Metagenome Family F089677

Overview

Basic Information

• Family ID: F089677
• Family Type: Metagenome
• Number of Sequences: 108
• Average Sequence Length: 39 residues
• Representative Sequence: NILSTAPQLSISQKALGTLPEDGNVMPKHVEATIHN
• Number of Associated Samples: 12
• Number of Associated Scaffolds: 108

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.95 %
• % of genes near scaffold ends (potentially truncated): 96.30 %
• % of genes from short scaffolds (< 2000 bps): 91.67 %
• Associated GOLD sequencing projects: 12
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (91.667 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (100.000 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 0.00%
  β-sheet: 0.00%
  Coil/Unstructured: 100.00%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 108 Family Scaffolds
PF00078	RVT_1	1.85

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
All Organisms	root	All Organisms	8.33 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
cellular organisms	root	All Organisms → cellular organisms	8.33 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	8.33 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	8.33 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	7.41 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	7.41 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	7.41 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	7.41 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	7.41 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	7.41 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	7.41 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	5.56 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	5.56 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	5.56 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	4.63 %
Collembola	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola	0.93 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	4.63 %
Entomobryomorpha	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola → Entomobryomorpha	0.93 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	4.63 %
Isotomoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola → Entomobryomorpha → Isotomoidea	0.93 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	4.63 %
Isotomidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola → Entomobryomorpha → Isotomoidea → Isotomidae	0.93 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	2.78 %
Proisotominae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola → Entomobryomorpha → Isotomoidea → Isotomidae → Proisotominae	0.93 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.93 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	2.78 %
Folsomia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola → Entomobryomorpha → Isotomoidea → Isotomidae → Proisotominae → Folsomia	0.93 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.93 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	2.78 %
Folsomia candida	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola → Entomobryomorpha → Isotomoidea → Isotomidae → Proisotominae → Folsomia → Folsomia candida	0.93 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.93 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Blaberoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea	0.93 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	0.93 %
Folsomia candida	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola → Entomobryomorpha → Isotomoidea → Isotomidae → Proisotominae → Folsomia → Folsomia candida	0.93 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.93 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Ectobiidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae	0.93 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	0.93 %
Folsomia candida	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola → Entomobryomorpha → Isotomoidea → Isotomidae → Proisotominae → Folsomia → Folsomia candida	0.93 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.93 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Blattellinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae	0.93 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	0.93 %
Folsomia candida	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola → Entomobryomorpha → Isotomoidea → Isotomidae → Proisotominae → Folsomia → Folsomia candida	0.93 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.93 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Blattella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella	0.93 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	0.93 %
Folsomia candida	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola → Entomobryomorpha → Isotomoidea → Isotomidae → Proisotominae → Folsomia → Folsomia candida	0.93 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.93 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.67 %
Blattella germanica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	0.93 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	0.93 %
Folsomia candida	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola → Entomobryomorpha → Isotomoidea → Isotomidae → Proisotominae → Folsomia → Folsomia candida	0.93 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.93 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300009792|Ga0126374_11132314	Not Available	622
3300009792|Ga0126374_11403881	Not Available	569
3300009792|Ga0126374_11725300	Not Available	521
3300009792|Ga0126374_11733894	Not Available	520
3300010043|Ga0126380_10715299	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	807
3300010043|Ga0126380_10727594	Not Available	802
3300010043|Ga0126380_10857100	Not Available	750
3300010043|Ga0126380_11124109	Not Available	671
3300010043|Ga0126380_11129686	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	670
3300010043|Ga0126380_12151934	Not Available	514
3300010043|Ga0126380_12182675	Not Available	511
3300010047|Ga0126382_10042017	Not Available	2609
3300010047|Ga0126382_10049826	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	2445
3300010047|Ga0126382_10054638	Not Available	2360
3300010047|Ga0126382_10057382	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola → Entomobryomorpha → Isotomoidea → Isotomidae → Proisotominae → Folsomia → Folsomia candida	2317
3300010047|Ga0126382_10077979	Not Available	2059
3300010047|Ga0126382_10306044	Not Available	1196
3300010047|Ga0126382_10423771	Not Available	1046
3300010047|Ga0126382_10837073	Not Available	789
3300010047|Ga0126382_10936365	Not Available	753
3300010047|Ga0126382_11022263	Not Available	726
3300010047|Ga0126382_11078389	Not Available	710
3300010047|Ga0126382_11129999	Not Available	697
3300010047|Ga0126382_11139630	Not Available	694
3300010047|Ga0126382_11163706	Not Available	688
3300010047|Ga0126382_11234611	Not Available	671
3300010047|Ga0126382_11258166	Not Available	666
3300010047|Ga0126382_11282186	Not Available	661
3300010047|Ga0126382_11297862	Not Available	658
3300010047|Ga0126382_11314664	Not Available	654
3300010047|Ga0126382_11364845	Not Available	644
3300010047|Ga0126382_11365368	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	644
3300010047|Ga0126382_11371945	Not Available	643
3300010047|Ga0126382_11447290	Not Available	629
3300010047|Ga0126382_11573233	Not Available	608
3300010047|Ga0126382_11598878	Not Available	604
3300010047|Ga0126382_11656684	Not Available	595
3300010047|Ga0126382_11661115	Not Available	595
3300010047|Ga0126382_11670713	Not Available	593
3300010047|Ga0126382_11701263	Not Available	589
3300010047|Ga0126382_11759462	Not Available	581
3300010047|Ga0126382_11761815	Not Available	581
3300010047|Ga0126382_11781863	Not Available	578
3300010047|Ga0126382_11787121	Not Available	577
3300010047|Ga0126382_11831308	Not Available	572
3300010047|Ga0126382_11843549	Not Available	570
3300010047|Ga0126382_11944296	Not Available	558
3300010047|Ga0126382_11952859	Not Available	557
3300010047|Ga0126382_11953334	Not Available	557
3300010047|Ga0126382_11964754	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	555
3300010047|Ga0126382_11966198	Not Available	555
3300010047|Ga0126382_11971943	Not Available	555
3300010047|Ga0126382_11985025	Not Available	553
3300010047|Ga0126382_11987781	Not Available	553
3300010047|Ga0126382_12015816	Not Available	550
3300010047|Ga0126382_12068340	Not Available	544
3300010047|Ga0126382_12165421	Not Available	534
3300010047|Ga0126382_12340037	Not Available	517
3300010047|Ga0126382_12354818	Not Available	516
3300010047|Ga0126382_12360787	Not Available	515
3300010047|Ga0126382_12396395	Not Available	512
3300010047|Ga0126382_12399263	Not Available	512
3300010047|Ga0126382_12413297	Not Available	511
3300010047|Ga0126382_12414931	Not Available	511
3300010047|Ga0126382_12487344	Not Available	505
3300010048|Ga0126373_10110949	Not Available	2552
3300010048|Ga0126373_11894658	Not Available	659
3300010048|Ga0126373_11913856	Not Available	656
3300010048|Ga0126373_12015123	Not Available	640
3300010048|Ga0126373_12106438	Not Available	626
3300010048|Ga0126373_12199084	Not Available	613
3300010048|Ga0126373_12200766	Not Available	613
3300010048|Ga0126373_12547404	Not Available	570
3300010048|Ga0126373_12679474	Not Available	556
3300010048|Ga0126373_12734690	Not Available	551
3300010048|Ga0126373_13023898	Not Available	524
3300010048|Ga0126373_13104533	Not Available	517
3300010048|Ga0126373_13222993	Not Available	508
3300010048|Ga0126373_13226728	Not Available	508
3300010358|Ga0126370_11069277	Not Available	741
3300010358|Ga0126370_11722162	Not Available	604
3300010358|Ga0126370_11828728	Not Available	589
3300010358|Ga0126370_12149843	Not Available	549
3300010358|Ga0126370_12457021	Not Available	518
3300010358|Ga0126370_12533569	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	512
3300010360|Ga0126372_12258091	Not Available	594
3300010361|Ga0126378_12547937	Not Available	584
3300010362|Ga0126377_11300134	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica	799
3300010362|Ga0126377_11314162	Not Available	795
3300010362|Ga0126377_11946554	Not Available	664
3300010362|Ga0126377_12336766	Not Available	611
3300010362|Ga0126377_12356013	Not Available	608
3300010362|Ga0126377_12446092	Not Available	598
3300010366|Ga0126379_11759833	Not Available	724
3300010366|Ga0126379_11976259	Not Available	686
3300010366|Ga0126379_13510772	Not Available	525
3300010366|Ga0126379_13535416	Not Available	523
3300010366|Ga0126379_13695074	Not Available	513
3300010376|Ga0126381_103465221	All Organisms → cellular organisms → Eukaryota → Opisthokonta	620
3300012948|Ga0126375_11465332	Not Available	582
3300012948|Ga0126375_11675618	Not Available	550
3300012948|Ga0126375_11723432	Not Available	544
3300021560|Ga0126371_11691558	Not Available	757
3300021560|Ga0126371_12971949	Not Available	574
3300021560|Ga0126371_13478581	Not Available	532

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	100.00%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	100.00%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	100.00%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	100.00%

Habitat

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	100.00%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0126374_111323141	3300009792	Tropical Forest Soil	PIHNILSTASQLSISQKALETLPEDGNVMPKHAEATTHN*
Ga0126374_114038811	3300009792	Tropical Forest Soil	ILSTSPQLSISQRALGTLPEDGNVMPKHVGVTIHN*
Ga0126374_117253001	3300009792	Tropical Forest Soil	IDNILSTTSQLSIPQKALETVPEDGNVMPKHEEATIHN*
Ga0126374_117338941	3300009792	Tropical Forest Soil	NILSTTPQLSVSQKALGTLPEDCNVMPKHVGATIHN*
Ga0126380_107152991	3300010043	Tropical Forest Soil	VTRHNTPIQNILSTASQLSISQKALETLPDDGNVMPKPAEATTYI*
Ga0126380_107275941	3300010043	Tropical Forest Soil	HNILSTASQMSISQKALETLPEDGNVMPKHAEATIHN*
Ga0126380_108571001	3300010043	Tropical Forest Soil	NILSTTPQFRISQKALGTLPEDGNVMPKHVGATIHN*
Ga0126380_111241091	3300010043	Tropical Forest Soil	HNTPIHNILSTAPQLSISQKALGTLPEDGNVMPKHVGATIHN*
Ga0126380_111296861	3300010043	Tropical Forest Soil	MYGSSYNTPIHNILSTAPELSISQKALGTLPEDGNVMPKHVGATMH
Ga0126380_121519341	3300010043	Tropical Forest Soil	IHNILSTAFQLSISQKALETLPEDRNVMRKHAEATTHN*
Ga0126380_121826751	3300010043	Tropical Forest Soil	TPIHNILSTAPQLSISQKALGMLPEDGNVMPKHVGATIHN*
Ga0126382_100420171	3300010047	Tropical Forest Soil	TPIHNILSTASQLSISQKALETLPEDGNVMPKHAEATTHN*
Ga0126382_100498261	3300010047	Tropical Forest Soil	NILSTASQLSISQKALETLPEDGNVMPKHAEATTRN*
Ga0126382_100546381	3300010047	Tropical Forest Soil	STAPQLSISQKAIGTLPEDGNVMPKHVGPTIHNQ*
Ga0126382_100573821	3300010047	Tropical Forest Soil	SRHNTPIHNILSTASQFSISQKALETLLEDGNVMLKHAEATIYN*
Ga0126382_100779791	3300010047	Tropical Forest Soil	NILSTAPQLSFSQKALGTLPEDGNVMPKHVGATKHN*
Ga0126382_103060441	3300010047	Tropical Forest Soil	VTRHNTPIHNILSTAPQLSISQKALGTLPEDGNVVPKHVRATIHN*
Ga0126382_104237711	3300010047	Tropical Forest Soil	LSTAPQLSISQKALATLPEDGNVMPKHVGATIHN*
Ga0126382_108370731	3300010047	Tropical Forest Soil	ILSTASQLSISQKALETIPEDGNVMPKHAEATIHN*
Ga0126382_109363651	3300010047	Tropical Forest Soil	RHNTPIHNILSTAPQLSISQKAVGTLPEDGNVMPKHVGATMHN*
Ga0126382_110222631	3300010047	Tropical Forest Soil	YVFEKITVPQLSISQKALGMLPEDKNVMPKHVGDTIHN*
Ga0126382_110783891	3300010047	Tropical Forest Soil	EEPIHNILSTASQLSISQKALETLPEDGNVMPKHAEATILN*
Ga0126382_111299991	3300010047	Tropical Forest Soil	NILPTAPQLSISQKALGTLPEDGNVMPKHVGATIHN*
Ga0126382_111396301	3300010047	Tropical Forest Soil	HNILSTASELSISQKELETLPEDGNVMPKHAEATIHN*
Ga0126382_111637061	3300010047	Tropical Forest Soil	PIHNILSTASQLSISQKALETLPEDGNVMLKHAEATTHN*
Ga0126382_112346111	3300010047	Tropical Forest Soil	IHNILSTAPQLSISQKALGTLTEDGNVMPKHVGATTHN*
Ga0126382_112581661	3300010047	Tropical Forest Soil	NTSIHNILSTTPQLSISQKALGTLPEDGNVMPKHVGATIHS*
Ga0126382_112821861	3300010047	Tropical Forest Soil	NTPIHNILSTASQLNISQKALEPLPEDGNVMPKHAEATIHN*
Ga0126382_112978622	3300010047	Tropical Forest Soil	LVTAPQLSISQKALGKLPEDSNVMPKHVGATIRN*
Ga0126382_113146641	3300010047	Tropical Forest Soil	IVDGRVRHNTSIHNILSTAPQLNISQKALGTLPEDANVMPKHVGATIHN*
Ga0126382_113648451	3300010047	Tropical Forest Soil	FHNILSTPSQFSISQKALETLPVDGNVMPKHAEATIHN*
Ga0126382_113653682	3300010047	Tropical Forest Soil	GVSGVHNILSTAPQLRISQKALGMLPEDGNVMPKHVGVTIHN*
Ga0126382_113719451	3300010047	Tropical Forest Soil	TRNNTPIYNILSTAAQLRISHKVLGTLPEDGNVMPKHVGDAIHNQ*
Ga0126382_114472902	3300010047	Tropical Forest Soil	TRHNTPIQNILATASQLSISQKALETLPEDGNVMPKHAGATIHN*
Ga0126382_115732331	3300010047	Tropical Forest Soil	HNILSTVPQLSIFQEALGTLPEIGNVMPKHVGATIHN*
Ga0126382_115988781	3300010047	Tropical Forest Soil	TTSLDTTRHIHNNLSTAPQLNITQKALGMLPEDGNVMPKHVGATIHN*
Ga0126382_116566841	3300010047	Tropical Forest Soil	ILSTASQFSISQKALETLPEDGNVMPKHAEATTHN*
Ga0126382_116611151	3300010047	Tropical Forest Soil	IHNILLTAPQLSISQKALGSLPEDGNVMPKHVGATIRN*
Ga0126382_116707131	3300010047	Tropical Forest Soil	NILSTAPQLSISQKALGTLPEDGNVMPKHVGAIIHN*
Ga0126382_117012631	3300010047	Tropical Forest Soil	PIHNILSTAPQLSIYQKALETLPEDGNVMPKHAEATIHN*
Ga0126382_117594621	3300010047	Tropical Forest Soil	IHNILSTASQLSFSQKALGTLPEDGNVMPKHVGATIHD*
Ga0126382_117618151	3300010047	Tropical Forest Soil	IHNILSTASQLSISQKALETLHEDGNVMPKHAEATIHN*
Ga0126382_117818631	3300010047	Tropical Forest Soil	HNILSTASQLSISQKALETLPEDGKVMPKHVEATTHN*
Ga0126382_117871211	3300010047	Tropical Forest Soil	TSIHNILSTAPQLSISQKALGTLPEDGNVMPKYVVATIHN*
Ga0126382_118313081	3300010047	Tropical Forest Soil	IHNILSTASQLSISQKALETLPEDGNVMPKHAEATIHN*
Ga0126382_118435492	3300010047	Tropical Forest Soil	LSTASQLSISQKALETLPEDGNVMPKHAEATTHN*
Ga0126382_118752451	3300010047	Tropical Forest Soil	IHNILSIASQLSISQKALETLPKDGNVMLKRAEATIHN*
Ga0126382_119442961	3300010047	Tropical Forest Soil	NILSTAPQLIISQNALRTLPEDSSVMPKHVEATIHN*
Ga0126382_119528591	3300010047	Tropical Forest Soil	HRVTRHNTPIHNILSTASQLTISQKALETLPEDGNVMPKHAEATIHN*
Ga0126382_119533341	3300010047	Tropical Forest Soil	HNILASQLSISQKALETLPEDGNVIPKHAEATTYN*
Ga0126382_119647541	3300010047	Tropical Forest Soil	HHDTRQNTPIHNILSTASQLSISQKALETLPDDGNVMPKHAEATIHN*
Ga0126382_119661981	3300010047	Tropical Forest Soil	LSTALQLSISQKALGTLPEDGNVMPKHVGATIHN*
Ga0126382_119719431	3300010047	Tropical Forest Soil	ILSTAPQLSISQKALGTLPEDGNVMPKHVGATTHNQ*
Ga0126382_119850251	3300010047	Tropical Forest Soil	IHNILSTASQLSIAQKALETLPEDGNVMPKHAEATIHN*
Ga0126382_119877811	3300010047	Tropical Forest Soil	ILSTASQLSISQKALETLPEDGNVMPKHEEATIHN*
Ga0126382_120158161	3300010047	Tropical Forest Soil	NTPIHNILSTAPQLSISQKALGTLPEDGNVMQKHVGATIHN*
Ga0126382_120683401	3300010047	Tropical Forest Soil	RHNTPIHYILSTAPQLSVSQKALGTLPEDGNVMPKHAEATIHN*
Ga0126382_121654211	3300010047	Tropical Forest Soil	IHNILSTAPQLSISQKALGMLPENGNVMPKHVGATIHN*
Ga0126382_123400371	3300010047	Tropical Forest Soil	TPIHNILSTASQLSISQKALETLPEDGNVMPKHAAVTIHN*
Ga0126382_123548181	3300010047	Tropical Forest Soil	RHNMPIHNILSTAPQLSISQKALGTLPEDGNVMPKHVGATMHD*
Ga0126382_123607871	3300010047	Tropical Forest Soil	PIHNILSTAPQRSISQMALGTLPEDGNVLPKHVAATIHN*
Ga0126382_123963951	3300010047	Tropical Forest Soil	VTGHNTPIHNILSTASQLSVCQKALETLPEDGNVMPKHAETTTHN*
Ga0126382_123992631	3300010047	Tropical Forest Soil	HNTPIHNILSTASQLSISQKALEALPEDGNVMPKHAEATIHN*
Ga0126382_124132971	3300010047	Tropical Forest Soil	SIHNILSTAPQLSISQEALGTLPEDGNVMPKHVGATIHN*
Ga0126382_124149311	3300010047	Tropical Forest Soil	RHNTASQLSTSQRALETLPEDGNVMLKYAEATIHN*
Ga0126382_124873441	3300010047	Tropical Forest Soil	ILSTDPQMSISQKALGTIHEDDNVMPKHLGATIHN*
Ga0126373_101109491	3300010048	Tropical Forest Soil	ILSTASQLSISQKALETLPEDGNVMPKHAEATIRN*
Ga0126373_118946581	3300010048	Tropical Forest Soil	NTPIHNILSTAPQLSIFQKALGTLPEDGNVMPKHVGATIHNE*
Ga0126373_119138561	3300010048	Tropical Forest Soil	NTPIHNILSTAPQLSIFQKALRTLPEDGNVMPKHVGAAIHNK*
Ga0126373_120151231	3300010048	Tropical Forest Soil	TKHNTPIHNILSTAPQLSISQKALGTLPEDGNVIPKHVGATIHN*
Ga0126373_121064381	3300010048	Tropical Forest Soil	HIHNIISTAPQFIISQKALGTLPEDGNVMPKHVGATIHN*
Ga0126373_121961092	3300010048	Tropical Forest Soil	MEDIRKYASQLSISQKALETLPEDGNVMPKRAEATIHN*
Ga0126373_121990841	3300010048	Tropical Forest Soil	LSTAPKLSISQKALGTLPEDSNVMPKHVGATIHN*
Ga0126373_122007661	3300010048	Tropical Forest Soil	PIHNILSTASQLSISQKALETLPEDGNVMPKHAEATVHN*
Ga0126373_125474041	3300010048	Tropical Forest Soil	LSTAPQLSIFQKALGTLPEDGNVMPKHVGATIHN*
Ga0126373_126794741	3300010048	Tropical Forest Soil	GAPAPQLSISQKALGTLLEDGNLMPKHVGATIHNS*
Ga0126373_127346902	3300010048	Tropical Forest Soil	VSNDVVLETAPQLSISQKALGTLPEDGNVMPKHIGATINN*
Ga0126373_130238981	3300010048	Tropical Forest Soil	IYNILSTAPQLSIFQKALRTLPEDGNVMPKHVGAAIHN*
Ga0126373_131045331	3300010048	Tropical Forest Soil	LSTASQLSIGQKALETLPEDGNVMPKHAEATIHN*
Ga0126373_132229931	3300010048	Tropical Forest Soil	NIPSTASQLRISQKALETLPEDGNVMPKHAEATIHN*
Ga0126373_132267281	3300010048	Tropical Forest Soil	TAPQLSISQKALGTLPEDGNVMPKHVGATIHNKLNE*
Ga0126370_110692771	3300010358	Tropical Forest Soil	YNILSTAPQLSISQKALGTLPEEGNVLPKHVGATIHN*
Ga0126370_111288321	3300010358	Tropical Forest Soil	TRHNTPIHNILSTAPQLSISQKALGTLPEDVNVMPKHVGATIHN*
Ga0126370_117221621	3300010358	Tropical Forest Soil	PRTTSLDKTPIHNILSSAPQLSISQKALGTLPEDGNVMPKHAEATIHN*
Ga0126370_118287281	3300010358	Tropical Forest Soil	HNTPIHNILSTARQLSISQKALGTLPENGKIIPKHAGDHHAPRQ*
Ga0126370_121498431	3300010358	Tropical Forest Soil	PIHNILSTAPQLSISQKALGTLPEDGNVMPKHIGGTIHN*
Ga0126370_124570211	3300010358	Tropical Forest Soil	NILSTAPQLSISQKTLGTFPEDSNVMPKHVGATIHN*
Ga0126370_125335691	3300010358	Tropical Forest Soil	ILSTASQLNISQKELETLPEYGNVIPKHAEVTIHN*
Ga0126372_122580911	3300010360	Tropical Forest Soil	NTPIHNILSTASQLSISQKALETLPEDANVMPKHAEAN*
Ga0126378_125479371	3300010361	Tropical Forest Soil	ILSTAPQLSIFQKALGTLPEDGNVMPKHVGATIHN*
Ga0126377_113001341	3300010362	Tropical Forest Soil	IHNILSTASQLSISQKALETLPEDGNVMPKHAEATTHN*
Ga0126377_113141621	3300010362	Tropical Forest Soil	NILSTAPQLSISQKALGTLPEDGNVMPKHVEATIHN*
Ga0126377_119465542	3300010362	Tropical Forest Soil	EVYYVTRHNTPIYNILSADPHLSIFKKALGTLPEDGNVMPKYVGAAIHN*
Ga0126377_123367661	3300010362	Tropical Forest Soil	NILSTAPQFSISQKALGTLPEDGNVMPKHVGATIHN*
Ga0126377_123560131	3300010362	Tropical Forest Soil	HNILSTAPQLRISQKSLGTLSEDGNVMPKHEGATIHN*
Ga0126377_124460921	3300010362	Tropical Forest Soil	LSTAPQLSISRKALGTLPGDTNVMPKHVGATIHN*
Ga0126379_117598331	3300010366	Tropical Forest Soil	ILSTATQFSISQKALGTLPENGNVMPKHVGATIYN*
Ga0126379_119762591	3300010366	Tropical Forest Soil	HNTLSTVSPLNISQKALETPPEDGNVMTKHAEATIHN*
Ga0126379_135107721	3300010366	Tropical Forest Soil	ILSTDPQLSISQKALGTLPEDRNVMPKHVGATINH*
Ga0126379_135354161	3300010366	Tropical Forest Soil	LSTAPQFSIFQKALGTLPEDGNVMPKHVGASIHN*
Ga0126379_136950741	3300010366	Tropical Forest Soil	HNILPTAPQLSISQKALGTLPEDGNVMPKHVRATIYN*
Ga0126381_1034652211	3300010376	Tropical Forest Soil	ILSTAPQLSISQKALGTLPEDGNVMPKHVAATIHN*
Ga0126375_114653321	3300012948	Tropical Forest Soil	TPIHSILSTASQLSICQKALETLPEDGNVMPKHAEATIHN*
Ga0126375_116756181	3300012948	Tropical Forest Soil	NILSTAAQLNISQKALGTLPEDDNVIPKHVGAIIHN*
Ga0126375_117234321	3300012948	Tropical Forest Soil	MLN*VTRHNTPIHNILSTAPQFSISQKAPETLPEDGNAMPKQVG
Ga0126371_116915581	3300021560	Tropical Forest Soil	QNILSTASQLSISQKALETLPEDGNVMPKHAEVTTHN
Ga0126371_129719491	3300021560	Tropical Forest Soil	TPIQKILSTAPEVSISEKALGTLPEDENVMPKHVGGTIHN
Ga0126371_134785812	3300021560	Tropical Forest Soil	MLSTAPQLSISQKALGMLPEDGNVMPKHVGAATHN