NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F089522

Metagenome Family F089522

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089522
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 87 residues
Representative Sequence TDKTGRNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNTDSLRQIGYDIKEIERVASGGY
Number of Associated Samples 70
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.85 %
% of genes near scaffold ends (potentially truncated) 96.33 %
% of genes from short scaffolds (< 2000 bps) 88.07 %
Associated GOLD sequencing projects 59
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.826 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(65.138 % of family members)
Environment Ontology (ENVO) Unclassified
(92.661 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.495 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 78.57%    β-sheet: 0.00%    Coil/Unstructured: 21.43%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF00166Cpn10 9.17
PF02657SufE 4.59
PF00011HSP20 4.59
PF00149Metallophos 1.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 9.17
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 4.59
COG2166Sulfur transfer protein SufE, Fe-S cluster assemblyPosttranslational modification, protein turnover, chaperones [O] 4.59

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.58 %
UnclassifiedrootN/A6.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10107211All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300000101|DelMOSum2010_c10215123All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10632Open in IMG/M
3300001450|JGI24006J15134_10038880All Organisms → cellular organisms → Bacteria2028Open in IMG/M
3300001450|JGI24006J15134_10061013All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300001450|JGI24006J15134_10174293All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10681Open in IMG/M
3300001450|JGI24006J15134_10176062All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10675Open in IMG/M
3300001450|JGI24006J15134_10193796All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10626Open in IMG/M
3300001450|JGI24006J15134_10213648All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10578Open in IMG/M
3300001450|JGI24006J15134_10214888All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300001450|JGI24006J15134_10243090All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300001450|JGI24006J15134_10246430All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300001460|JGI24003J15210_10030395All Organisms → cellular organisms → Bacteria1971Open in IMG/M
3300001460|JGI24003J15210_10037584All Organisms → cellular organisms → Bacteria1710Open in IMG/M
3300001460|JGI24003J15210_10122722All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10706Open in IMG/M
3300001460|JGI24003J15210_10148435All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10603Open in IMG/M
3300001472|JGI24004J15324_10075678All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10925Open in IMG/M
3300001472|JGI24004J15324_10122658All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10635Open in IMG/M
3300001589|JGI24005J15628_10132522All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10784Open in IMG/M
3300001589|JGI24005J15628_10183535All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10602Open in IMG/M
3300001718|JGI24523J20078_1010338All Organisms → Viruses → Predicted Viral1282Open in IMG/M
3300001718|JGI24523J20078_1037184All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300001720|JGI24513J20088_1003090All Organisms → cellular organisms → Bacteria2429Open in IMG/M
3300001720|JGI24513J20088_1004399All Organisms → cellular organisms → Bacteria2006Open in IMG/M
3300004448|Ga0065861_1156892All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10778Open in IMG/M
3300004460|Ga0066222_1288191All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10642Open in IMG/M
3300006735|Ga0098038_1134739All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300006735|Ga0098038_1271501All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10531Open in IMG/M
3300006810|Ga0070754_10336925All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10670Open in IMG/M
3300006920|Ga0070748_1238947All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10656Open in IMG/M
3300006921|Ga0098060_1229776All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300006990|Ga0098046_1022155All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101600Open in IMG/M
3300007276|Ga0070747_1030727All Organisms → cellular organisms → Bacteria2133Open in IMG/M
3300008050|Ga0098052_1318222All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10586Open in IMG/M
3300008217|Ga0114899_1277003All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300009409|Ga0114993_10721587All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10724Open in IMG/M
3300009413|Ga0114902_1137371All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10629Open in IMG/M
3300009420|Ga0114994_10078746Not Available2250Open in IMG/M
3300009420|Ga0114994_10467536All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10832Open in IMG/M
3300009420|Ga0114994_11118004All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10508Open in IMG/M
3300009425|Ga0114997_10527640All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10627Open in IMG/M
3300009428|Ga0114915_1142028All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10686Open in IMG/M
3300009432|Ga0115005_11189484All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10620Open in IMG/M
3300009441|Ga0115007_11161025All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300009528|Ga0114920_10758895All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10664Open in IMG/M
3300009705|Ga0115000_10134820All Organisms → cellular organisms → Bacteria1649Open in IMG/M
3300009705|Ga0115000_10242935All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300009705|Ga0115000_10469004All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10795Open in IMG/M
3300009705|Ga0115000_10638681All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10661Open in IMG/M
3300009790|Ga0115012_10984988All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10695Open in IMG/M
3300010151|Ga0098061_1085497All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300010151|Ga0098061_1107353Not Available1036Open in IMG/M
3300010392|Ga0118731_112042711All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10616Open in IMG/M
3300017705|Ga0181372_1013775All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101414Open in IMG/M
3300017724|Ga0181388_1117898All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10632Open in IMG/M
3300017728|Ga0181419_1118313All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10645Open in IMG/M
3300017729|Ga0181396_1011425Not Available1772Open in IMG/M
3300017732|Ga0181415_1117220All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10600Open in IMG/M
3300017733|Ga0181426_1079790All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10655Open in IMG/M
3300017737|Ga0187218_1164369All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10522Open in IMG/M
3300017745|Ga0181427_1131598All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10608Open in IMG/M
3300017746|Ga0181389_1019424Not Available2145Open in IMG/M
3300017750|Ga0181405_1026914All Organisms → cellular organisms → Bacteria1575Open in IMG/M
3300017759|Ga0181414_1032855Not Available1403Open in IMG/M
3300017767|Ga0181406_1195300All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10602Open in IMG/M
3300017767|Ga0181406_1231449All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10545Open in IMG/M
3300017771|Ga0181425_1249092All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300017773|Ga0181386_1243418All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10533Open in IMG/M
3300017782|Ga0181380_1073157All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300022074|Ga0224906_1097075All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10875Open in IMG/M
3300022178|Ga0196887_1064845All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10893Open in IMG/M
3300025071|Ga0207896_1000813All Organisms → cellular organisms → Bacteria6226Open in IMG/M
3300025079|Ga0207890_1019257All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300025079|Ga0207890_1050480All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10707Open in IMG/M
3300025079|Ga0207890_1078819All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10513Open in IMG/M
3300025085|Ga0208792_1039643All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10910Open in IMG/M
3300025102|Ga0208666_1146551All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10531Open in IMG/M
3300025103|Ga0208013_1137438All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10592Open in IMG/M
3300025120|Ga0209535_1020197All Organisms → cellular organisms → Bacteria3391Open in IMG/M
3300025120|Ga0209535_1044749All Organisms → cellular organisms → Bacteria1942Open in IMG/M
3300025128|Ga0208919_1224278All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10555Open in IMG/M
3300025132|Ga0209232_1157667All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10720Open in IMG/M
3300025137|Ga0209336_10106628All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10784Open in IMG/M
3300025137|Ga0209336_10166259All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10571Open in IMG/M
3300025137|Ga0209336_10176302All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10544Open in IMG/M
3300025138|Ga0209634_1013909All Organisms → cellular organisms → Bacteria4704Open in IMG/M
3300025138|Ga0209634_1018746All Organisms → cellular organisms → Bacteria3912Open in IMG/M
3300025138|Ga0209634_1045354Not Available2207Open in IMG/M
3300025138|Ga0209634_1069422All Organisms → cellular organisms → Bacteria1661Open in IMG/M
3300025138|Ga0209634_1101923All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101268Open in IMG/M
3300025138|Ga0209634_1166059All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10882Open in IMG/M
3300025168|Ga0209337_1015418All Organisms → Viruses → Predicted Viral4625Open in IMG/M
3300025168|Ga0209337_1138793All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300025168|Ga0209337_1186165All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300025168|Ga0209337_1256749All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10665Open in IMG/M
3300025168|Ga0209337_1336936All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300025266|Ga0208032_1062983All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10821Open in IMG/M
3300025277|Ga0208180_1107080All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10613Open in IMG/M
3300025806|Ga0208545_1108571All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10714Open in IMG/M
3300027687|Ga0209710_1245746All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10582Open in IMG/M
3300027780|Ga0209502_10402890All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10560Open in IMG/M
3300027801|Ga0209091_10290941All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10777Open in IMG/M
3300027813|Ga0209090_10337406All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10738Open in IMG/M
3300028194|Ga0257106_1312778All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300028448|Ga0256383_105002All Organisms → Viruses → Predicted Viral1017Open in IMG/M
3300031655|Ga0308018_10182613All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10714Open in IMG/M
3300031721|Ga0308013_10157757All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10858Open in IMG/M
3300032073|Ga0315315_10845631All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10830Open in IMG/M
3300033742|Ga0314858_047291All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101035Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine65.14%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater14.68%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean4.59%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.59%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.83%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.83%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.83%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.92%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.92%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.92%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.92%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.92%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300001718Marine viral communities from the Pacific Ocean - LP-48EnvironmentalOpen in IMG/M
3300001720Marine viral communities from the Pacific Ocean - LP-36EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008217Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215EnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009413Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009528Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaGEnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025266Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes)EnvironmentalOpen in IMG/M
3300025277Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300028194Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10mEnvironmentalOpen in IMG/M
3300028448Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 300mEnvironmentalOpen in IMG/M
3300031655Marine microbial communities from water near the shore, Antarctic Ocean - #282EnvironmentalOpen in IMG/M
3300031721Marine microbial communities from water near the shore, Antarctic Ocean - #181EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1010721113300000101MarineKNLEQRVYGDIDNIHAIFTDKTNINSSNYSSAREELVKEMAEMSSWVGRIEGIVAALRDGSYKLASQAEYQALEELVRTNSDAIRQIGYDIKDLERVASGGY*
DelMOSum2010_1021512313300000101MarineREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRTNTDSLRQIGYDIKEIERVASGGY*
JGI24006J15134_1003888013300001450MarineIDNIHRTYTDKTGRNSKNYADAREELVKEMAEMASWVGRLEGILYALRDGSYKLASQAEYQALEELVRGNTDSLRQIGYDIKEIERVASGGY*
JGI24006J15134_1006101343300001450MarineTQIDASTDTINILKVEVENLEQRVYGDIDNIHRTYTDKTGRNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNTDSLRQIGYDIKEIERVASGGY*
JGI24006J15134_1017429313300001450MarineRTYTDKTGRNSKNYAEAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNTDSLRQIGYDIKEIERVASGGY*
JGI24006J15134_1017606213300001450MarineTTIALLKAEVINLEKRIYGDIDNIHNIFNDKTSRNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRTNTDSLRQIGYDIKEIERVASGGY*
JGI24006J15134_1019379613300001450MarineMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNSEAVRDIGYDIKEIERVASGGY*
JGI24006J15134_1021364813300001450MarineKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNTDSLRQVGYDIKEIERVASGGY*
JGI24006J15134_1021488813300001450MarineTQIDASTDTINILKVEVENLEQRVYGDIDNIHRTYTDKTGRNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNSEAIRDMGYDIKEIERVASGGY*
JGI24006J15134_1024309013300001450MarineEVENLEQRIYGDIDNIHTIFNDKTGRNSNNYASAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY*
JGI24006J15134_1024643013300001450MarineQRIYGDIDNIHAIFNDKTGRNSNNYASAREELVKEMADMSSWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY*
JGI24003J15210_1003039553300001460MarineLLKAEVINLEKRIYGDIDNIHNIFNDKTSRNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRTNTDSLRQIGYDIKEIERVASGGY*
JGI24003J15210_1003758413300001460MarineIDASTTTIALLKAEVINLEKRIYGDIDNIHTIFNDKTSRNSNNYAEAREELVKEMAEMATWVGRLEGIVAALRDGSYKLASQAEYQALEELVRNNSEAVRDMGYDIKEIERVASGGY*
JGI24003J15210_1012272223300001460MarineTTIALLKLEVENLEERVYGDIDNIHRTYTDKTGRNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNTDSLRQIGYDIKEIERVASGGY*
JGI24003J15210_1014843513300001460MarineEELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNTDSLRQIGYDIKEIERVASGGY*
JGI24004J15324_1007567833300001472MarineMAEMATWVGRLEGIVAALRDGSYKLASQAEYQALEELVRGNTDSLRQIGYDIKEIERVASGGY*
JGI24004J15324_1012265813300001472MarineELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNTDSLRQIGYDIKEIERVASGGY*
JGI24005J15628_1013252213300001589MarineIHRTYTDKTGRNSKNYAEAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNSEAIRDMGYDIKEIERVASGGY*
JGI24005J15628_1018353513300001589MarineADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNTDSLRQVGYDIKEIERVASGGY*
JGI24523J20078_101033843300001718MarineEELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNSEAVRDMGYDIKEIERVASGGY*
JGI24523J20078_103718423300001718MarineKLEITNLEQRVYGDIDNIHRTYTDKTGRNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRSNTDSLRQIGYDIKEIERVASGGY*
JGI24513J20088_100309063300001720MarineKTGRNSKNYAEAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNTDSLRQIGYDIKEIERVASGGY*
JGI24513J20088_100439963300001720MarineLEQRVYGDIDNIHRTYTDKTGRNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRSNTDSLRQIGYDIKEIERVASGGY*
Ga0065861_115689223300004448MarineTTIALLKLEVENLEERIYGDIDNIHRTYTDKTGMNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEGLVRGNIESIREIGYDIKDIERVASGGY*
Ga0066222_128819113300004460MarineAEMATWVGRLEGILYALRDGSYKLASQAEYQALEGLVRGNIEAIREIGYDIKDIEKEASGGY*
Ga0098038_113473933300006735MarineFTDKTGRNSKNYAEAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEMQALEEIVRTNTDSIRQFKYDMKDLENTISGGY*
Ga0098038_127150123300006735MarineSNYTSAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEHQALEELVRTNSDAIRQIGYDIKDLERVASGGY*
Ga0070754_1033692513300006810AqueousERNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRTNTDSLRQIGYDIKEIERVASGGY*
Ga0070748_123894713300006920AqueousMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRTNTDSLRQIGYDIKEIERVASGGY
Ga0098060_122977623300006921MarineDESTNTISLLKVEVENLEQRVYGDLDNIHAIFTDKTTINSNNYTSAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEHQALEELVRTNSDAIRQIGYDIKDLERVASGGY*
Ga0098046_102215553300006990MarineRVYGDMDNIHAIFTDKTGRNSKNYAEAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEMQALEEIVRTNTDSIRQFKYDMKDLENTISGGY*
Ga0070747_103072713300007276AqueousHRTYTDKTGRNSKNYAEAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRTNTDSLRQIGYDIKEIERVASGGY*
Ga0098052_131822213300008050MarineIENLEQRVYGDMDNIHAIFTDKTGRNSQNYSDAREELVKEMAEMATWVGRLEGILYALRDGSYKLASESELRALEELVRTNSDAIRQFKYDMKDLENTISGGY*
Ga0114899_127700313300008217Deep OceanLEQRVYGDLDNIHAIFTDKTGRNSKNYAEAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEMQALEEIVRTNTDSIRQFKYDMKDLENTISGGY*
Ga0114993_1072158713300009409MarineTIALLKLEVKNLENRVYGDIDNIHSKFDDKTGRNSKNYTDAREELVKEIAEMATWIGRIEGIVSALRDGSYKMASQAEVQALEELVRNNSDAVRQFKYDIKEIERVASGGY*
Ga0114902_113737123300009413Deep OceanLYTDIDNIHAIFTDKTGRNSKNYAEAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEMQALEEIVRTNTDSIRQFKYDMKDLENTISGGY*
Ga0114994_1007874613300009420MarineKTSRNSKNYIDAREELVREMAEMSTWVGRLEGILYALRDGSYKMSSQAEVQALEELVRNNSDAVRQFKYDIKEIERVASGGY*
Ga0114994_1046753613300009420MarineLKLEVENLEERIYGDIDNIHRTYTDKTGMNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNGVAIRDMGYDIKEIERVASGGY*
Ga0114994_1111800423300009420MarineKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEGLVRGNIESIREIGYDIKDIEKEASGGY*
Ga0114997_1052764013300009425MarineIDNIHSKFDDKTGRNSKNYTDAREELVKEIAKMATWVGRLEGILYALRDGSYKMASQAEVQALEELVRNNSDAVRQFKYDIKEIERVASGGY*
Ga0114915_114202823300009428Deep OceanNYASAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSLRQIGYDIKEIERVASGGY*
Ga0115005_1118948413300009432MarineEVENLEERIYGDIDNIHRTYTDKTGMNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEGLVRGNIEAIREIGYDIKDIERVASGGY*
Ga0115007_1116102523300009441MarineDKSTSTIALLKLEVENLEERVYSDIDNIHRTYTDKTGRNTKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEGLVRGNIEAIREIGYDIKDIERVASGGY*
Ga0114920_1075889523300009528Deep SubsurfaceAQIDASTDTINILKVEVKNLEQRVYGDIDNIHAIFTDKTSRNSNNYASAREELVKEMAEMASWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY*
Ga0115000_1013482013300009705MarineTIALLKLEVTNLEKRVYGDIDNIHSKFDDKTGRNSKNYTDAREELVKEIAEMATWVGRLEGILYALRDGSYKMASQAEVQALEELVRNNSDAVRQFKYDIKEIERVASGGY*
Ga0115000_1024293513300009705MarineENLEERIYGDIDNIHRTYTDKTGMNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEGLVRGNIESIREIGYDIKDIERVASGGY*
Ga0115000_1046900413300009705MarineREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNGVAIRDMGYDIKEIERVASGGY*
Ga0115000_1063868113300009705MarineELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEGLVRGNIESIREIGYDIKDIEKEASGGY*
Ga0115012_1098498813300009790MarineKNYADAREELVKEMAEMATWVGRLEGILYAVRDGSYKLASDSELRALEELVRTNSDAIRQFKYDMKDLENTISGGY*
Ga0098061_108549713300010151MarineSAREELVKEMADMATWVGRIEGIVAALRDGSYKLASQAEYQALEELVRTNSDAIRQIGYDIKDLERVASGGY*
Ga0098061_110735333300010151MarineMDNIQAIYTDKTGRNSKNYAEAREELVKEMAEMATWVGRLEGILYAVRDGSYKLASDSELRALEELVRTNSDAIRQFKYDMK
Ga0118731_11204271113300010392MarineHTIFNDKTGRNSKNYAEAREELVKEMAEMASWVGRLEGIVSALRDGSYKLASEAEMQAIEEIVRTNTDSIRQFKYDMKDLENTVSGGY*
Ga0181372_101377513300017705MarineRNSKNYSDAREELVKEMAEMATWVGRLEGILYALRDGSYKLASESELRALEELVRTNSDAIRQFKYDMKDLENTISGGY
Ga0181388_111789813300017724SeawaterASWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0181419_111831313300017728SeawaterEMADMASWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0181396_101142563300017729SeawaterGDIDNIHTIFNDKTNRNSNNYASAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0181415_111722023300017732SeawaterEMADMSSWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0181426_107979023300017733SeawaterMADMASWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0187218_116436913300017737SeawaterTGRNSNNYASAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0181427_113159823300017745SeawaterIYSDIDNIHRTYTDKTGRNSKNYADAREELVKEMAERPSWVGRIEGIVAALRDGSYKLASEAEMQALEEIVRSNTDSIRQFKYDMKDLENTVSGGY
Ga0181389_101942413300017746SeawaterNYASAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0181405_102691413300017750SeawaterEQRIYGDIDNIHTIFNDKTGRNSKNYAEAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0181414_103285513300017759SeawaterLVKEMAEMATWVGRLEGIVSALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0181406_119530013300017767SeawaterYGDIDNIHAIFNDKTSRNSNNYASAREELVKEMAEMASWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0181406_123144923300017767SeawaterVKEMAEMSSWVGRLEGIVAALRDGSYKLASEAEMQALEEIVRTNTDSIRQFKYDMKDLENTVSGGY
Ga0181425_124909213300017771SeawaterQRIYGDIDNIHTIVNDKTGRNSNNYASAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0181386_124341823300017773SeawaterNIHTIFNDKTSRNSTNYASAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0181380_107315733300017782SeawaterLEQRVYGDIDNIHTIFNDKTSRNSTNYASAREELVKEMADMSSWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0224906_109707523300022074SeawaterTDTINILKVEVENLEQRVYGDIDNIHTIFNDKTSRNSTNYASAREELVKEMAEMSSWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0196887_106484533300022178AqueousDNIHTIFNDKTGRNSKNYAEAREELVKEMAEMASWVGRLEGIVSALRDGSYKLASEAEMQAIEEIVRTNTDSIRQFKYDMKDLENTVSGGY
Ga0207896_1000813123300025071MarineELVKEMAEMATWVGRLEGIVAALRDGSYKLASQAEYQALEELVRNNSEAVRDMGYDIKEIERVASGGY
Ga0207890_101925713300025079MarineAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNSEAVRDMGYDIKEIERVASGGY
Ga0207890_105048023300025079MarineSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRGNTDSLRQIGYDIKEIERVASGGY
Ga0207890_107881913300025079MarineDKTSRNSKNYAEAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNSEAIRDMGYDIKEIERVASGGY
Ga0208792_103964313300025085MarineRVYGDMDNIHAIFTDKTGRNSKNYSDAREELVKEMAEMATWVGRLEGILYAVRDGSYKLASDSELRALEELVRTNSDAIRQFKYDMKDLENTISGGY
Ga0208666_114655113300025102MarineSNYTSAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEHQALEELVRTNSDAIRQIGYDIKDLERVASGGY
Ga0208013_113743813300025103MarineENLEQRVYGDMDNIHAIFTDKTGRNSKNYADAREELVKEMAEMATWVGRLEGILYAVRDGSYKLASDSELRALEELVRTNSDAIRQFKYDMKDLENTISGGY
Ga0209535_102019773300025120MarineINLEKRIYGDIDNIHTIFNDKTSRNSNNYAEAREELVKEMAEMATWVGRLEGIVAALRDGSYKLASQAEYQALEELVRNNSEAVRDMGYDIKEIERVASGGY
Ga0209535_104474953300025120MarineNLEKRIYGDIDNIHTIFNDKTSRNSNNYAEAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRTNTDSLRQIGYDIKEIERVASGGY
Ga0208919_122427823300025128MarineIHAIFTDKTGRNSKNYAEAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEMQALEEIVRTNTDSIRQFKYDMKDLENTISGGY
Ga0209232_115766713300025132MarineTDKTGRNSQSYTEAREELVKEMANFSAWVGRIEGVVNALRDASYKMAADSELRALEELVRSNADAIRQYKYDLEEVERKATGGY
Ga0209336_1010662833300025137MarineMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRTNTDSLRQIGYDIKEIERVASGGY
Ga0209336_1016625923300025137MarineHRTYTDKTGRNSKNYAEAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNTDSLRQIGYDIKEIERVASGGY
Ga0209336_1017630223300025137MarineHRTYTDKTGRNSKNYAEAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRTNTDSLRQIGYDIKEIERVASGGY
Ga0209634_101390983300025138MarineVINLEKRIYGDIDNIHTIFNDKTSRNSNNYAEAREELVKEMAEMATWVGRLEGIVAALRDGSYKLASQAEYQALEELVRNNSEAVRDMGYDIKEIERVASGGY
Ga0209634_101874613300025138MarineNYADAREELVKEMAEMATWVGRLEGIVAALRDGSYKMASQAEYQALEELVRGNTDSLRQIGYDIKEIERVASGGY
Ga0209634_104535413300025138MarineNYASAREELVKEMADMSSWVGRIEGIVAALRDGSYKLASQAEYQALEEIVRGNTDSIRQIGYDIKDIERVASGGY
Ga0209634_106942253300025138MarineYTDKTSRNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRTNTDSLRQIGYDIKEIERVASGGY
Ga0209634_110192313300025138MarineTDKTGRNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNTDSLRQIGYDIKEIERVASGGY
Ga0209634_116605933300025138MarineEELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRGNTDSLRQIGYDIKEIERVASGGY
Ga0209337_101541893300025168MarineEELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNSEAVRDMGYDIKEIERVASGGY
Ga0209337_106712053300025168MarineTWVGRLEGILYALRDGSYKLASQAEYQALEELVRTNTDSLRQIGYDIKEIERVASGGY
Ga0209337_113879313300025168MarineAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNSEAIRDMGYDIKEIERVASGGY
Ga0209337_118616513300025168MarineGDIDNIHTIFNDKTGRNSNNYASAREELVKEMADMSSWVGRIEGIVAALRDGSYKLASQAEYQALEELVRTNSDAIRQIGYDIKDIERVASGGY
Ga0209337_125674913300025168MarineKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRGNTDSLRQIGYDIKEIERVASGGY
Ga0209337_133693623300025168MarineDIDNIHRTYTDKTGRNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRGNTDSLRQIGYDIKEIERVASGGY
Ga0208032_106298323300025266Deep OceanSTNTIALLKLEINNLEKRVYGDIDNIHNTFNDKTNRNSKNYIDAREELVREMAEMSTWVGRLEGILYALRDGSYKMSSQAEVQALEELVRNNSDAVRQFKYDIKEIERVASGGY
Ga0208180_110708013300025277Deep OceanRLYTDIDNIHAIFTDKTGRNSKNYAEAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEMQALEEIVRTNTDSIRQFKYDMKDLENTISGGY
Ga0208545_110857123300025806AqueousASTDAIALLTVEVKNLEQRIYGDIDNIHTIFNDKTGRNSKNYAEAREELVKEMAEMASWVGRLEGIVSALRDGSYKLASEAEMQAIEEIVRTNTDSIRQFKYDMKDLENTVSGGY
Ga0209710_124574623300027687MarineYGDIDNIHRTYTDKTGMNSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEGLVRGNIEAIREIGYDIKDIERVASGGY
Ga0209502_1040289013300027780MarineSKNYADAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEGLVRGNIEAIREIGYDIKDIERVASGGY
Ga0209091_1029094113300027801MarineDAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEGLVRGNIEAIREIGYDIKDIERVASGGY
Ga0209090_1033740623300027813MarineKTSRNSKNYIDAREELVREMAEMSTWVGRLEGILYALRDGSYKMSSQAEVQALEELVRNNSDAVRQFKYDIKEIERVASGGY
Ga0257106_131277823300028194MarineENLEERIYSDIDNIHRTYTDKTSMNSKNYADAREELVKEMAEMATWVGRLEGIVAALRDGSYKLASQAEYQALEELVRGNTDSLRQIGYDIKEIERVASGGY
Ga0256383_10500213300028448SeawaterYAEAREELVKEMADMASWVGRIEGIVAALRDGSYKLASQAEMQALEEIVRTNTDSIRQFKYDMKDLENTISGGY
Ga0308018_1018261313300031655MarineGDIDNIHNTFNDKTNRNSKNYIDAREELVREMAEMSTWVGRLEGILYALRDGSYKMSSQAEVQALEELVRNNSDAVRQFKYDIKEIERVASGGY
Ga0308013_1015775713300031721MarineDKTGRNSQNYVSAREELVKEMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEELVRNNGVAIRDMGYDIKEIERVASGGY
Ga0315315_1084563123300032073SeawaterLEQRVYGDMDNIHAIFTDKTGRNSKNYADAREELVKEMAEMATWVGRLEGILYAVRDGSYKLASDSELRALEELVRTNSDAIRQFKYDMKDLENTISGGY
Ga0314858_047291_15_2063300033742Sea-Ice BrineMAEMATWVGRLEGILYALRDGSYKLASQAEYQALEGLVRGNIESIREIGYDIKDIERVASGGY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.