NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089474

Metagenome / Metatranscriptome Family F089474

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089474
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 44 residues
Representative Sequence LHRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNP
Number of Associated Samples 96
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.50 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 97.25 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.083 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil
(39.450 % of family members)
Environment Ontology (ENVO) Unclassified
(45.872 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(67.890 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 55.56%    β-sheet: 0.00%    Coil/Unstructured: 44.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF16363GDP_Man_Dehyd 87.16
PF01370Epimerase 10.09
PF02655ATP-grasp_3 0.92
PF09913DUF2142 0.92



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.08 %
UnclassifiedrootN/A0.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001333|A21PFW6_1036979All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300001537|A2065W1_11010551All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300004081|Ga0063454_101960188All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300004643|Ga0062591_100229776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1394Open in IMG/M
3300005440|Ga0070705_101057184All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300005458|Ga0070681_11005554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300005543|Ga0070672_101139135All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300005552|Ga0066701_10740856All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium588Open in IMG/M
3300005561|Ga0066699_11187752All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300005937|Ga0081455_10657378All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300006163|Ga0070715_10127546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1220Open in IMG/M
3300006237|Ga0097621_101828913All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300006797|Ga0066659_11870474All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300006800|Ga0066660_11405603All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300006871|Ga0075434_102076818All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300009137|Ga0066709_100007033All Organisms → cellular organisms → Bacteria9643Open in IMG/M
3300009553|Ga0105249_11352361All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300010084|Ga0127461_1075245All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300010086|Ga0127496_1004744All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300010087|Ga0127492_1079883All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300010092|Ga0127468_1101104All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300010093|Ga0127490_1012348All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300010095|Ga0127475_1024643All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300010099|Ga0127450_1065245All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300010104|Ga0127446_1105168All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300010112|Ga0127458_1108123All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300010117|Ga0127449_1142021All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300010119|Ga0127452_1107555All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300010122|Ga0127488_1164910All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300010128|Ga0127486_1013152All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300010140|Ga0127456_1220943All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300010142|Ga0127483_1144298All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300010145|Ga0126321_1245184All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300010359|Ga0126376_10542687All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium1086Open in IMG/M
3300011106|Ga0151489_1274728All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300011998|Ga0120114_1047634All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300012189|Ga0137388_10683167All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300012198|Ga0137364_11318238All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300012211|Ga0137377_10004760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10735Open in IMG/M
3300012224|Ga0134028_1035675All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300012224|Ga0134028_1179134All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300012358|Ga0137368_10245815Not Available1239Open in IMG/M
3300012359|Ga0137385_11422191All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300012374|Ga0134039_1034891All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300012379|Ga0134058_1147549All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012383|Ga0134033_1238443All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300012385|Ga0134023_1038216All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium626Open in IMG/M
3300012385|Ga0134023_1120780All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300012386|Ga0134046_1248134All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300012389|Ga0134040_1107668All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300012390|Ga0134054_1232325All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300012391|Ga0134035_1112509All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300012393|Ga0134052_1187286All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300012395|Ga0134044_1001684All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300012395|Ga0134044_1069057All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300012395|Ga0134044_1076838All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300012398|Ga0134051_1356249All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300012399|Ga0134061_1068922All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300012399|Ga0134061_1347142All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300012400|Ga0134048_1280158All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300012402|Ga0134059_1203222All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300012402|Ga0134059_1224194All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300012402|Ga0134059_1370348All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300012403|Ga0134049_1070968All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300012407|Ga0134050_1017338All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300012407|Ga0134050_1062347All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300012410|Ga0134060_1358428All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300012469|Ga0150984_104108164All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300012469|Ga0150984_108577099All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium820Open in IMG/M
3300012898|Ga0157293_10094943All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300012918|Ga0137396_10778671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → environmental samples → uncultured Nocardioides sp.704Open in IMG/M
3300012929|Ga0137404_10796914All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300012972|Ga0134077_10458287All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300012985|Ga0164308_10479627All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium1036Open in IMG/M
3300015359|Ga0134085_10453268All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300015371|Ga0132258_10667560All Organisms → cellular organisms → Bacteria2615Open in IMG/M
3300019255|Ga0184643_1129421All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300019269|Ga0184644_1024159All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300019279|Ga0184642_1097232All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300019279|Ga0184642_1724738All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300019875|Ga0193701_1012945All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300020000|Ga0193692_1116612All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300020001|Ga0193731_1117839All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300021080|Ga0210382_10356240All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300025911|Ga0207654_11008058All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300025916|Ga0207663_10926118All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium697Open in IMG/M
3300026095|Ga0207676_10429480All Organisms → cellular organisms → Bacteria1241Open in IMG/M
3300027748|Ga0209689_1346095All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300028711|Ga0307293_10282614All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300028713|Ga0307303_10185350All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300028718|Ga0307307_10307006All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300028791|Ga0307290_10345879All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300028793|Ga0307299_10274303All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300028796|Ga0307287_10192057All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300028802|Ga0307503_10609629All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300028807|Ga0307305_10275205All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300028807|Ga0307305_10410417All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300028811|Ga0307292_10075033All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300028811|Ga0307292_10204006All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300028814|Ga0307302_10120172All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300028814|Ga0307302_10623897All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300028881|Ga0307277_10249260All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300028884|Ga0307308_10434897All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300030785|Ga0102757_11280384All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300030903|Ga0308206_1024942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → environmental samples → uncultured Nocardioides sp.1043Open in IMG/M
