| Basic Information | |
|---|---|
| Family ID | F089492 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTLKNAALLALIGTILMTALLVWTFVFNSLNLLRGLVPAVTLF |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.09 % |
| % of genes near scaffold ends (potentially truncated) | 92.66 % |
| % of genes from short scaffolds (< 2000 bps) | 87.16 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.725 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (13.761 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.532 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (34.862 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF03695 | UPF0149 | 7.34 |
| PF00583 | Acetyltransf_1 | 2.75 |
| PF01738 | DLH | 2.75 |
| PF16901 | DAO_C | 2.75 |
| PF08240 | ADH_N | 2.75 |
| PF03641 | Lysine_decarbox | 2.75 |
| PF01965 | DJ-1_PfpI | 1.83 |
| PF00881 | Nitroreductase | 1.83 |
| PF07228 | SpoIIE | 1.83 |
| PF00106 | adh_short | 1.83 |
| PF14300 | DUF4375 | 0.92 |
| PF13335 | Mg_chelatase_C | 0.92 |
| PF04203 | Sortase | 0.92 |
| PF13673 | Acetyltransf_10 | 0.92 |
| PF10162 | G8 | 0.92 |
| PF09286 | Pro-kuma_activ | 0.92 |
| PF00069 | Pkinase | 0.92 |
| PF01839 | FG-GAP | 0.92 |
| PF14082 | DUF4263 | 0.92 |
| PF14236 | DUF4338 | 0.92 |
| PF04185 | Phosphoesterase | 0.92 |
| PF13538 | UvrD_C_2 | 0.92 |
| PF00216 | Bac_DNA_binding | 0.92 |
| PF14490 | HHH_4 | 0.92 |
| PF05163 | DinB | 0.92 |
| PF04773 | FecR | 0.92 |
| PF04226 | Transgly_assoc | 0.92 |
| PF03781 | FGE-sulfatase | 0.92 |
| PF00383 | dCMP_cyt_deam_1 | 0.92 |
| PF00107 | ADH_zinc_N | 0.92 |
| PF08239 | SH3_3 | 0.92 |
| PF16177 | ACAS_N | 0.92 |
| PF14833 | NAD_binding_11 | 0.92 |
| PF13432 | TPR_16 | 0.92 |
| PF00994 | MoCF_biosynth | 0.92 |
| PF00873 | ACR_tran | 0.92 |
| PF05532 | CsbD | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG3079 | Uncharacterized conserved protein YgfB, UPF0149 family | Function unknown [S] | 7.34 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.67 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 2.75 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.92 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.92 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.92 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.92 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.72 % |
| Unclassified | root | N/A | 30.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_100177917 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300000955|JGI1027J12803_100751577 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300001154|JGI12636J13339_1048802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300001593|JGI12635J15846_10228472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1209 | Open in IMG/M |
| 3300001593|JGI12635J15846_10553101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300002909|JGI25388J43891_1057516 | Not Available | 583 | Open in IMG/M |
| 3300005439|Ga0070711_102010388 | Not Available | 508 | Open in IMG/M |
| 3300005451|Ga0066681_10839242 | Not Available | 553 | Open in IMG/M |
| 3300005518|Ga0070699_100383714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1269 | Open in IMG/M |
| 3300005591|Ga0070761_10136915 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300005610|Ga0070763_10097780 | Not Available | 1476 | Open in IMG/M |
| 3300006102|Ga0075015_100189471 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300009519|Ga0116108_1012666 | Not Available | 3083 | Open in IMG/M |
| 3300009519|Ga0116108_1251171 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009551|Ga0105238_12921317 | Not Available | 514 | Open in IMG/M |
| 3300009552|Ga0116138_1056608 | Not Available | 1115 | Open in IMG/M |
| 3300009616|Ga0116111_1017922 | All Organisms → cellular organisms → Bacteria | 2566 | Open in IMG/M |
| 3300009616|Ga0116111_1071676 | Not Available | 935 | Open in IMG/M |
| 3300009616|Ga0116111_1163429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300009617|Ga0116123_1121549 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 685 | Open in IMG/M |
| 3300009631|Ga0116115_1005438 | All Organisms → cellular organisms → Bacteria | 4340 | Open in IMG/M |
| 3300009637|Ga0116118_1114771 | Not Available | 894 | Open in IMG/M |
| 3300009643|Ga0116110_1264200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300009644|Ga0116121_1107779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
| 3300009665|Ga0116135_1001422 | All Organisms → cellular organisms → Bacteria | 12047 | Open in IMG/M |
| 3300009700|Ga0116217_10322733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 989 | Open in IMG/M |
| 3300009759|Ga0116101_1042891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300009824|Ga0116219_10262033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 979 | Open in IMG/M |
| 3300010341|Ga0074045_10189708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1381 | Open in IMG/M |
| 3300010358|Ga0126370_12579400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300010366|Ga0126379_13396358 | Not Available | 533 | Open in IMG/M |
| 3300010376|Ga0126381_103762297 | Not Available | 593 | Open in IMG/M |
| 3300010379|Ga0136449_100959310 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300010379|Ga0136449_101749904 | Not Available | 933 | Open in IMG/M |
| 3300012199|Ga0137383_10265573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1257 | Open in IMG/M |
| 3300012203|Ga0137399_11280489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300012208|Ga0137376_10260858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1503 | Open in IMG/M |
| 3300012210|Ga0137378_10127248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2354 | Open in IMG/M |
| 3300012357|Ga0137384_10615642 | Not Available | 885 | Open in IMG/M |
| 3300012927|Ga0137416_10780793 | Not Available | 844 | Open in IMG/M |
| 3300012930|Ga0137407_12415917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 502 | Open in IMG/M |
| 3300014156|Ga0181518_10076091 | All Organisms → cellular organisms → Bacteria | 1925 | Open in IMG/M |
| 3300014158|Ga0181521_10218593 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300014164|Ga0181532_10225203 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300014201|Ga0181537_10996170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300014489|Ga0182018_10002743 | All Organisms → cellular organisms → Bacteria | 16997 | Open in IMG/M |
| 3300014493|Ga0182016_10603661 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300014638|Ga0181536_10070454 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
| 3300014638|Ga0181536_10182337 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300015371|Ga0132258_11292849 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300017822|Ga0187802_10432258 | Not Available | 523 | Open in IMG/M |
| 3300017925|Ga0187856_1290710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300017935|Ga0187848_10068047 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300017946|Ga0187879_10180249 | Not Available | 1187 | Open in IMG/M |
| 3300017955|Ga0187817_10820521 | Not Available | 594 | Open in IMG/M |
| 3300018002|Ga0187868_1287407 | Not Available | 546 | Open in IMG/M |
| 3300018005|Ga0187878_1195257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300018008|Ga0187888_1146657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 968 | Open in IMG/M |
| 3300018015|Ga0187866_1088670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1300 | Open in IMG/M |
| 3300018016|Ga0187880_1042712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2470 | Open in IMG/M |
| 3300018016|Ga0187880_1091932 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300018022|Ga0187864_10188304 | Not Available | 987 | Open in IMG/M |
| 3300018022|Ga0187864_10329993 | Not Available | 673 | Open in IMG/M |
| 3300018030|Ga0187869_10398143 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300018042|Ga0187871_10212718 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300018042|Ga0187871_10524879 | Not Available | 655 | Open in IMG/M |
| 3300018046|Ga0187851_10856738 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300018482|Ga0066669_11359797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300020170|Ga0179594_10316867 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Anammoximicrobium → unclassified Candidatus Anammoximicrobium → Candidatus Anammoximicrobium sp. | 591 | Open in IMG/M |
| 3300020583|Ga0210401_11044325 | Not Available | 676 | Open in IMG/M |
| 3300021180|Ga0210396_10402632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1203 | Open in IMG/M |
| 3300021401|Ga0210393_10983868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300021405|Ga0210387_11197046 | Not Available | 660 | Open in IMG/M |
| 3300021432|Ga0210384_10905647 | Not Available | 782 | Open in IMG/M |
| 3300021432|Ga0210384_11687724 | Not Available | 539 | Open in IMG/M |
| 3300022557|Ga0212123_10652293 | Not Available | 655 | Open in IMG/M |
| 3300022732|Ga0224569_105626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Chloroflexineae → Oscillochloridaceae → Oscillochloris → unclassified Oscillochloris → Oscillochloris sp. ZM17-4 | 926 | Open in IMG/M |
| 3300025472|Ga0208692_1055441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300025527|Ga0208714_1027244 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300025533|Ga0208584_1161944 | Not Available | 502 | Open in IMG/M |
| 3300025922|Ga0207646_11591079 | Not Available | 564 | Open in IMG/M |
| 3300026078|Ga0207702_12093188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300026116|Ga0207674_10665846 | Not Available | 1005 | Open in IMG/M |
| 3300027394|Ga0209904_1000578 | All Organisms → cellular organisms → Bacteria | 3350 | Open in IMG/M |
| 3300027502|Ga0209622_1044088 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300027660|Ga0209736_1082563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| 3300027812|Ga0209656_10532661 | Not Available | 510 | Open in IMG/M |
| 3300027853|Ga0209274_10331232 | Not Available | 783 | Open in IMG/M |
| 3300027908|Ga0209006_10742485 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300028565|Ga0302145_10036013 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300029903|Ga0247271_106721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1924 | Open in IMG/M |
| 3300029918|Ga0302143_1118246 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300029943|Ga0311340_10790513 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300029954|Ga0311331_10164982 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
| 3300030057|Ga0302176_10162757 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300030058|Ga0302179_10028243 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
| 3300030509|Ga0302183_10409368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300031028|Ga0302180_10034105 | All Organisms → cellular organisms → Bacteria | 3163 | Open in IMG/M |
| 3300031028|Ga0302180_10353271 | Not Available | 745 | Open in IMG/M |
| 3300031525|Ga0302326_13374355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300031711|Ga0265314_10015117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6138 | Open in IMG/M |
| 3300031753|Ga0307477_10390985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300031823|Ga0307478_11541475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300031962|Ga0307479_10576206 | Not Available | 1108 | Open in IMG/M |
| 3300032160|Ga0311301_10649849 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300032205|Ga0307472_100382148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1170 | Open in IMG/M |
| 3300032205|Ga0307472_100783438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300032205|Ga0307472_101446863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300033888|Ga0334792_004758 | All Organisms → cellular organisms → Bacteria | 6279 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 13.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 12.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.34% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.92% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.92% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.92% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.92% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.92% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1001779172 | 3300000955 | Soil | MTLKNAALLALIGTILMTALQLWTFVITFLNVLRDLVPW* |
| JGI1027J12803_1007515772 | 3300000955 | Soil | MTLKNAALLALIGTILMTALLVWNFVVTFLNVLRDLVPAVSLF |
| JGI12636J13339_10488023 | 3300001154 | Forest Soil | MTLKNAALLALIGTVLITALLAWTFVLNVVDVLRGLLPAVILFSSFIHAFACFC |
| JGI12635J15846_102284722 | 3300001593 | Forest Soil | MTLKNAALLALIGTVLMTALLVWTFVFNFLNLLRGWFLR |
| JGI12635J15846_105531012 | 3300001593 | Forest Soil | MTLKNAALLPLIGTMLMTALLVWVFVSNLVNVLRGVDAPVVLFS |
| JGI25388J43891_10575162 | 3300002909 | Grasslands Soil | MTLKNAALLALIGTILITVLLVWTFFFNVVNVLRGLVPALTLFSS |
| Ga0070711_1020103881 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKNAALLALIGTILATVLLVCTFVFSFVNVLRGLAPPL |
| Ga0066681_108392422 | 3300005451 | Soil | MTLKGAALLALIGTILMTALLLWTFVVTFLNVLGDLVPAVTLL |
| Ga0070699_1003837144 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKNAALLALIGTILGTVLLVWTFIFDVVNVLRGLVPALTLFSSFI |
| Ga0070761_101369153 | 3300005591 | Soil | MPAMTLKNAALLALIGTILITVLLVWDFIFNVLNVLRGLIP |
| Ga0070763_100977801 | 3300005610 | Soil | MTLKNAALLALIGTILITALLVWDFVFNVLNVLRGLIPVTMLFSSFIY |
| Ga0075015_1001894712 | 3300006102 | Watersheds | MTLKNAALLALIGTILMTALLVWSFVLTLLNVVRDLVPA |
| Ga0116108_10126661 | 3300009519 | Peatland | MTLKNAALLALVGTILMTVLLVWNFVSNVLNVLRGVEAPIVLF |
| Ga0116108_12511711 | 3300009519 | Peatland | MTLKNAALLALVGTILMTVLLVWNFVSNVLNVLRGVEAPIVLFASFIYAFGC |
| Ga0105238_129213171 | 3300009551 | Corn Rhizosphere | MTLKKAALLALAGMILVTVLLVWDLVFNLLNVLRGLVPAVMLFSSFIYAFAAL |
| Ga0116138_10566081 | 3300009552 | Peatland | LLVLIGTILITALLVWTFVFNFLNVLRGLVPAVMLFSSFIYAF |
| Ga0116111_10179221 | 3300009616 | Peatland | MTLKNAALLALIGTILMTALLVWTFVFNFLNLLRGL |
| Ga0116111_10716761 | 3300009616 | Peatland | LLVLIGTILITALLVWTFVFNFLNVLRGLVPAVMLFSSFIYAFGC |
| Ga0116111_11634291 | 3300009616 | Peatland | MTPKNAALLALIGTILMTVLLVWQFVFNFLNLLRGLVPA |
| Ga0116123_11215491 | 3300009617 | Peatland | MTLKNATLLALVGTILMTVLLVWNFVSNVLNVLRGVEAPIV |
| Ga0116115_10054381 | 3300009631 | Peatland | MTLKNAALLALVGTLLMTVLLVWNFVFTFLNVLRDLVPAVTRFSSFIYAF |
| Ga0116118_11147711 | 3300009637 | Peatland | MTVKNAALLALVGTTLITALLLWRFVFNFLNVLRDLVPAVVLFSS |
| Ga0116110_12642001 | 3300009643 | Peatland | MTLKNAALLALVGTVLMTALLAWNFVSNVLNVLRGAEAPIVLFASFIYAFG |
| Ga0116121_11077791 | 3300009644 | Peatland | MTLKNAALLALVGTVLMTALLAWNFVSNVLNVLRGAEAPIVLFASFIYAFGC |
| Ga0116135_100142212 | 3300009665 | Peatland | MTLKNAALLALIGMVLMTALLVWNFVLTLLNVLRDLVPAVTLFS |
| Ga0116217_103227331 | 3300009700 | Peatlands Soil | MTLKNAALLALVGTILMTVLLVWNFVFTFLNVLRDLVPAVMLFS |
| Ga0116101_10428911 | 3300009759 | Peatland | MTLKNAALLALIGTVLMTALLLWNFALTLLNVLRDLVPAVTLFSSLIYA |
| Ga0116219_102620331 | 3300009824 | Peatlands Soil | MTLKNAALLALIGTILMTALLVWQFVFNLLNLLRGVVLAVMVF |
| Ga0074045_101897083 | 3300010341 | Bog Forest Soil | MTLKNAALLALIGTILITALLVWTFVFTILNFLRGVVPAV |
| Ga0126370_125794001 | 3300010358 | Tropical Forest Soil | MTLKNAALLALIGTILMTALLVWTFVVNVLNALRGL |
| Ga0126379_133963581 | 3300010366 | Tropical Forest Soil | MLNTPIMTLKNVALLALTGTILMTALLVWTCIFNVLNAVRGLVPAVTMLSSFIYAFG |
| Ga0126381_1037622972 | 3300010376 | Tropical Forest Soil | MTLKNAALLALIGTILLTALLLWTFVLNLLNVLRELVPAV |
| Ga0136449_1009593101 | 3300010379 | Peatlands Soil | MTLKNAALLALVGTILMTVLLVWNFVFTFLNVLRDLVPAVALFSSFIYA |
| Ga0136449_1017499042 | 3300010379 | Peatlands Soil | MTLKNAALLALVGTTLITALLLWRFVFNFLNVLRDL |
| Ga0137383_102655731 | 3300012199 | Vadose Zone Soil | MTLKNAALLALIGTILITVLLVWTFVFDVLNALRGLVP |
| Ga0137399_112804892 | 3300012203 | Vadose Zone Soil | MTLKNAALLALIGTILATVFLTWPFIMTALNVLRGLAPPLMLFPWFVYGL |
| Ga0137376_102608581 | 3300012208 | Vadose Zone Soil | MTLKNAALLALIGTILITVLLVWTFFFNVVNVLRGLVPALTLFSSFIYAFACL |
| Ga0137378_101272481 | 3300012210 | Vadose Zone Soil | MTLKNAALMALFGTILMTALLVWAFVLTFLNILRGLVPAVTLFSSFIYAF |
| Ga0137384_106156421 | 3300012357 | Vadose Zone Soil | MTLKNAALMALFGTILMTALLVWALVLTFLNILRGL |
| Ga0137416_107807931 | 3300012927 | Vadose Zone Soil | MTVKNAALLALIGTILATVLLVWTFVSTALNVLRGLAPAVMLFPL |
| Ga0137407_124159173 | 3300012930 | Vadose Zone Soil | MTLKNAALLALIGTILATVLLVWTFVFNFVNVLRGLA |
| Ga0181518_100760911 | 3300014156 | Bog | VTLKNAALLALVGTILMTVLLVWNFVSNVLNVLRGVEAPIVLF |
| Ga0181521_102185931 | 3300014158 | Bog | MTLKNAALLALVGTILMTVLLVWNFVSNVLNVLRG |
| Ga0181532_102252033 | 3300014164 | Bog | MTVKNAALLALIGTLLITVVLVWTFAFNVLNALRGLIPAVM |
| Ga0181537_109961701 | 3300014201 | Bog | MTLKNAALLALIGTVLVTALLTWTFIFNFLNVLRGLVP |
| Ga0182018_100027431 | 3300014489 | Palsa | MTLKNAALLALIGTVLMTALLVWNFVFNLINLLRGLVPAVTLF |
| Ga0182016_106036611 | 3300014493 | Bog | MTLKAAAFLALIGTILMTVLLVWNFALTLINVLRDLVPAVTLF |
| Ga0181536_100704541 | 3300014638 | Bog | VTLKNAALLALVGTILMTVLLVWNFVSNVLNVLRGVEAPIV |
| Ga0181536_101823371 | 3300014638 | Bog | MTLKNAALLALIGTILMTALLLWNFVSNLLNVLRGVEAPIVLFASFIYAF |
| Ga0132258_112928492 | 3300015371 | Arabidopsis Rhizosphere | MTLKNAALLALIGTILMTALQLWTFVITFLNVLRDLVPAR* |
| Ga0187802_104322581 | 3300017822 | Freshwater Sediment | MTLKNAALLALIGTVLMTALLGLTFVFNVINALRGLIPALTLFSSFIYAF |
| Ga0187856_12907101 | 3300017925 | Peatland | MTLKNVALLALVGTILMTALLVWNFVFNLLNLLRGLVPAVTLFSSFI |
| Ga0187848_100680471 | 3300017935 | Peatland | MTLKNAALLALVGTILMTVLLVWNFVSNVLNVLRGVEA |
| Ga0187879_101802491 | 3300017946 | Peatland | LLVLIGTILITALLVWNFVFTFLNVLRDLVPAVTLFSSLIYAFGSLS |
| Ga0187817_108205212 | 3300017955 | Freshwater Sediment | MPAMTLKNAALLALIGTILATALLVWTFAFNVLNVLRGLVPAIALFSSFIY |
| Ga0187868_12874072 | 3300018002 | Peatland | MTLKNAALLALIGTVLMTALLVWTFVFNFLNLLQGLVPAVVFGSGPV |
| Ga0187878_11952572 | 3300018005 | Peatland | MTLKNAALLALVGTILMTVLLVWNFVFTFLNVLRDLVPAV |
| Ga0187888_11466571 | 3300018008 | Peatland | MTLKNAALLALVGTILMTVLLVWNFVSNVLNVLRGVEAPIV |
| Ga0187866_10886701 | 3300018015 | Peatland | MTLKNAALLALIGTVLMTALLVWQFVFNLLNLLRGLVPAVTLFS |
| Ga0187880_10427123 | 3300018016 | Peatland | MTLKNAALLALIGTILITALLVWPFVFNVLNVLRGLVPAVMLFSSFI |
| Ga0187880_10919323 | 3300018016 | Peatland | MTLKNGALLALIGTILMTVLLVWTFVFNFLNLLRGLVPAVTLFSSLIYAFG |
| Ga0187864_101883042 | 3300018022 | Peatland | MTLKNAALLALVGTILMTALLVWNFVSNVVNVLRGVDAPVVLFHSLIF |
| Ga0187864_103299931 | 3300018022 | Peatland | MTVKNAALLALVGTTLITALLLWRFVFNFLNVLRDLVPAVVLFSSFIEAF |
| Ga0187869_103981431 | 3300018030 | Peatland | MTLKNAALLALIGTALMTGFLVWNFVLTFLNVLRDSVPAVTRF |
| Ga0187871_102127181 | 3300018042 | Peatland | MTLKNAALLALVGTILMTVLLVWNFVLTLLNVLRDLVPP |
| Ga0187871_105248792 | 3300018042 | Peatland | MTLKNAALLALIGTILMTVLLVWNFVSNVLNVLRGAEAPIVLFASFIYAF |
| Ga0187851_108567381 | 3300018046 | Peatland | MTLKSAALLALVGTILMTVLLVWNFVLTLLNVLRDLVPPVRL |
| Ga0066669_113597971 | 3300018482 | Grasslands Soil | MTLKNAALLALIGTILMTALLVWTFVLTFLNVLRDLVPAM |
| Ga0179594_103168671 | 3300020170 | Vadose Zone Soil | MTLKNAALLALIGTILATVLLVWTFVFNFVNVLRGLAPPVLL |
| Ga0210401_110443251 | 3300020583 | Soil | MTLNNAALLALTGTILMTALLLCTFVLTFLNVLRDLVPAVTLFT |
| Ga0210396_104026321 | 3300021180 | Soil | MTLKNAALLALIGTILMTALLLWTFVSNMINVLRGVDAPVVLFSSFLYAFGCF |
| Ga0210393_109838682 | 3300021401 | Soil | MTLKNAALLALIGTILMTALLLQSFVLTFLNVLRDLVPAVTLFQS |
| Ga0210387_111970461 | 3300021405 | Soil | MTLKNAALLALIGTILLTALLLWNFIFNLLNLLRGLIP |
| Ga0210384_109056471 | 3300021432 | Soil | MTLKNAALLALTGTILMTALLLCTFVLTFLNVLRDLVPAVTLFTSF |
| Ga0210384_116877241 | 3300021432 | Soil | MTLKNAALLALIGTILATVLLVCIFVFNFVNVLRGLAPPL |
| Ga0212123_106522931 | 3300022557 | Iron-Sulfur Acid Spring | MTIKNAALLALVGTILMTALLLWTFVFTVLNVLRGVVPAVMLFQSFIYALAASA |
| Ga0224569_1056261 | 3300022732 | Rhizosphere | MTLKSATLLALIGTILMTALLAWDFAFTVLNVLRGVV |
| Ga0208692_10554412 | 3300025472 | Peatland | MTLKNAALLALIGTVLMTALLVWQFVFNLLNLLRGLVPAVTLFSSFIY |
| Ga0208714_10272442 | 3300025527 | Arctic Peat Soil | MTLKNAALLALIGTILMTALLVWTFVFNSLNLLRGLVPAVTLF |
| Ga0208584_11619442 | 3300025533 | Arctic Peat Soil | MTLKNAALLALIGTILMTALLVWTFVFNFLNLLRGLV |
| Ga0207646_115910791 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKNAALLALIGTIMMAALLVWVFVSNVVNVLRGVDAPVVLF |
| Ga0207702_120931883 | 3300026078 | Corn Rhizosphere | MTLKNAALLALIGTILMTALLLWTFVLTFLNVLRDLVPAVTLFQSFVYA |
| Ga0207674_106658463 | 3300026116 | Corn Rhizosphere | MTLKKAALLALAGMILVTVLLVWDLVFNLLNVLRGLVPAVMLFSS |
| Ga0209904_10005785 | 3300027394 | Thawing Permafrost | MTLKNAALLALIGTILMTALLVWTFVFNFLNLLRGLVPAVTLFQSFIYAF |
| Ga0209622_10440882 | 3300027502 | Forest Soil | MTLKNAALLALIGTVLMTALLVWNFVFNLLNLLRGL |
| Ga0209736_10825631 | 3300027660 | Forest Soil | MTLKNAALLALIGTILVTALLVWTFVFNVVNVLRGLVPALT |
| Ga0209656_105326611 | 3300027812 | Bog Forest Soil | MTLKNAAVLALVGTILMTVLLMWNFVSNVLNVLRGVQA |
| Ga0209274_103312321 | 3300027853 | Soil | MPAMTLKNAALLALIGTILITVLLVWDFIFNVLNVLRGLIPATMLFS |
| Ga0209006_107424851 | 3300027908 | Forest Soil | MTIKNAALLALAGTILMTALLLWTFVFTVLNVLRGV |
| Ga0302145_100360131 | 3300028565 | Bog | MTLKNAALLALVGTILMTVLLVWNFVSNVLHVLRGVEAPIVLFASFIYAFGCL |
| Ga0247271_1067214 | 3300029903 | Soil | MTLKNASLLALVGTILMTVLSVWNFVLTLLNVLRDLVPPVRLFSS |
| Ga0302143_11182461 | 3300029918 | Bog | MTLKAAAFLALIGTILMTVLLVWNFALTLINVLRDLVP |
| Ga0311340_107905132 | 3300029943 | Palsa | MTLKNAALLALIGTILMTALLVWDFVFTVLNVLRGVIPAVMLFHSFIYAFGCS |
| Ga0311331_101649821 | 3300029954 | Bog | MTLKAAAFLALIGTILMTVLLVWNFALTLINVLRDLVPAV |
| Ga0302176_101627571 | 3300030057 | Palsa | MTLKNAALLALIGTILMTALLVWDFVFTVLNVLRGVIPAVMLFHSFIYAF |
| Ga0302179_100282432 | 3300030058 | Palsa | MTLKNAALLALIGTILMTALLVWDFVFTVLNVLRGVIPAVMLF |
| Ga0302183_104093682 | 3300030509 | Palsa | MTLKNAALLALIGTILMTALLVWTFVLTFLNVLRDLVPAATLFQSFIYAF |
| Ga0302180_100341051 | 3300031028 | Palsa | MTLKNAALLGLIGTTLLTALLVWNFLIACLNVMRDLIPPVALFSSLI |
| Ga0302180_103532712 | 3300031028 | Palsa | MTLKNAALLALIGTILMRALMVWPLVLTFLNVLRDGFRR |
| Ga0302326_133743552 | 3300031525 | Palsa | MTLKNAALLALIGTVLVTALLTWTFIFNFLDVLRGLVPPVA |
| Ga0265314_100151175 | 3300031711 | Rhizosphere | MTLKNAGLLAFVGTMVMTILLVWNLVFNLLNLLRGLVPAVTAFSSFICV |
| Ga0307477_103909851 | 3300031753 | Hardwood Forest Soil | MTLKNAALLALIGTILMTALLVWTLVLTFLNVLRDLVPAVTLFSSF |
| Ga0307478_115414751 | 3300031823 | Hardwood Forest Soil | MTLKNAALLALTGTVLITALLVWTFVFNVVDVLRGLLPAVI |
| Ga0307479_105762063 | 3300031962 | Hardwood Forest Soil | MTIKNAALLAVIGTILMTALLLWSFVLTFLNVLRDLVPAVTLFSS |
| Ga0311301_106498491 | 3300032160 | Peatlands Soil | MTVKNAALLALIGTLLITVLLVWTFVFNVLNALRGLIPAVLLFS |
| Ga0307472_1003821482 | 3300032205 | Hardwood Forest Soil | MTVKNAALLALIGTILATVLLVWTFVSTALNVLRGLAP |
| Ga0307472_1007834383 | 3300032205 | Hardwood Forest Soil | MTLKNAALLALIGTILITALLVWTFALNVLNVLRGAVPAVI |
| Ga0307472_1014468632 | 3300032205 | Hardwood Forest Soil | MTLKTASLLALIGTVLVTALLTWNLIFSVVNVLRGLLPAAVLFPA |
| Ga0334792_004758_3_116 | 3300033888 | Soil | MTLKNAALLALIGTILMTALLLWTFVFTFLNVLRNVVP |
| ⦗Top⦘ |