Metagenome Family F089605

Basic Information
Family ID	F089605
Family Type	Metagenome
Number of Sequences	108
Average Sequence Length	39 residues
Representative Sequence	MAKLRKEMIGAVQTGTLFGNRVISGAVDLGFRSALYGWKAKT
Number of Associated Samples	20
Number of Associated Scaffolds	108

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	52.38 %
% of genes near scaffold ends (potentially truncated)	45.37 %
% of genes from short scaffolds (< 2000 bps)	74.07 %
Associated GOLD sequencing projects	20
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Most Common Taxonomy
Group	Bacteria (52.778 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (66.667 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (84.259 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 108 Family Scaffolds
PF03641	Lysine_decarbox	3.70
PF00665	rve	1.85
PF03732	Retrotrans_gag	1.85
PF04862	DUF642	0.93
PF00078	RVT_1	0.93
PF13976	gag_pre-integrs	0.93
PF07727	RVT_2	0.93
PF00063	Myosin_head	0.93

COG ID	Name	Functional Category	% Frequency in 108 Family Scaffolds
COG1611	Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family	Nucleotide transport and metabolism [F]	3.70
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	1.85
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	1.85
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	1.85
COG4584	Transposase	Mobilome: prophages, transposons [X]	1.85

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	74.07 %
Unclassified	root	N/A	25.93 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	74.07 %
Unclassified	root	N/A	25.93 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	52.78 %
Unclassified	root	N/A	25.93 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	21.30 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	52.78 %
Unclassified	root	N/A	25.93 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	21.30 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	52.78 %
Unclassified	root	N/A	25.93 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	21.30 %

Name	Rank	Taxonomy	Distribution
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	52.78 %
Unclassified	root	N/A	25.93 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	20.37 %

Name	Rank	Taxonomy	Distribution
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	52.78 %
Unclassified	root	N/A	25.93 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	20.37 %

Name	Rank	Taxonomy	Distribution
Methylomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas	52.78 %
Unclassified	root	N/A	25.93 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	13.89 %

Name	Rank	Taxonomy	Distribution
unclassified Methylomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas	52.78 %
Unclassified	root	N/A	25.93 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	13.89 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	13.89 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	13.89 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	11.11 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	11.11 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	11.11 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	11.11 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	11.11 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	9.26 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	1.85 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	8.33 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	1.85 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.93 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	7.41 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	1.85 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.93 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	7.41 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	1.85 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.93 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	7.41 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	1.85 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.93 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4.63 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.85 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	0.93 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.93 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4.63 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.85 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	0.93 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.93 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4.63 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.85 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	0.93 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.93 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4.63 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.85 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	0.93 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.93 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4.63 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.85 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	0.93 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.93 %

Name	Rank	Taxonomy	Distribution
Methylomonas sp. Kb3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	52.78 %
Unclassified	root	N/A	25.93 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4.63 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.85 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	0.93 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300006038\|Ga0075365_10170988	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1517	Open in IMG/M
3300028786\|Ga0307517_10039626	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	5166	Open in IMG/M
3300028786\|Ga0307517_10083047	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2712	Open in IMG/M
3300028786\|Ga0307517_10090882	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	2499	Open in IMG/M
3300028786\|Ga0307517_10151337	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1590	Open in IMG/M
3300028786\|Ga0307517_10313817	Not Available	871	Open in IMG/M
3300028786\|Ga0307517_10458337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	658	Open in IMG/M
3300028786\|Ga0307517_10477601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	639	Open in IMG/M
3300028786\|Ga0307517_10670171	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	502	Open in IMG/M
3300028794\|Ga0307515_10017257	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	13158	Open in IMG/M
3300028794\|Ga0307515_10038217	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	7686	Open in IMG/M
3300028794\|Ga0307515_10296237	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1307	Open in IMG/M
3300028794\|Ga0307515_10577196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	734	Open in IMG/M
3300028794\|Ga0307515_10619357	Not Available	693	Open in IMG/M
3300028794\|Ga0307515_10638882	Not Available	676	Open in IMG/M
3300028794\|Ga0307515_10729295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	608	Open in IMG/M
3300028794\|Ga0307515_10846853	Not Available	540	Open in IMG/M
3300030521\|Ga0307511_10040374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	3964	Open in IMG/M
3300030521\|Ga0307511_10061930	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2845	Open in IMG/M
3300030521\|Ga0307511_10211434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	989	Open in IMG/M
3300030521\|Ga0307511_10243258	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	874	Open in IMG/M
3300030521\|Ga0307511_10280602	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	770	Open in IMG/M
3300030521\|Ga0307511_10297130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	732	Open in IMG/M
3300030521\|Ga0307511_10333010	Not Available	663	Open in IMG/M
3300030521\|Ga0307511_10402742	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	561	Open in IMG/M
3300030522\|Ga0307512_10267582	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	831	Open in IMG/M
3300030522\|Ga0307512_10277112	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	806	Open in IMG/M
3300031456\|Ga0307513_10322419	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1302	Open in IMG/M
3300031456\|Ga0307513_10352534	Not Available	1218	Open in IMG/M
3300031456\|Ga0307513_10460483	Not Available	994	Open in IMG/M
3300031456\|Ga0307513_10474043	Not Available	972	Open in IMG/M
3300031456\|Ga0307513_10584736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	826	Open in IMG/M
3300031456\|Ga0307513_10730767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	695	Open in IMG/M
3300031456\|Ga0307513_10823382	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	634	Open in IMG/M
3300031456\|Ga0307513_10957790	Not Available	564	Open in IMG/M
3300031507\|Ga0307509_10050868	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	4434	Open in IMG/M
3300031507\|Ga0307509_10305419	Not Available	1336	Open in IMG/M
3300031507\|Ga0307509_10547402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	835	Open in IMG/M
3300031507\|Ga0307509_10721748	Not Available	662	Open in IMG/M
3300031507\|Ga0307509_10825436	Not Available	591	Open in IMG/M
3300031507\|Ga0307509_10945652	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	527	Open in IMG/M
3300031507\|Ga0307509_10949455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	525	Open in IMG/M
3300031507\|Ga0307509_11004118	Not Available	501	Open in IMG/M
3300031507\|Ga0307509_11006451	Not Available	500	Open in IMG/M
3300031616\|Ga0307508_10045789	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	3907	Open in IMG/M
3300031616\|Ga0307508_10596797	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	705	Open in IMG/M
3300031616\|Ga0307508_10901388	Not Available	510	Open in IMG/M
3300031649\|Ga0307514_10178683	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1372	Open in IMG/M
3300031649\|Ga0307514_10266497	Not Available	996	Open in IMG/M
3300031649\|Ga0307514_10410110	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	686	Open in IMG/M
3300031649\|Ga0307514_10423520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	667	Open in IMG/M
3300031649\|Ga0307514_10463626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	617	Open in IMG/M
3300031649\|Ga0307514_10573598	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	514	Open in IMG/M
3300031730\|Ga0307516_10362412	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1113	Open in IMG/M
3300031730\|Ga0307516_10414259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1005	Open in IMG/M
3300031730\|Ga0307516_10658428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	702	Open in IMG/M
3300031730\|Ga0307516_10695627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	673	Open in IMG/M
3300031730\|Ga0307516_10841792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	580	Open in IMG/M
3300031730\|Ga0307516_10951032	Not Available	528	Open in IMG/M
3300031730\|Ga0307516_10964856	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	522	Open in IMG/M
3300032354\|Ga0325403_1000016	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	75317	Open in IMG/M
3300032354\|Ga0325403_1000799	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	24165	Open in IMG/M
3300032354\|Ga0325403_1024008	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	5380	Open in IMG/M
3300032354\|Ga0325403_1030514	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4521	Open in IMG/M
3300032354\|Ga0325403_1048767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	3003	Open in IMG/M
3300032354\|Ga0325403_1062606	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	2289	Open in IMG/M
3300032354\|Ga0325403_1081967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1607	Open in IMG/M
3300032354\|Ga0325403_1082611	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1590	Open in IMG/M
3300032354\|Ga0325403_1111901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	991	Open in IMG/M
3300032354\|Ga0325403_1123965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	850	Open in IMG/M
3300032354\|Ga0325403_1127102	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	820	Open in IMG/M
3300032354\|Ga0325403_1134295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	763	Open in IMG/M
3300032354\|Ga0325403_1139570	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	712	Open in IMG/M
3300032354\|Ga0325403_1158505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	575	Open in IMG/M
3300032355\|Ga0325401_1009837	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	9284	Open in IMG/M
3300032355\|Ga0325401_1202804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	649	Open in IMG/M
3300032355\|Ga0325401_1227512	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	565	Open in IMG/M
3300032374\|Ga0325400_1005135	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	12266	Open in IMG/M
3300032374\|Ga0325400_1027116	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5254	Open in IMG/M
3300032374\|Ga0325400_1121244	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1551	Open in IMG/M
3300032374\|Ga0325400_1238996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	740	Open in IMG/M
3300032389\|Ga0325405_1006201	Not Available	12080	Open in IMG/M
3300032389\|Ga0325405_1048612	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2607	Open in IMG/M
3300032389\|Ga0325405_1125614	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	557	Open in IMG/M
3300032389\|Ga0325405_1130701	Not Available	518	Open in IMG/M
3300032390\|Ga0325404_1003280	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	17310	Open in IMG/M
3300032390\|Ga0325404_1028624	Not Available	4458	Open in IMG/M
3300032390\|Ga0325404_1082657	Not Available	1098	Open in IMG/M
3300032390\|Ga0325404_1106847	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	697	Open in IMG/M
3300033179\|Ga0307507_10255535	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1125	Open in IMG/M
3300033179\|Ga0307507_10264669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1093	Open in IMG/M
3300033179\|Ga0307507_10371169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	829	Open in IMG/M
3300033179\|Ga0307507_10455628	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	704	Open in IMG/M
3300033179\|Ga0307507_10538800	Not Available	618	Open in IMG/M
3300033179\|Ga0307507_10707427	Not Available	502	Open in IMG/M
3300033180\|Ga0307510_10201936	Not Available	1521	Open in IMG/M
3300033180\|Ga0307510_10310428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	1036	Open in IMG/M
3300033180\|Ga0307510_10419333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	781	Open in IMG/M
3300033180\|Ga0307510_10473765	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	693	Open in IMG/M
3300033180\|Ga0307510_10525526	Not Available	627	Open in IMG/M
3300034389\|Ga0325419_002365	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	21406	Open in IMG/M
3300034389\|Ga0325419_135338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	527	Open in IMG/M
3300034688\|Ga0325420_012386	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7568	Open in IMG/M
3300034688\|Ga0325420_062693	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	2012	Open in IMG/M
3300034901\|Ga0325409_111637	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3	678	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	67.59%
Wood	Host-Associated → Plants → Wood	28.70%
Phylloplane	Host-Associated → Plants → Phylloplane	3.70%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	66.67%
Unclassified	Host-Associated → Plants → Wood → Unclassified	28.70%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	3.70%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	66.67%
Unclassified	Host-Associated → Plants → Wood → Unclassified → Unclassified	28.70%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	3.70%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.93%

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	66.67%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	28.70%
Leaf	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf	3.70%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.93%

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F089605

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated	Open in IMG/M
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated	Open in IMG/M
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated	Open in IMG/M
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated	Open in IMG/M
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated	Open in IMG/M
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated	Open in IMG/M
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated	Open in IMG/M
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated	Open in IMG/M
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated	Open in IMG/M
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated	Open in IMG/M
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated	Open in IMG/M
3300034688	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1	Host-Associated	Open in IMG/M
3300034901	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R2	Host-Associated	Open in IMG/M

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0075365_101709883	3300006038	Populus Endosphere	MAKQKRDAGAVQIGTLFGNWVISGAVDLGFRSILYGWKDKT*
Ga0307517_100396266	3300028786	Ectomycorrhiza	RDVGAVQTGTLLGNRVISGVVDLGFRSALYGWKAKT
Ga0307517_100830473	3300028786	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNRVISGAVDLGFRSALYGLKAKT
Ga0307517_100908821	3300028786	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNRVISGAVDLGFRSVLYGWKAKT
Ga0307517_101513373	3300028786	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNRVISGAVDLGFRSALYGWKAKT
Ga0307517_103138171	3300028786	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNRVISEAVDLGFRSALYGWKAKT
Ga0307517_104583371	3300028786	Ectomycorrhiza	KDKEMAKLRKEMIGAVQTGTLFGNWVISGAVDLVFRSILYGWKDET
Ga0307517_104776011	3300028786	Ectomycorrhiza	DKEMAKLRKEMIGAVQTGTLFGNWVISGAVDLGFRSILYGWKDKT
Ga0307517_106701711	3300028786	Ectomycorrhiza	MAKLRKKMIGAVQTGTLFGNRVISGAVDLIFRSALYG
Ga0307515_1001725718	3300028794	Ectomycorrhiza	RDVGAVQTGTLFGNRVISGAVDLGFRSSLYGWKAKT
Ga0307515_100382171	3300028794	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNRVISGAVDIGFRPTLYGWKAKT
Ga0307515_102962371	3300028794	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFSNRVISGAVDLGFRSALYGWKAKT
Ga0307515_105771961	3300028794	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNRVISGAVDLGFKSALYGWKAKT
Ga0307515_106193572	3300028794	Ectomycorrhiza	KRDVGAVQTGTLFGNRVISGVVDLGFRSALYGWKVET
Ga0307515_106388821	3300028794	Ectomycorrhiza	DVGAVQTGTLFGNRVISGAVDLGFRSTLYGWKGKT
Ga0307515_107292951	3300028794	Ectomycorrhiza	DVGAVQTGTLFGNRAISGAVDLGFRFTLYGWKGKT
Ga0307515_108468531	3300028794	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFDNWVISGAVDLGFRSILYG
Ga0307511_100403742	3300030521	Ectomycorrhiza	MAKLRKEMIGVVQTGTLFGNRVISGAIDLGSMSALYGWKAKT
Ga0307511_100619303	3300030521	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNRVISGAVDLGFRSALYGLNAKT
Ga0307511_102114341	3300030521	Ectomycorrhiza	RDAGSVQTGTQFGHRVISRAVDLGFRSALYGWKSKT
Ga0307511_102432581	3300030521	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNRVISGALDLGFRSALYGWKAKT
Ga0307511_102806021	3300030521	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNQVISGAVDLGFRSTLYGWKAKT
Ga0307511_102971301	3300030521	Ectomycorrhiza	DVGSIQIGTLFGHRVISGAVDLGFRSTLYGWKSKT
Ga0307511_103330102	3300030521	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNRVISGAVDLRFRFALYGWKAKT
Ga0307511_104027421	3300030521	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNWVISGDVDLGFRSILYGWKDKT
Ga0307512_102675821	3300030522	Ectomycorrhiza	KRDVGAVQTGTLFGNRVISGAVDLGFRSTLYGWKGKT
Ga0307512_102771121	3300030522	Ectomycorrhiza	MVKLRKEMIGAVQTGTLFGNQVISGAVDLGFRSALYGWKAKI
Ga0307513_103224192	3300031456	Ectomycorrhiza	MGKLRKEMIGAVQTGKLFGNRVISGALDLGFRSILYGWKDKT
Ga0307513_103525341	3300031456	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNQVISGAIDLGFRSALYGWKAKT
Ga0307513_104604831	3300031456	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNWEISGAVDLGFRFILYEWKDKT
Ga0307513_104740431	3300031456	Ectomycorrhiza	MAKLRKEMIGAVQNGTLFGNRVISGAVDLGFRSSLYGWKAKT
Ga0307513_105847361	3300031456	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNWVISGAVDLVFRSILYGWKDET
Ga0307513_107307671	3300031456	Ectomycorrhiza	DAGAVQTGTLFGNWVISRVVNLGFRSILYGWKDKT
Ga0307513_108233821	3300031456	Ectomycorrhiza	DVGAVQTGTLFGNRVISGVVDLGFRSALYGWKAKT
Ga0307513_109577901	3300031456	Ectomycorrhiza	MTKLRKEMISAVQTGTLFGNWVISGAVDLEFRSILYGCKVKT
Ga0307509_100508687	3300031507	Ectomycorrhiza	MAKHRKEMIGAVQTGTLFGNRVISRAVDLGFRSALYGLKAKT
Ga0307509_103054191	3300031507	Ectomycorrhiza	MAKLRKEMIDAVQTRTLFSNRVISGAVDLGFRSSLYGWKAKT
Ga0307509_105474021	3300031507	Ectomycorrhiza	RNVGSVQTGTLFGHWVISGVIDLGFRSALYGWKAKT
Ga0307509_107217481	3300031507	Ectomycorrhiza	MAKLRKEMIDAVQTGTLFGNWEISGAVDLGFRSILYEWKDKT
Ga0307509_107298811	3300031507	Ectomycorrhiza	DVGSVQIGTLFGHRVISGVVDLGFRSALNGWKAKK
Ga0307509_108254361	3300031507	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFSNRVISGAVDLGFRSALYG
Ga0307509_109456521	3300031507	Ectomycorrhiza	DVGSVQIGTLFGHRVISEAVDLGFRSALYGWKAKT
Ga0307509_109494551	3300031507	Ectomycorrhiza	RDVGAVQTGTLFGNRVISGVVDLGFRSALYGWKAKT
Ga0307509_110041181	3300031507	Ectomycorrhiza	MAKLRKKDAGAVQTGTLFGNCIISGAVDLGFRSILYGWKDKT
Ga0307509_110064511	3300031507	Ectomycorrhiza	LKRDAGSVQTGTLFGHRVIFGAVDLGFRSSLYGWK
Ga0307508_100457891	3300031616	Ectomycorrhiza	MTKLRKEMISAVQTGTLFGNWEISGAVDLEFRSILYGCKVKT
Ga0307508_105967971	3300031616	Ectomycorrhiza	GSVQTGTLFGHRVISGAVNFGFRSALYGWKAKTYA
Ga0307508_109013881	3300031616	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNRVISGAVDLRFRSALYG
Ga0307514_101786831	3300031649	Ectomycorrhiza	DVGAAQTGTLFGNRVIFGAVDLRFRSTLYEWKGKT
Ga0307514_102664971	3300031649	Ectomycorrhiza	DVGAVQTGTLFGNRVISGAVDLEFRSTLYGWKGKT
Ga0307514_104101101	3300031649	Ectomycorrhiza	RDVGSVQTGTLFDHWVISGAVDLGFRSVLYGWKAKT
Ga0307514_104235201	3300031649	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFDNRVISGAVDLRFRFALYGWKAKT
Ga0307514_104636261	3300031649	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNQVISGAVDLGFRSALYGWKAKI
Ga0307514_105735981	3300031649	Ectomycorrhiza	RDAGAVQIGTLFGNXAISRVVDLEFRSTLYGWKGKT
Ga0307516_103624121	3300031730	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNRVISGAVDIGFKPTLYGWKAKT
Ga0307516_104142591	3300031730	Ectomycorrhiza	DAGLVQTGTLFSHWVISGAVDLGFRSALYGWKAKT
Ga0307516_106584281	3300031730	Ectomycorrhiza	KRDVGSVQTGTLFGHWVISGAVDLGFRSDLYGWKAKT
Ga0307516_106956271	3300031730	Ectomycorrhiza	RDTGXVQTGTLFGHGVISGAIDLGFRSSLYGWKAKT
Ga0307516_108417921	3300031730	Ectomycorrhiza	EILVQSKLKTLFSNWVISGAVDLGFRFALYGWKAKT
Ga0307516_109510321	3300031730	Ectomycorrhiza	TYKRDVGSVQTETLFGHWVISGAVDLGFRSALYGWKAKT
Ga0307516_109648561	3300031730	Ectomycorrhiza	MIGAVQTGTLFDNWVISGAVDLGFRSILYGWKDKT
Ga0325403_100001634	3300032354	Xylem	MAKLRKKMFGAVQTRTLFGNRVISGAVDLEFRSALYGWKDKT
Ga0325403_10007991	3300032354	Xylem	MAKLRKEMIGAVQTGTLFGNRVISGAVDLGFRSTLYGRKAKT
Ga0325403_10240086	3300032354	Xylem	MAELRKEMIGAVQTGTLFGNWVISGAVDLGFRSTFYGRKAKT
Ga0325403_10305142	3300032354	Xylem	MAKLRKEMIGAVQTVTLFGNRVISGDVDLGFRSALYGWKAKT
Ga0325403_10487671	3300032354	Xylem	MAKLSKEMIGAVQTGTLLSNRVISRAVDLGFRFSLYEWKAKT
Ga0325403_10626061	3300032354	Xylem	MAKLRKEMIGAVQTGTLFGNRVISGVVDLRFRSSLYGWKAKT
Ga0325403_10819673	3300032354	Xylem	RDAGAVQTGTLFGTWVISGAVGLGFRSILYGWKAKT
Ga0325403_10826111	3300032354	Xylem	MAKLREEMIGAVQTGTLFGNRVISGAVDLGFRFALYGWKAKK
Ga0325403_11119011	3300032354	Xylem	RRYVGAAQTGTLFGNRVISRAVDLGFRSTLCGWKGKT
Ga0325403_11239651	3300032354	Xylem	MAKLRKEMIGAVQTRTLFGNRVIYGVVDLGFRSALYGWKDKK
Ga0325403_11271021	3300032354	Xylem	VGGAVQTGTMFGNRVISGAVDLRFRSTLYGWKGKT
Ga0325403_11342951	3300032354	Xylem	DAGAVQTGTLFGNWVISGAVDLGFRSILYGWKDKT
Ga0325403_11395701	3300032354	Xylem	MAKLRKEMIGAVQTGTLFGNRVISGAEDLGFRSILYGWKDKT
Ga0325403_11585051	3300032354	Xylem	RDIGAVQTGTLFGNRVISRAVDLGFRSTLYEWKAKT
Ga0325401_100983713	3300032355	Xylem	MAKLRKEMIGAVQTRTLFGNRVIYGVVDLGFKSALYGWKDKT
Ga0325401_12028041	3300032355	Xylem	MGKLRKEMIGVVQTGTLFGNRVISGVVDLRFRSILYGWKDKT
Ga0325401_12275121	3300032355	Xylem	EMIGAVQTGTLFGNRVISGVVDLRFRSSLYGWKAKT
Ga0325400_100513516	3300032374	Xylem	KRDVGAVQTRTLFGNQVISGAVDLGFRSTLYGWKGKT
Ga0325400_10271162	3300032374	Xylem	MAKLRKEMLIQSKLKTLFGNRVISGAVDLGFRSTLYGWKGKT
Ga0325400_11212441	3300032374	Xylem	RDVGAVQTGTLFGNRVISGAVDLGFRSTLYGWKGKT
Ga0325400_12389961	3300032374	Xylem	RYVGAAQTGTLFGNRVISRAVDLGFRSTLCGWKGKT
Ga0325405_10062011	3300032389	Xylem	MAKLRKEMIGAVQTRTLFGNQVIYGVVDLGFRSALYGWKDKT
Ga0325405_10486121	3300032389	Xylem	MAKLRKEMIGAVQTGTLFGNRVISGAVDLRFRFALYGWKAKK
Ga0325405_11256141	3300032389	Xylem	RDIGAVQTGTLFGNRVISGAVDLGFRSTLYGWKANT
Ga0325405_11307011	3300032389	Xylem	MGKLRKEMIGVVQTGTLFGNRVISGVVDLGFRSILYGWKYKT
Ga0325404_10032808	3300032390	Xylem	LKGKEMAKLRKEMIGAVQTRTLFGNQVIYGVVDLGFRSALYGWKDKT
Ga0325404_10286242	3300032390	Xylem	MGKLRKEMIGAVQTGILFGNQVISGAVDLRFRSILYEWKDKT
Ga0325404_10826571	3300032390	Xylem	MAKFRKRDVGVVQTGTLFSNRVISGAVDLGFRSTLYGWKGKT
Ga0325404_11068471	3300032390	Xylem	RDIGAVQTGTLFGNRVISGAVDLGFRSTLYGWKAKT
Ga0307507_102555351	3300033179	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFGNWVISGAVDLGFRSILYGWKDKT
Ga0307507_102646691	3300033179	Ectomycorrhiza	DAGSVQIGTQFGHRVISRAVDLGFRSALYGWKSKT
Ga0307507_103711691	3300033179	Ectomycorrhiza	RDVGSVKTGTLFGHWVISGAVDLGFRSALYGWKTKT
Ga0307507_104556281	3300033179	Ectomycorrhiza	KRDVGAVQTGTLFGNRVISGAVDLRFRSTLYGWKGKT
Ga0307507_104989851	3300033179	Ectomycorrhiza	RDAGSVQTRTLFVHWVISGAIDLGFRSALYGWKAKT
Ga0307507_105388001	3300033179	Ectomycorrhiza	MAKLIKEMIGAVQIGTLFGNRVISGAVDLGFRSALCGWKAKT
Ga0307507_107074271	3300033179	Ectomycorrhiza	MAKLRKEMIGAVQTRTLFGNRVISGVVDLGFRSALYGWKAKT
Ga0307510_102019361	3300033180	Ectomycorrhiza	MAKLRKEMIGAVQTGTLFDNWVISGAVDLGFRSILYGWKDKT
Ga0307510_103104281	3300033180	Ectomycorrhiza	RDAGSVHTRTLFGHWVIFGAVDLGFRSVLYGWKAKT
Ga0307510_104193331	3300033180	Ectomycorrhiza	RDAGSVQTGTLFGHWVISGAVDLGFRSALYGXKAKR
Ga0307510_104737651	3300033180	Ectomycorrhiza	KEMAKLRKEMIGAVQTGTLFGNWVISGAVDLGFRSILYGWKYKT
Ga0307510_105255261	3300033180	Ectomycorrhiza	MAKLRKEMIGAVQIGTLFGNQIISGAVDLGFRSTLYGWKAKT
Ga0325419_002365_21097_21225	3300034389	Leaf	MGKLRKEMIGAVQTGILFGNQVISGAVDLRFRSILYGWKDKT
Ga0325419_135338_1_111	3300034389	Leaf	RDIGVVQTGTLFGNRVISGAVDLGFRSTLYGWKAKT
Ga0325420_012386_6952_7077	3300034688	Leaf	MAKIRKEMIGVQTGTLFGNRVISGVVDLGFRSALYGWKAKT
Ga0325420_062693_1217_1345	3300034688	Leaf	MAKLRKKMIGAVQTGTLFGNWVISEAVDLGFRSALYGCKAKT
Ga0325409_088029_888_995	3300034901	Xylem	DAGLVQTGTLFGHWIISEAVDLGFRSFLYGWKAKT
Ga0325409_111637_1_114	3300034901	Xylem	KRDAGAVQTGTLFGNWVISGAVDLGFRSILYGWKDKT

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign