941511	3300010157	Freshwater Lake	NQANLVNANANTGEVTVSGKNVKFRTLAAKGQTLAV*
Ga0114960_101363966	3300010158	Freshwater Lake	MTANQANQVNAKASTGEVTVSGKNVKFSARTVKAESFAV*
Ga0114960_101484681	3300010158	Freshwater Lake	NQANLVNANANTGEVTVSGKNIKFRTLAAKGQSLAV*
Ga0114960_101651763	3300010158	Freshwater Lake	MTANQANQVNAKASTGEVTVSGKGVKFSARTVKAESFAV
Ga0114967_1000711913	3300010160	Freshwater Lake	MTVNQANLVNAKANTGEVTVSGKNVKFSARSVKRQSLAV*
Ga0136551_10986011	3300010388	Pond Fresh Water	MTVNQANLVNAKANTGEVTVSGKGVKFSARTAKATLAV*
Ga0133913_104562565	3300010885	Freshwater Lake	LNQAKIVNANANTTVTVSGKNVKFKARTAKASLAV*
Ga0136709_10049673	3300011184	Freshwater	MTVNQAKLVNAKASTGEVTVSGKNVKFSARTAKAESFAV*
Ga0164294_105530782	3300013006	Freshwater	MTVNQANKVNAKTSTGEVTVSGKNVKFSARAVKATSFAV*
Ga0164297_101238491	3300013094	Freshwater	VEANLVNAKASTGEVTVSGKNIKFRTLAAKGQSLAV*
Ga0182045_12045561	3300016726	Salt Marsh	MTVNQANLVNAKANTGEVTVSGKNVKFSARTAQRQS
Ga0207193_10061486	3300020048	Freshwater Lake Sediment	MTVNQATYVNAKTSTGEVTVSGKNVKFRTLAAKGQSLAV
Ga0211735_112732652	3300020162	Freshwater	MTVNQANKVNAKTSTGEVTVSGKNIKFSARTVKAESFAV
Ga0214178_10454351	3300020718	Freshwater	MTVNQANLVNAKASTGEVTVSGKNVKFSARTAKADSFAV
Ga0214164_10216101	3300021138	Freshwater	MTVNQANLVNAKANTGEVTVSGKGVKFSARTAKATLAV
Ga0194047_100609483	3300021354	Anoxic Zone Freshwater	MTVNQAKSVNAKASTGEVTVSGKNIKFRTLAAKGQSLAV
Ga0194047_102189141	3300021354	Anoxic Zone Freshwater	MTVNQANLVNANANTGEVTVSGKNIKFRTLAAKGQSLAV
Ga0194047_102767192	3300021354	Anoxic Zone Freshwater	MTVNQAKLVNAKANTGEVTVSGKNVKFSARTAQRQSLAV
Ga0194048_1000093810	3300021519	Anoxic Zone Freshwater	MTVNQAKLVNANANTGEVTVSGKGVKFSARTVKATLAV
Ga0194048_103172031	3300021519	Anoxic Zone Freshwater	MTVNQAKNVNADVNKTVTVTGKNVKFSARTAKEALAA
Ga0212088_101312272	3300022555	Freshwater Lake Hypolimnion	MTVNQANLVNAKASTGEVTVSAKNLKFRTLAAKGQSLAV
Ga0212088_106736262	3300022555	Freshwater Lake Hypolimnion	MTVNQANLVNAKANTGEVTVSGKGVKFSARTAKAESFAV
Ga0214919_1000121443	3300023184	Freshwater	MTVNQANQVNAKASTGEVTVSGKNVKFSARTVKAESFAV
Ga0209616_10100972	3300025091	Freshwater	MTVNQAKLVNAKASTGEVTVSGKNVKFSARTAKAESFAV
Ga0208383_10255333	3300025357	Freshwater	MTVNQAKLVNANANTGEVTVSAKNLKFRTLAAKGQSLAV
Ga0208256_10493622	3300025382	Freshwater	MTVNQAKLVNANANTGEVTVSAKNVKFRTLAAKGQSLAV
Ga0208875_10288143	3300025410	Freshwater	MTVNQAKNLNANASKGEVTVSGKGIRFSARTAQRQTLAV
Ga0208614_10640461	3300025413	Freshwater	MTVNQAKSVNANANTGEVTVSGKNVKFSARSAKATLAV
Ga0208742_10624732	3300025437	Freshwater	MTVNQANYVNAKTSTGEVTVSGKNVKFSARTAQRQSLAV
Ga0208106_100014546	3300025449	Freshwater	MTLNQAKLVNANANTKSGTVTVNGKGVKFSARTAKVALV
Ga0208497_10293604	3300025466	Freshwater	MTVNQANLVNAKANTGEVTVSGKNIKFSARSAQRQSLAV
Ga0208497_10343582	3300025466	Freshwater	NQAKLVNANANTGEVTVSAKNVKFRTLAAKGQSLAV
Ga0209195_10145551	3300025590	Pelagic Marine	VNQAKLVNANANTKGSVTVSGKNIKFSRRGQEAVLA
Ga0208741_100161518	3300025723	Freshwater	MIVNQANLVNAKASTGEVTVSGKNIKFHTLAAKGQSLAV
Ga0209188_10001148	3300027708	Freshwater Lake	MTVNQANLVNAKASTGEVTVSAKNIKFRTLAAKGQSLAV
Ga0209188_101295510	3300027708	Freshwater Lake	MTVNQANLVNATASTGEVTVKANKGIRFSARSTAKAEAFAV
Ga0209297_11902692	3300027733	Freshwater Lake	MTVNQANLVNAKANTGEVTVSGKNVKFSARSVKRQSLAV
Ga0209087_10489071	3300027734	Freshwater Lake	MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQSLAV
Ga0209087_11139742	3300027734	Freshwater Lake	MTANQAKLVNAKASTGEVTVSAKNLKFRTLAAKGQSLAV
Ga0209190_11076511	3300027736	Freshwater Lake	MTVNQANQVNAKASTGEVTVSGKGVKFSARTVKAESFAV
Ga0209084_13287521	3300027749	Freshwater Lake	MTVNQANLVNANANTGEVTVSGKNVKFRTLAAKGQTLAV
Ga0209596_10731322	3300027754	Freshwater Lake	MILNQANLVNANANTGEVTVSGKNIKFRTLAAKGQSLAV
Ga0209829_103132652	3300027777	Freshwater Lake	MTVNQAKLVNANANTGEVTVSGKNVKFRTLAAKGQLLAV
Ga0209500_101662751	3300027782	Freshwater Lake	AMTVNQAKLVNAKANTGEVTVSGKNVKFSTRSVKRQSFAV
Ga0209550_103546942	3300027892	Freshwater Lake	MTVNQANLVNAKANTGEVTVSGKNIKFSARSVKRQSFAV
Ga0209777_102998213	3300027896	Freshwater Lake Sediment	MTLNQAKLVNANANTGEVTVSGKNVKFRTLAAKGQTLAV
Ga0209668_1000171718	3300027899	Freshwater Lake Sediment	MTVNQAKLVNAKASTGEVTVSGKGVKFSARTAKAESFAV
(restricted) Ga0247831_12641351	3300028559	Freshwater	NQANIVNAKTSTGEVTVSGKNVKFSARTVKATLAV
Ga0315293_109319152	3300031746	Sediment	MTVNQAKLVNAKANTGEVTVSGKNVKFSARSVKRQSFAV
Ga0315909_102241432	3300031857	Freshwater	GWGDSAEEAKNVNANVNKTVTVSGKNLKFSARSAKEALAV
Ga0316232_11420382	3300032605	Freshwater	GFLVEEAKLVNANANTGEVTVSAKNVKFRTLAAKGQSLAV

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign