NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089623

Metagenome / Metatranscriptome Family F089623

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089623
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 117 residues
Representative Sequence MAFISHIPPLEGGNYRVWREKYELALMLSENDLALTSPCPTEPVDPVREKNESDADFIARQRDHAEVRMKYDLEHKKWDISNRKCLMVAKSTISDAIRGSILDCDTATEYLKKVES
Number of Associated Samples 61
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 62.96 %
% of genes near scaffold ends (potentially truncated) 65.74 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 61
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.074 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere
(96.296 % of family members)
Environment Ontology (ENVO) Unclassified
(96.296 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(96.296 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.75%    β-sheet: 2.78%    Coil/Unstructured: 53.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF14223Retrotran_gag_2 7.41



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.07 %
UnclassifiedrootN/A0.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300014745|Ga0157377_11185228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum590Open in IMG/M
3300015269|Ga0182113_1010537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum954Open in IMG/M
3300015269|Ga0182113_1064441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum571Open in IMG/M
3300015269|Ga0182113_1074212All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum547Open in IMG/M
3300015269|Ga0182113_1087973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum519Open in IMG/M
3300015274|Ga0182188_1020760All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum669Open in IMG/M
3300015274|Ga0182188_1036435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum580Open in IMG/M
3300015275|Ga0182172_1026553All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae680Open in IMG/M
3300015276|Ga0182170_1010215All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum881Open in IMG/M
3300015281|Ga0182160_1074424All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum521Open in IMG/M
3300015282|Ga0182124_1074940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae517Open in IMG/M
3300015282|Ga0182124_1078398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum510Open in IMG/M
3300015283|Ga0182156_1026880All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum709Open in IMG/M
3300015285|Ga0182186_1076772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum515Open in IMG/M
3300015286|Ga0182176_1053745All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum583Open in IMG/M
3300015286|Ga0182176_1085462All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum501Open in IMG/M
3300015287|Ga0182171_1014626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum833Open in IMG/M
3300015287|Ga0182171_1075808All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum527Open in IMG/M
3300015288|Ga0182173_1042591All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum618Open in IMG/M
3300015291|Ga0182125_1004606All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum1163Open in IMG/M
3300015291|Ga0182125_1076110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae538Open in IMG/M
3300015292|Ga0182141_1024546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum742Open in IMG/M
3300015292|Ga0182141_1075935All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum537Open in IMG/M
3300015292|Ga0182141_1083267All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum522Open in IMG/M
3300015294|Ga0182126_1062370All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae573Open in IMG/M
3300015295|Ga0182175_1032236All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae699Open in IMG/M
3300015295|Ga0182175_1049100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum620Open in IMG/M
3300015298|Ga0182106_1042938All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae655Open in IMG/M
3300015299|Ga0182107_1041356All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum665Open in IMG/M
3300015299|Ga0182107_1042083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum662Open in IMG/M
3300015299|Ga0182107_1084706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae537Open in IMG/M
3300015300|Ga0182108_1049087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae638Open in IMG/M
3300015302|Ga0182143_1017752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum840Open in IMG/M
3300015303|Ga0182123_1004764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum1154Open in IMG/M
3300015305|Ga0182158_1025711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum757Open in IMG/M
3300015308|Ga0182142_1092731All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum538Open in IMG/M
3300015321|Ga0182127_1041744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum706Open in IMG/M
3300015321|Ga0182127_1100426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum539Open in IMG/M
3300015321|Ga0182127_1123616All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae503Open in IMG/M
3300015322|Ga0182110_1038812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum718Open in IMG/M
3300015322|Ga0182110_1089655All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae558Open in IMG/M
3300015323|Ga0182129_1034478All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum722Open in IMG/M
3300015323|Ga0182129_1082521All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum559Open in IMG/M
3300015341|Ga0182187_1026934All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum999Open in IMG/M
3300015341|Ga0182187_1197827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum504Open in IMG/M
3300015344|Ga0182189_1172160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum561Open in IMG/M
3300015345|Ga0182111_1095355All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum721Open in IMG/M
3300015345|Ga0182111_1215618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum528Open in IMG/M
3300015346|Ga0182139_1141356All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum623Open in IMG/M
3300015347|Ga0182177_1140744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum626Open in IMG/M
3300015347|Ga0182177_1229856Not Available518Open in IMG/M
3300015347|Ga0182177_1239282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae510Open in IMG/M
3300015351|Ga0182161_1053539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum936Open in IMG/M
3300015351|Ga0182161_1213965All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum550Open in IMG/M
3300015351|Ga0182161_1239082All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum526Open in IMG/M
3300015355|Ga0182159_1204558All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum637Open in IMG/M
3300015355|Ga0182159_1265312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum568Open in IMG/M
3300015355|Ga0182159_1299629All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum539Open in IMG/M
3300015361|Ga0182145_1024346All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum986Open in IMG/M
3300015361|Ga0182145_1172201All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae523Open in IMG/M
3300015361|Ga0182145_1183382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum512Open in IMG/M
3300017404|Ga0182203_1150448All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum517Open in IMG/M
3300017407|Ga0182220_1104139All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum508Open in IMG/M
3300017409|Ga0182204_1116702All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum506Open in IMG/M
3300017410|Ga0182207_1144199All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum539Open in IMG/M
3300017413|Ga0182222_1032686All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae686Open in IMG/M
3300017415|Ga0182202_1088828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum582Open in IMG/M
3300017415|Ga0182202_1094746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum570Open in IMG/M
3300017415|Ga0182202_1111656All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum541Open in IMG/M
3300017417|Ga0182230_1069895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum627Open in IMG/M
3300017417|Ga0182230_1072066All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum619Open in IMG/M
3300017420|Ga0182228_1043584All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum753Open in IMG/M
3300017420|Ga0182228_1068390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae634Open in IMG/M
3300017424|Ga0182219_1098205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum563Open in IMG/M
3300017424|Ga0182219_1116294All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum533Open in IMG/M
3300017425|Ga0182224_1124000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum553Open in IMG/M
3300017427|Ga0182190_1022793All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum972Open in IMG/M
3300017427|Ga0182190_1132913All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum542Open in IMG/M
3300017427|Ga0182190_1150092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum519Open in IMG/M
3300017430|Ga0182192_1132809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae552Open in IMG/M
3300017430|Ga0182192_1170798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae505Open in IMG/M
3300017433|Ga0182206_1052387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum715Open in IMG/M
3300017433|Ga0182206_1056840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae697Open in IMG/M
3300017433|Ga0182206_1076340All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum636Open in IMG/M
3300017433|Ga0182206_1082736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum620Open in IMG/M
3300017433|Ga0182206_1104906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum575Open in IMG/M
3300017436|Ga0182209_1103277All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum596Open in IMG/M
3300017438|Ga0182191_1133123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae561Open in IMG/M
3300017442|Ga0182221_1070625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum661Open in IMG/M
3300017442|Ga0182221_1084232All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum626Open in IMG/M
3300017443|Ga0182193_1078363All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum689Open in IMG/M
3300017443|Ga0182193_1100599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum635Open in IMG/M
3300017443|Ga0182193_1108329All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum619Open in IMG/M
3300017443|Ga0182193_1128007All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae585Open in IMG/M
3300017680|Ga0182233_1062348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum663Open in IMG/M
3300017680|Ga0182233_1070752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum626Open in IMG/M
3300017682|Ga0182229_1088684All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum542Open in IMG/M
3300017683|Ga0182218_1064535All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum657Open in IMG/M
3300017683|Ga0182218_1144070All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum513Open in IMG/M
3300017685|Ga0182227_1129262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum512Open in IMG/M
3300017686|Ga0182205_1099363All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum605Open in IMG/M
3300017689|Ga0182231_1052580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum765Open in IMG/M
3300017689|Ga0182231_1108736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum538Open in IMG/M
3300017690|Ga0182223_1048482All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum652Open in IMG/M
3300017690|Ga0182223_1063546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum606Open in IMG/M
3300020081|Ga0206354_11513123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae600Open in IMG/M
3300026089|Ga0207648_12209939All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum511Open in IMG/M
3300026118|Ga0207675_101605904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum671Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Miscanthus PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere96.30%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015269Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015274Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015275Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015276Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015281Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015282Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015283Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015285Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015286Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015287Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015288Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015291Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015292Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015294Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015295Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015298Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015299Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015300Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015302Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015303Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015305Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015308Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015321Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015322Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015323Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015341Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015344Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015345Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015346Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015347Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015351Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015355Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015361Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017404Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017407Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017409Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017410Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017413Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017415Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017417Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017420Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017424Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017425Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017427Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017430Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017433Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017436Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017438Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017442Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017443Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017680Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017682Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017683Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017685Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017686Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017689Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017690Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0157377_1118522813300014745Miscanthus RhizosphereMAFISHILPLEGGNYRVWREKYELALALSENDLALTFPCPTEPVDLVREDNETDADFTAWRRDHTEVWMKYDLERKQWDISNRKCLIVVTSTISDVIRGSILDCDTVIEYLKKVESS
Ga0182113_101053723300015269Miscanthus PhyllosphereMAFISHIPSLEGGNYRVWRKKYELSLALSENDLALTSPYSTKPVDLVREGNETDADFTARWRDHAEVRMKYDPEHKKWDILNHKCLMVAKSTISDMIRGSILDCDTA
Ga0182113_106444113300015269Miscanthus PhyllosphereMAFISHIPSLEGDNYKVW*EKYELVLALSENDLTLTSPCPTEPVDPVREENETDADFTARQRDHVEVRMKYDLERKK*DISNHKCLMLAKSTISD
Ga0182113_107421213300015269Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALVLSENDLALTSPCPTKLVDPVREENESDADFTARQRDHAEVRMKYDLERKKWDISNRKCLMVAKSTILDAIRGSIPDCDTATEYLKKVKS*
Ga0182113_108797313300015269Miscanthus PhyllosphereMTFISHIPPLERGNYRVWREKYELPLALSENNLALTFTCPTEPVDPVREENETDADFTARQLYHVKVRVKYDLELKKWDISNRKCLMVAKSTILYAIRGSIPDYNTATEYLKKVE
Ga0182188_102076013300015274Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALALSENDLALTSPCPTEPEDPVRAENETDADFTARKRDHVEVRMKYDLDRNKWDISNRKCLMVAKSTISDAIRGLIPDCDTATEYLKKVESQFTGSLKAYSSILIKKLCNEKYSGEGIKEHI
Ga0182188_103643513300015274Miscanthus PhyllosphereLKEGNYRVWQEKYELALTLSENDLALTSPCPTEPVDPVREENETDTNFTTRQRDHAEVRIKYDLERKKWDISNRKCLMVAKSTISDAIRGSIPDCDTAREYLKKVES*
Ga0182172_102655313300015275Miscanthus PhyllosphereMFSGLNPMAFISHISPLEGGNYRVWREKYELALSLSENDLALTSSCPTEPVDPVREENETDDDFTARQRDHAEVRMKYDLDRKKWDISNHKCLMVVKSTISYATRRSILDYDTA
Ga0182170_101021523300015276Miscanthus PhyllosphereMAFISHILPLERGNYRVWREKYELALALSKNDLALTSPCPTEPVDPVREDNETDADFTTQQQDHAEVRMKYDLKHKKWDISNRKCLMVAKSIISDAIRGYISYCDTTTEYLKKV*
Ga0182160_107442413300015281Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALALLENDLTLTSPCPTEPVDPMREENETDADFTTRQRDHAEVRMKYDIERKKWDISNHKCLIVAKSSILDAIRGSIPYCDTTT*
Ga0182124_107494013300015282Miscanthus PhyllosphereMAFISHIPPLEGGNYRV*REKYELALALSENDLALTSPCPTKPEDSVRVENETDADFNARK*DHVEVRMKYDLDRKKWDISNHKCLMVAKSTISDVIRGSILDCDTDMEYLKKVES
Ga0182124_107839813300015282Miscanthus PhyllosphereFISHIPPLEGGNYRVWREKYELALALSENDIALTSPCPTEPVDPVREENESNADFTARQRDHAEVRMKYDLERKKWDISNRKCLMMAKSTISDAIRGSILDCDTAIEYLKKVDS*
Ga0182156_102688013300015283Miscanthus PhyllosphereMAFISHIPSLEGGNYRVWREKYELALALSENDLALTSPCPTEPVDPVREDNETNADFTARQRDHAEVRMKYDLKCKKWDISNRKCLMVPKSTILDAIRGSILDCD
Ga0182186_107677213300015285Miscanthus PhyllosphereMAFISYIPPLEGGNYGVWREKYELTLALSENDLALTSPCPTELEDPARAENETDADFTAQKRDHAEVRMKYDLDRKKWNILNRKCLMVAKSTISDAIRGSILDCDTATEYLKKVESQFTSSSKAYASTL
Ga0182176_105374513300015286Miscanthus PhyllosphereMFFLTISDSVFSGLNPMAFISYVPPLEGGNYRVW*EKYELSLALSANDLALDSPCPTELVDPVREENETDADFTARQRDHAEVRMKYDLERKEWNISNRKCLMVAKSTIQMQ*
Ga0182176_108546213300015286Miscanthus PhyllosphereMAFISHRPSLEGGNYRVWREKYELALALSENDLALTFPCPTEPVDPVREENESDADFTARQRDHAEVRMKYDLEHKKWDISNRKCLMVAKSTILDVIRGSILDCDTATEYLKKVESQFTGSSKAYVNSLIKKLFNEKYSGGGIREQILKMSNTAL
Ga0182171_101462613300015287Miscanthus PhyllosphereMAFISHIPPLDGGNYRVWQEKYELTLALSENDLALTSSCPTKLEDPMRAQNKTDADFNARKRDHAEIRIKYDLDRKKWDISNRKCLMVAKSTISDAIRGSIPDCDTATEYFKKVENKFTGSSK
Ga0182171_107580813300015287Miscanthus PhyllosphereMVISSSSSGTLVLVPDKYELALALSKNDLALISPCPTEPVDPVREENETDADFTTRKRDHAQVRMKYDLECKKWDILNHKCLMVAKSTISDAIRGSIPDCNTTTEYLKKVESQFNGSSK
Ga0182173_104259113300015288Miscanthus PhyllosphereMAFISHIPSLEGGNYRVWRKKYELSLALSENDLALISPCPTEPVNPVREDNETDADFTARQRDHAEVRMKYDLECKKWDILNRKCLMVAKSTISDAIRWSIPDC
Ga0182125_100460613300015291Miscanthus PhyllosphereMAFISHIPPLEGGNYRVRREKYELALALSENDLALTSQCPTEPVDPVREDNNTDADFIARQRDHAEVRMKYDLECKKWDILNRKCLMVAKSTISDAIRWSIPDCDTAIEYLKKVESQFTSTSKAYSSTLIKK
Ga0182125_107611013300015291Miscanthus PhyllosphereMAFIWHIPPLEGGNYRVWREKYELALALSENDLALTSPCPTEPEDPVRAENKIDADFNARKRDHAEVRKKYDLDRKKWDISNRKRLMVAKSTISYAIRGSIPDYDTATEYLKIVE
Ga0182141_102454613300015292Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKCELTLALSENDLALTSPCPTKPMDPVRKENEFDADFTARQRDHAEVRMKYDLEHKKWDISNHKCLMVAKSIILDAIRGSILDCDTAT*
Ga0182141_107593513300015292Miscanthus PhyllosphereMTFISHIPPLEGDNYWVWREKYELALALSENDLVLTSPCLTEPVVLVREENEIDADFTARQRDHAKVRMKYDLEHKKWDISNYKCLMVAKSTISDAIRGSIPDCDTANRVS*
Ga0182141_108326713300015292Miscanthus PhyllosphereMAFILHIPPLEGDNYRVWREKYELALALSENDLALTSPYPTKPVDPVREENESDADFIARRRDHAEVRMKYDLEHKKLNISNRKCLMVAKSTILDAIRGSI
Ga0182126_106237013300015294Miscanthus PhyllosphereMALISHIPPLEGSNYRVWREKYELALALSENDLALTSPCPTEPEDLVRAENETDANFNARKRDHAEVRMKYDLDQKKWDISNRKCLMVAKSTILDAIRGSI
Ga0182175_103223613300015295Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALSLSENDLALTSPCLTEPEDPVRAENETDADFTARKRDHTEVRMKYDLDRKKWDISNRKCLMVAKSTISDA
Ga0182175_104910013300015295Miscanthus PhyllosphereWCFSGLNTMAFISHIPPLEGGNYRVWQEEYELGLVLSKNDLALTSSCPTKPVDPVREENKTDADFTARQRDHAEVRMKYDLDRKKWDILNRKCLMVAKSTISDAIRGSISDCDTATDYLKAVESVYLLFKGLCKHPEQEVIQ*
Ga0182106_104293813300015298Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALALSENDLALTSLCPTELEDPVRAENEIDVVFTARKRDHAEVRMKYDLDQKKCDISNHKCLMVAKSTISDVIRGSILDCDTDMEYLKKVE
Ga0182107_104135623300015299Miscanthus PhyllosphereMAFILHIPSLEGGNYRVWREKYELALALFENDLALTSPCSTELVDPVREDNETDADFTAQQQDHAEVRMKYDLEHKKWDISNLKCLMVAKSIISYAIRGFIPDCDAATEYLRNVESQFT
Ga0182107_104208313300015299Miscanthus PhyllosphereMFSGLNPMTFISHIPPLEGGNYRVWREKYELALALSENDLALTSPCPTEPVDPMREENKTDADFTARQRDHTEVRMKYDLDRKKWDILNRKCLMVAKSTISDAIRGSIPDCDTATKYF*
Ga0182107_108470613300015299Miscanthus PhyllosphereMMFSRLNPMAFISHIPPLEGGNYRVWREKYELVLALSENDLALTSPCPTEPVDPVRAENETDADFTARQRDHAEVRIKYDLDRKKWDISNHKCLMVAKSTILDAIRGSIPDYDIVT*
Ga0182108_104908713300015300Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALALFENDLALTSLCPTEPEDPVRAENKTDADFNAQKRVHAEVRMKYDLDRKKWDISNRKCLMVAKSTILDAIRGSIPDCDTATEYLKKVES*
Ga0182143_101775213300015302Miscanthus PhyllosphereMFSRLNPIAFISYIPPLEGGNSRVWQEKYELALALSENDLALTSPCPTEPVDPVRAENETDADFTARQRDHAEVRMKYDLDHRKWDISNHKCLMVARSTILDVIRGSILDCDTATEYLKKVKSQFTGSSKAHASTLIKKLFNE
Ga0182123_100476423300015303Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWQEKYELALALSENDLALTSLCPTEPMDPVREENESDADFTARQRDHAEVRMKYDLECKKWDISNRKCLMVAKCTMSDAIKGSIPDCDTATEYLKKVESQFIGSSKAYTSTLIKKLFNKNILVAVSENTF*
Ga0182158_102571123300015305Miscanthus PhyllosphereFSGLNLMAFISHIPPLEGGNYRVW*EKYELALTLSENDLALTSSCPTEPVDPVREENKTDADFTARQRDHAEVRKKYDLERKKWDISNRKCLMVAKSTILDAIRGSILDCDTTIKYLKKVES*
Ga0182142_109273113300015308Miscanthus PhyllosphereMIFSGLNPMAFILHIPPLEGDNYRVWREKYELALALSENDLALISSCPTEPVDPVRTENKTDVDFTARQLDHAEVRIKYDLDRKKWDISNHKYLMVAKSTILDEQGDQ
Ga0182127_104174423300015321Miscanthus PhyllosphereMAFILHIPPLEGDNYRVWRVKYELALALSENDLALTSSCLTEPVDPVREDNETDADFTARQRDHAEVRMKYDLECKKWDISNRKCLMVAKSIISDAIRGSPRL*
Ga0182127_110042613300015321Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALALSENDLALTSSCPTEPVDPVGEENECDADFTARQRDHAEVRMKYDLERKKWDISNCKCLMVAKSTISDAIRGSILDYDTATEYLKKVESQF
Ga0182127_112361613300015321Miscanthus PhyllosphereMAFISHIPPLEWVNYIVWREKYELALALSKNDLALTSPCPTEPEDLVRAENETDADFNARKRDHAEVRMKYDLDRKKWDISNRKCLMVAKSTISDAIRG*
Ga0182110_103881213300015322Miscanthus PhyllosphereMQLLCHIFSLSLTLFSGLNPMAFISHIPPLEGGNYRVWREKYELALALSENDIALTSPCPTEPVDLVREDNETDADFTARQRDHAEVRMKYDLECKKWDISNSKCLMMAKSTILDAIRGSIPDCDTATEYLMKVESQFTSSSKT
Ga0182110_108965513300015322Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKCELTLALSENDLALTSPCPTVSEDPVRTENKTDADFNARKQDHTEVRMKYDLDRKKWDISNRKRLMVAKSTISYAIRGSIPDYDTATEYLKIVES
Ga0182129_103447823300015323Miscanthus PhyllosphereMAFISHIAPLEGGNYRVWREKYELALALFENDLALTSPCPTEPVDPVREDNETDADFTARQRDHAEVRMKYDLERKKWDISNHKCLMVAKSTISDVIRGFIPDCDTTTEYLKKVESQLTCSSKAYASILIKKLFNEKYTSGI*
Ga0182129_108252113300015323Miscanthus PhyllosphereGGNYRVWREKYELALALSENDLALTSQCPTEPVDPVREDNNTDADFIARQRDHAEVRMKYDLECKKWDILNRKCLMVAKSTISDAIRGSILECDTAIEYLKKVES*
Ga0182187_102693413300015341Miscanthus PhyllosphereMTFISHIPPLEGDNYRVWRDKYELALTLSENDLALIYPCPTELVDLVREENETDTDFTTRQRDHAEVRIKYDLERKKWDISNYKCLMVAKSTISDAIRGSILDCDTAREYLKKVES*
Ga0182187_119782713300015341Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALMLSENDLALTSPCPTEPVDPVREKNESDADFIARQRDHAEVRMKYDLEHKKWDISNRKCLMVAKSTISDAIRGSILDCDTATEYLKKVES*
Ga0182189_117216013300015344Miscanthus PhyllosphereMFSGLNPMAFISHIMPLEGGNYRVWREKYELALALSENDLALTSSCPTEPEDLVRVENETDADFNARKRDHAEVRMKYDLDRKKWDISNRKCLMVAKSTISDAIRGSILDCDTAIEYLKKVESQFTSSSKAYVSNLIKKLFNEKYIGGGIREH
Ga0182111_109535513300015345Miscanthus PhyllosphereMTFISHIPPLEGDNYRVWRDKYELALALPENDLALTSPCPTEPVDPMREENETDTDFTTRQRDHAEVRIKYDLERKKWDISNYKCLMVAKSTISDAIRGSIPDCDTANRVS*
Ga0182111_121561813300015345Miscanthus PhyllosphereMVFSGLNPMAFISHILPLEGANYRVW*EKYELALALSDNDLALTSPCPTKPVDSVREENESDAYFTARE*DHTEVRMKYDLERKKWDISNRKCLMVARSTILDTIRGSIPDYDTAIEYLK
Ga0182139_114135613300015346Miscanthus PhyllosphereMAFILHIPPLERGNYRVWREKYELALVLSEIDLALISPCPNEPMDPVRKENETDADFTARQQDHAEVRMKYDLERKKWDISNHKCLKVAKSTILGAIRGSILDCDTATEYLKKVKSQFIGSSKAYVSTLIKRLFNKKYSGGGIREHI
Ga0182177_114074413300015347Miscanthus PhyllosphereMAFILHISPLEVGNYRVWREKYELALMLSENDLALTSPCPTEPVDPVREENETNANFTARQQDHAEVRMKYDPERKKWDISNRKCLMVAKSIISDTIRGSIPDCDTISEYLKKVKS*
Ga0182177_122985613300015347Miscanthus PhyllosphereMAFISHIPPLEGGNYRV*REKYELVLALSKNDLALTSPCPTEPVDPMREDNETDADFTIWQ*DHAEVQMKYDLERKKLDISNCKCLMMATSTISDAIRES
Ga0182177_123928213300015347Miscanthus PhyllosphereMAFILHIPPLEGGNYRVWQEKYELALTLSENDLALTSSCPTKLEDPMRAQNKTDADFNARKRDHAEIRMKYDLDRKKWDISNRKCLMVAKSTISDAIRGSISNYDTTTEYLKKVES*
Ga0182161_105353923300015351Miscanthus PhyllosphereMAFISHIPPLEWGNYRVWREKYELALALSKNDLALTSPCPTEPVDLMREDNETDADFTARHRDNAEVWMKFDLERKKWDISNRKWLMLDKYTILDAIRGSIPDCDTATEYLK
Ga0182161_121396513300015351Miscanthus PhyllosphereMQLLCHIFSLSLTLFPGLNPMTFISHIPPLEGGNYRVWREKYELALALSENDLALTSLCPTELVDPMREENKTDANFTARQQDHAEVRMKYDPERKKWDISNRKCLMVAKSIISDAIRGSIPDCDIAIEYLKKVESVYWLFKGLCQYPNKE
Ga0182161_123908213300015351Miscanthus PhyllosphereMQLLCHVFSLSLMMFSGLNPMAFISHIPPLEGGNYRVWREKYESALALSENDLALTSPCPTEPVDPVRAENETDADFTARQRDHAEVRMKYDLDRKKWDISNRKCSMVAKSTISDAIRGSIPDCDTA
Ga0182159_120455813300015355Miscanthus PhyllosphereMLFSRLNPMAFISHIPPLEGGNYRVWQEKYELALVLSENDLALTSPCPTEPVDPVRVENETNADFTTRQRDHAEVRMKYDLDRNKWDISNRKCLMVAKSTISDAIR
Ga0182159_126531213300015355Miscanthus PhyllosphereMSFISHIPPLERGNYRVWREKYELALALSENDLALTSSCPTEPVDPVREENKTDANFTARRRDHAEVRMKYDLERKKWDISNRKCFMVAKFTISDAIRGSMPDCDTAT*
Ga0182159_129962913300015355Miscanthus PhyllosphereMQLLSHIFSLSLTVFLGLNPMTFISHIPPLEGGNYRVWRDKYELVLALSENDLALTSPCPTEPVDPVREEKETDADFTSRQRDHAEVRIKYDLERKKWDISNRKCLMVAKSTI
Ga0182145_102434613300015361Miscanthus PhyllosphereMAFISHIPSLEGGNYRVRREKYELALALSENDLALTSQCPTEPVDPVREDNNTDADFIARQRDHAEVRMKYDLECKKWDILNRKCLMVAKSTISDVIRGSIPDCDTTTEYLKKVESVHSLFKGLCQYLDK*
Ga0182145_117220113300015361Miscanthus PhyllosphereMAFISHIMPLEGGNYRVWREKYELALALSENDLALTSPCPTEPEDPVRAENKIDADFTARKRDHVEVRMKYDLDRKKWDITNYKCLILAKSTISNAIR*
Ga0182145_118338213300015361Miscanthus PhyllosphereAFISHIPPLEWGNSRVWREKYKLALALSKNDLALTSPCPTESVGPVREENESDADFTARQRNHAEVRMKYDLERKKWDISNRKCLMVAKSKISDAIRGSISDYDTATKYLKKVES*
Ga0182203_115044813300017404Miscanthus PhyllosphereMAFISHVSSLEGGNYRVWREKYELAHALSENDLALTSQCPTEPVDPVREDNNTDADFIARQRDHAEVRMKYDLECKKWDILNRKCLMVAKSTISDA
Ga0182220_110413913300017407Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALALSKNDLALTSSCPTEPEDSVRVENETDADFTARKRDHAEVRMKYDLDRKKWDISNHKCLMVAKSTILDTIRRSIPNCDTATEYLKKVESQFTGSSKAYAS
Ga0182204_111670213300017409Miscanthus PhyllosphereMAFISHIPPFEGGNYRVWQEKYELALVLSENDLVLTCPCTTEPVDPVREDNGTDVDFTARQRDHAEVRMNYDLERKKWDISNNKCLMVAKSRILDAIRGSILDCDTA
Ga0182207_114419913300017410Miscanthus PhyllosphereMTFISHIPPLEGDNYRVWRDKYELALALSENDLALTYPCPTELVDLVREENETDTNFTTRQRDHAEVRIKYDLERKKWDISNYKCLMVAKSTISDAIRGSI
Ga0182222_103268613300017413Miscanthus PhyllosphereMAFISHKPPLEGGNNRVWREKCELALALLENNLALTSPCPTKPVDPVREENETNVDFTARQRDHVEVRMKYDLKRKKWDISNRKCLMVAKSTIFGYNKGGNLRL
Ga0182202_108882813300017415Miscanthus PhyllosphereAFISHIRPLQGGNYQVWREKYKLALALSENDLALIFPCPTEPVDPVRKKNKTDADFTARQRDHAEVRMKYDLEHKKLNISNRKCLMVAKSTILDAIRGSIPDCDTTIEYLKKVES
Ga0182202_109474613300017415Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALTLSENNLALTSPCPTEPVDPVREENESDADFTARQRDHTKVRMKFDLDHKKWDILNHKCLMVAKSTISDAIRGSILDCDTATGYLKKVESQFTGSFKGLCQYFDQEI
Ga0182202_111165623300017415Miscanthus PhyllosphereMAFIRHIPPLEGGTYRVWREKYELAFALSENDLALTSPCPTEPVDPVREENKFDADFTARQRDHAKVRMKYDLERKKWDISNRKCLMVAKSIISDVIRGSIPDCDTATEYLKKVES
Ga0182230_106989513300017417Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWXEKYELVLALSKNNLALTSPCPTEPVDPVREENKSDADFTARQLDHVEVRIKYDPERKKLGISNRKCLMVAKSTIS
Ga0182230_107206613300017417Miscanthus PhyllosphereLLSLTVFFRFNPMAFISHIPPLEGGNYRVWREKYELALALSENDLALTFPCSTEPVDPVREENESDADFTVRQRDHAEVRMKYDLEHKKWDISNRKCLMVAKSTISDVIRGSVLDCDTATEYLKKVES
Ga0182228_104358413300017420Miscanthus PhyllosphereMAFILHILPLEGGNYRVWREKYELALALSENDLALTSSCPTEPVDPVREENKTDADFTARQXDHAEVRMKYDLDRKKWDISNRKCLMVAKSTISDA
Ga0182228_106839013300017420Miscanthus PhyllosphereMFLGLNPMAFISHIPPLEGGNYRVWREKYELALALSENDLALTSPCPTEPEDPVRAENETDADFNARKRDHAEVIMKYDLDRKKWDISNHKCLMVAKSIISYAIRGSIPDYDTATEYLK
Ga0182219_109820523300017424Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWXEKYELALALSENDLALTSLCPTEPVDLVREENESGVDFTARQRDHAEVCMKYDLECKKWNTSNHKCLMVAKSTISDAIRGSIPYCDTATEYLKKVESQFTD
Ga0182219_111629413300017424Miscanthus PhyllosphereMAFISHILPFEGGNYRVWXEKYELALALYENDLALTSLCPTEPVDPVREENETDTDFTARQRDHVEVRMKYDLERKKXDISNHKCLMVAKSTISDEIRGSILDCDTATEYLKKVESQFTSSSKAYTSTLIKKLFNEK
Ga0182224_112400013300017425Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALALSENDLALTSPYPTEPVDPVRAENETDADFTTRQRDHIEVRMKYDLDRKKWDISNRKCLIVAKSTILDAIKRSIPDCDTVKGPNIARGG
Ga0182190_102279313300017427Miscanthus PhyllosphereMAFISHIQPLEGGNYRVWXEKYKLALALSENDLALISPYPTEPVDPVREENETDADFTARQRDHAEVRMKYDLERKKWDISNRKCLMVAKSTILDAIRGSILDCDTATEYLKKVES
Ga0182190_113291313300017427Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWRKKYELALALSENNLALTSPCPTEPVDPVRAENETDADFTARQQDHAEARMKYDLDRKKRDISNRKCLMVAKSTILDAIRGSILNCNTATEYLKKVESQFTGSSK
Ga0182190_115009213300017427Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALVLSENDLVLTSSCPTEPVDPVREENETDADFTAWQRDHAEVRIKYDLERKKWDISNRKCLMVAKFTISDTIKRSILDCDTTTEYLKKVESQFT
Ga0182192_113280913300017430Miscanthus PhyllosphereRGGNYRVWQEKYELALALSENDLTLIFSCPTEPVDLVRAMNETDADFTARQXDHVEVRMKYDLECKKWDILNRKCLMVAKSTISDAIRGSILDCDTTTEYLKKVES
Ga0182192_117079813300017430Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALALSENDLALTSPCPTEPEDPVRAENETDADFTARKRDYAEVRMKYDLDRKKWDISNCKCLMVAKSTFLDAIRGSIPDCDTTTE
Ga0182206_105238723300017433Miscanthus PhyllosphereMAFISHIPSLEGGNYRVWREKYELALALLENNLALTSPCPTEPVDPVREENKIDADFTARQRDHVEVRMKYDLECKKWDISNRKCLVVAESTISDAIRGLS
Ga0182206_105684023300017433Miscanthus PhyllosphereMVFSGLNHMALISHILSLEGDNYRVLREKYELALALSENDVALISPCPTEPVDPVRAENETNADFTVRRXDHVEVRMKYDLDRKKWDISNHKCLMVAKSTILDAIRGSIPDCDTTIEYFKKVES
Ga0182206_107634013300017433Miscanthus PhyllosphereMQLLCHIFSVSLALFSGLNPIAFISHIPPLEGGNYCIWREKYELALALSENNLALTSPCPTEPVDPVREENETDADFTARPRDHVEIRMKYDFERKKWDISNPKCLMVAKSIISDAIRGSIPDCDIAIEYLKKVESVYWLFKGLCQYPNKEIIQ
Ga0182206_108273623300017433Miscanthus PhyllosphereMAFISHIPPIEGGNYRVWXEKYELALALSENDLVLTSPYLTKPVDLVREDNETDADFTAQQRDHAEVRMKYDLERKKWDISNRKCFMVAKSTISDAITGFIPDCDTATEYLK
Ga0182206_110490613300017433Miscanthus PhyllosphereMAFISHILPLEGGNYRVWREKYELALVLSENDLALTFSCPTEPVDPVREENETDADFTAQQRDHAEVRIKYDLEHKKWDISNRKCLMVAKSTILDAIRGSIPDCDTATEYLKKVES
Ga0182209_110327723300017436Miscanthus PhyllosphereMAFISYIPLLEGGNCRVWREKYELALALSENDFALTSPCPTEPVDPVREENKFDADFTARQRDHAKVRMKYDLERKKWDISNRKCLMVAKSTISDVIRGSIPDCDTATEYLKKVES
Ga0182191_113312313300017438Miscanthus PhyllosphereMAFISHIPPLDGGNYRVWQEKYELTLALSENDLALTSLCPTEPEDPVRAENETDADFNDQKLDHANVRMKFNLDQKKWDISNRKCLMVAKSTISDAIRGSILDCDTATEYLKK
Ga0182221_107062513300017442Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELTLALFENDLALTSPCSTEPVDPVREENKSDADFTTRQRDHAKVHMKYDLERKKWDISNRKCLMVAKSTISDAIRGSIPDYDTATKYLKKVESRFTGSSKA
Ga0182221_108423223300017442Miscanthus PhyllosphereMVFISHIPPLEGGNYRVWREKYELKLALSENDLALTFPCPTEPVDPVREENESNADFTARQRDHAEVCMKYDLERKKWDISNYKCLMVAKSTISDAIWGLSQIVIPP
Ga0182193_107836323300017443Miscanthus PhyllospherePTLNYDMQLLCQVFSLSLMIFSGLNPMAFISHILPLEGGNYRVWRRKYELTLALSENDLALTSPCPTEPVDLVRAENETDADFTARQRDHAEVRMKYDLDRKKWDILNRKCLMVAKSTISDAIRGSILDCDTATEYLKKVES
Ga0182193_110059923300017443Miscanthus PhyllosphereMQLLCHIFSLSLTLFSGFNRMAFISHIPPLEGGNYRVWREKYELALALSENDLALISRSPTKPVDPVREENKTDADFTARQRDHAEVKMKYDLGRKKWDISNRKCLMVAKSTISD
Ga0182193_110832923300017443Miscanthus PhyllosphereFILHIPPLEGGNYRVXREKYELALALSENDLALTSPCPTEPEDLVRAENETDADFNARKRDHVEVRMKNDLERKKWDISNRKCLMVAKFTISDAIRGLS
Ga0182193_112800713300017443Miscanthus PhyllosphereMAFISHIPPLMWGYYRVWREKYELALVLSENFPCPTKLADPVTEENESNADFTAWQRDHTEVRMKYDLERKKWNISNRKCLMVAKSIISDAIKG
Ga0182233_106234823300017680Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWXEKYELALTLSENDLALTSSCPTEPVDPVREENKTDADFTARQRDHAEVRMKYDLERKKWDISNHKCLMVAKSTISDAIRGSILDCDTATEYLKKVESVY
Ga0182233_107075213300017680Miscanthus PhyllosphereMSFISHIPPLEWGNYRVWREKYELALALPKNGLALTSPRPTEPVEPVREETETGADFTVRQRDHAEVRMKYNLERKKWDISNHKFLMVA
Ga0182229_108868413300017682Miscanthus PhyllosphereMTFILHIRPLEGGNYRVWREKYELALALSENDLALTSPCPTEPVDPVRAENETDADFTARQQDYAEVRMKYDLDHKKWDILNRKCLMVAKSTILDAIRGSILDYDTVAEYLKKVESQFTGSSKAYVSTLIKKLFHEKCSGGG
Ga0182218_106453513300017683Miscanthus PhyllosphereMAFISHIPPREGGNYRVWREKYKLALALLENDLALTFPCPTELVYPVREENEADANFTARQQDHAEVRIKYDLERKKCDISNCKCLRNGTFQTASARWWLSPLFQMR
Ga0182218_114407013300017683Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKYELALALSENDLALTFPCPTEPVDPVRKDNETDADFTAQQQDHAEVRMKYDLEHKKWDISNRNCLMVAKSIISDAIRG
Ga0182227_112926213300017685Miscanthus PhyllosphereMQVLCHIFSLSLTLFLGLNPMGFISHIPSLEGGNYRVWREKYELALALSENDLAFTSPYPTELVDPVKEENEIDADFTARQRDHAKVRIKYDLERKKWDISNRKCLMVAKFTISDTIKGSILDCDTTTE
Ga0182205_109936313300017686Miscanthus PhyllosphereMAFISHIPPLEGGNYRVWREKCELTLTLSENDLALTSPCPTDPIDPVMKENEFDADFTARQRDHAEVRMKYDLECKKWDISNRKCLMVAKSTISYAIR
Ga0182231_105258023300017689Miscanthus PhyllosphereMMSYFLTISEVFSGLNPIAFISHIPPLEGGNYRVWREKYELALALSENDLALTSPCPTEPVDPVREENESDADFTARQRDHAEVRMKYDLERKKWDISNRKCLMVAKSIISDAIRGSIPDCDTATEYLKKVES
Ga0182231_110873613300017689Miscanthus PhyllosphereMMFAVLTHMAFISHIRPLEGGNYRVWREKYELALALSENDIALTSPCPTEPVDPVREENKIDADFIARQRDHAEVRIKYDLERKKWDISNLKCLMVAKSTISD
Ga0182223_104848213300017690Miscanthus PhyllosphereMAFISHIPLLEGGNYRVWREKYELTLALSENDLALTSLCPTEPVAPVREENESDADFTARLRDHAEVRMKYDLERKKWDISKRKCLMVAKSTISDAIRRSIPDCDTATEYLKKVESQFTSSSKAYWLFKGLCKHLDKEIIQREILWCRY
Ga0182223_106354623300017690Miscanthus PhyllosphereMAFISQIPPLEGGNYRVWREKYEIALELSENDLALTSPCPTEPVDLVRKENESDADFTARQRGHAEVWMKYDLKRKKLDISNRKCLMVAKSTISDARRGSIPDYDTATEYL
Ga0206354_1151312313300020081Corn, Switchgrass And Miscanthus RhizosphereMNYIESIPPLNGGNYELWREKLELALALLDIDLAITDPCPIAPVDPVQEENESDDDFNARVRNHAPIKMKYDLYKVKWDQSNRKCLMVIKSSIMDTIRGAFPACTTATEYLSKVESHFTISSKAYACTIIER
Ga0207648_1220993923300026089Miscanthus RhizosphereMAFISHIPPLEGGNYRVWREKYELALALSENDLALTSLCPIEPEDPVRAENEIDADFTARKRDHAEVRMKYDLDRKKWDISNRKCLIVAKSTISDAIRGSISDCDTATKYFKKVESQFIG
Ga0207675_10160590423300026118Switchgrass RhizosphereMVFISHIPPLEGGNYRVWREKYELKLALSENDLALTFPCPTEPVDPVREENKIDADFTARQRDHAEVHMKYDLEHKKWDISNRKCLMVAKSTILDTIRGLS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.