3300030993|Ga0308190_1022892All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300031058|Ga0308189_10414573All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300031094|Ga0308199_1129381All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300031366|Ga0307506_10276265All Organisms → cellular organisms → Bacteria649Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil39.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil22.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.42%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment4.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.59%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.75%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.83%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.92%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.92%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001333Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010084Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010086Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010087Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010092Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010093Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010095Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010099Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010104Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010112Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010117Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010119Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010122Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010128Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010140Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010142Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011998Permafrost microbial communities from Nunavut, Canada - A30_35cm_6MEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012224Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012374Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012379Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012383Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012385Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012386Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012389Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012390Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012391Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012393Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012395Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012398Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012399Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012400Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012402Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012407Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030785Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A21PFW6_103697913300001333PermafrostLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDSMTLHGN
A2065W1_1101055113300001537PermafrostLPRRIGVAAAIVFVAAVLCVPAAEAKAHMLIGIQDDAMTLRGNPTFTFPTLKQLR
Ga0063454_10196018813300004081SoilLHKRVGVFAAIVFLAAALSVPAAQAKRHMLIGLQDDAMTLFGN
Ga0062591_10022977613300004643SoilLFRRIGVAAAIILVAAGLAVPAAQAKAHMLVGLQDDAMTLRGNPTFTFSTLK
Ga0070705_10105718413300005440Corn, Switchgrass And Miscanthus RhizosphereLPRRIGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGNPTFTFST
Ga0070681_1100555413300005458Corn RhizosphereLRRRMGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMALHGNPQFTFSTLKS
Ga0070672_10113913523300005543Miscanthus RhizosphereLRRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPS
Ga0066701_1074085623300005552SoilLHRRFGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAM
Ga0066699_1118775213300005561SoilLRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMVLRGNPIFTF
Ga0081455_1065737823300005937Tabebuia Heterophylla RhizosphereLRRRIGVIVATALVAVGLCVPTAQAQRRLLVGMQDDAMVLRGDPTFTFR
Ga0070715_1012754623300006163Corn, Switchgrass And Miscanthus RhizosphereMGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLHGNPQFTFST
Ga0097621_10182891323300006237Miscanthus RhizosphereLHRRLGVLAAIVFLAAALSVPAAQAKRHMLIGLQDDAMTLFGNPTFTFR
Ga0066659_1187047413300006797SoilLPRRLGVLAAIVFAAAGLCVPAASAKAHMLVGIQDDALT
Ga0066660_1140560323300006800SoilVALLVAAGLSAPAATASRHMLVGIQDEANTLYGNPDQ
Ga0075434_10207681813300006871Populus RhizosphereLHRRIGVVAATVLVAAGLCVPAATAARHLLVGIQDDAMVLRGNPTFTFGMLKQLR
Ga0066709_10000703313300009137Grasslands SoilLHRRFGVFAAIVLVSAGLSVPAAQAQRHLLVGIQDDAM
Ga0105249_1135236123300009553Switchgrass RhizosphereMGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLHGNPQFTFSTLKSL
Ga0127461_107524513300010084Grasslands SoilLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNPTFT
Ga0127496_100474413300010086Grasslands SoilLRRRIGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGN
Ga0127492_107988323300010087Grasslands SoilLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNPTVTFQ
Ga0127468_110110423300010092Grasslands SoilLRRRVGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGDPTFT
Ga0127490_101234813300010093Grasslands SoilLHKRVGVFAAIVFLAAALSVPAAQAKRHMLIGLQDD
Ga0127475_102464313300010095Grasslands SoilLRRRVGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGNP
Ga0127450_106524513300010099Grasslands SoilLAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMVLRGNPQFTFST
Ga0127446_110516823300010104Grasslands SoilLRRRVGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGDP
Ga0127458_110812323300010112Grasslands SoilLRRSLGVLAAIILFAAGLSVPAAQAKQHMLVGLQDDAMVLY
Ga0127449_114202123300010117Grasslands SoilLPRRIGVAAAIVFVAAVLCVPVAQAKAHMLVGIQDDAMTLHGNPT
Ga0127452_110755523300010119Grasslands SoilLFRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNPTVTF
Ga0127488_116491023300010122Grasslands SoilLAAIVLVAAGFAVPAAQAQRHLLVGIQDDAMVLRGNPQ
Ga0127486_101315223300010128Grasslands SoilLPRRLGVFAAIVLVVAGLSVPAAQAKRHLLVGIQDDSMTLRGNP
Ga0127456_122094323300010140Grasslands SoilLPRRIGVAAAIVFVAAVLYVPVAQAKAHMLVGIQDDAMTLHGNPTFTFPTLK
Ga0127483_114429823300010142Grasslands SoilLHKRVGVFAAIVFLAAALSVPAAQAKRHMLIGLQD
Ga0126321_124518423300010145SoilLPKRLGVLAAIVLLAAGLSVPAAQAKRGMLIGIQDDAMVLFGN
Ga0126376_1054268713300010359Tropical Forest SoilLPKNIGVFAATVFLAAALAVPAAQAKNHMLVGMQDD
Ga0151489_127472823300011106SoilLRRRIGVAAAIVLVAASLAEPAAQAKQHMLVGIQDDAMTL
Ga0120114_104763423300011998PermafrostLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDSMTLHGNPTFTFPTL
Ga0137388_1068316713300012189Vadose Zone SoilLPRRIGVAAAIVFVAAVLCVPAAEAKAHMLIGIQDDAMTLRGDPTFTFPTLKQLRT
Ga0137364_1131823823300012198Vadose Zone SoilVVAAAIVLIAAGLAVPAAQAKAHMLVGIQDDSMTLHGNPTFTFTTLK
Ga0137377_1000476013300012211Vadose Zone SoilLAAIVLVAAGLCVPAASAKAHMLVGIQDDALTLHGNPTFTFPTLKQ
Ga0134028_103567513300012224Grasslands SoilLHRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPTFTF
Ga0134028_117913413300012224Grasslands SoilLPRRIGVAAAIAFAAAGLCVPVASAKAHMLVGIQD
Ga0137368_1024581523300012358Vadose Zone SoilLPRRIGVFAAIVLVAAGLCVPAAQAQRHLLVGMQDDSMA
Ga0137385_1142219113300012359Vadose Zone SoilLPRRIGVAAAIVFVAAGLCVPVASAKAHMLVGIQDDAMTLRGNPTFTFPTLKQL
Ga0134039_103489123300012374Grasslands SoilLRRRVGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGDPTFTFPILK
Ga0134058_114754913300012379Grasslands SoilLRRRIGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDA
Ga0134033_123844323300012383Grasslands SoilLRRRIGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGNP
Ga0134023_103821613300012385Grasslands SoilLHRRFGVFAAIVFVAAALSVPAAQAKNHMLIGMQDDA
Ga0134023_112078023300012385Grasslands SoilLAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMVLRGNPQFTFSTLKQLR
Ga0134046_124813423300012386Grasslands SoilLLRRTAFIAALVLVAAGLAIPAAQAKQHMLVGIQDDAMTLRGNPTV
Ga0134040_110766813300012389Grasslands SoilVVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGNPTFTFSTLK
Ga0134054_123232513300012390Grasslands SoilLFRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTL
Ga0134035_111250913300012391Grasslands SoilLRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGNPTFTFSTLKQLR
Ga0134052_118728623300012393Grasslands SoilLRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGNPQFT
Ga0134044_100168413300012395Grasslands SoilLRRSLGVLAAIILLAAGLSVPAAQAKQHMLVGLQDDAMVL
Ga0134044_106905713300012395Grasslands SoilLRKRIGVFAAIALLAAALSVPAAQAKRHMLIGLQDDAMVL
Ga0134044_107683823300012395Grasslands SoilLRRRIGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGNPTFTFSTLKQ
Ga0134051_135624923300012398Grasslands SoilLRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGDPTFTFPILKQLR
Ga0134061_106892223300012399Grasslands SoilLRRRIGVFAAIFFLAAGLSVPAAQAKRHMLIGIQDD
Ga0134061_134714223300012399Grasslands SoilLPRRIGVAAAIVFVAAVLCVPVAQAKAHMLVGIQD
Ga0134048_128015823300012400Grasslands SoilLHRRFGVFAAIVFVAAALSVPAAQAKNHMLIGMQDD
Ga0134059_120322213300012402Grasslands SoilLHRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDATVLHGNPTFTF
Ga0134059_122419423300012402Grasslands SoilLRRQLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDD
Ga0134059_137034823300012402Grasslands SoilLPRRIGVAAAIVFVAAGLCVPAASAKAHMLIGIQDDAMTLRGNP
Ga0134049_107096813300012403Grasslands SoilLPRRIGVAAAIVFVAAGLCVPAASAKAHMLIGIQDDAM
Ga0134050_101733823300012407Grasslands SoilLRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLRGDPTFTFPILKQL
Ga0134050_106234713300012407Grasslands SoilLPRRIGVAAAIVFVAAVLCVPVAQAKAHMLVGIQDDAMTLH
Ga0134060_135842823300012410Grasslands SoilLRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGVQDDAMTLRGNSQFTFS
Ga0150984_10410816413300012469Avena Fatua RhizosphereLLRRAGILTAIALVVVGLAVPAAQAKRHMLVGIQDD
Ga0150984_10857709913300012469Avena Fatua RhizosphereLRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAM
Ga0157293_1009494323300012898SoilLRRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTL
Ga0137396_1077867113300012918Vadose Zone SoilLPSRIGVAAAIVFVAASLCVPVASAKAHMLVGIQDDAMTLQGNPT
Ga0137404_1079691423300012929Vadose Zone SoilLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGN
Ga0134077_1045828723300012972Grasslands SoilLRRRLGVFAAIVLVAAGLAVPAAQAQRHLLVGIQDDAMTLR
Ga0164308_1047962713300012985SoilLRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLHGNPQ
Ga0134085_1045326823300015359Grasslands SoilLAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPAFTFGTLK
Ga0132258_1066756043300015371Arabidopsis RhizosphereLPKRIGVILATALAAVGLCVPAAQAQRHLLVGLQDD
Ga0184643_112942123300019255Groundwater SedimentLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQD
Ga0184644_102415923300019269Groundwater SedimentLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNP
Ga0184642_109723213300019279Groundwater SedimentLRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLH
Ga0184642_172473823300019279Groundwater SedimentLRRRIGVAAAIVLVAAGLAVPAAQAKPHMLVGIQDDAMTLRGNPTFTFGTLK
Ga0193701_101294513300019875SoilLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGTPTFTFQ
Ga0193692_111661213300020000SoilLRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLHG
Ga0193731_111783923300020001SoilLPRRIGVAAAIVFVAASLCVPAASAKAHMLVGIQD
Ga0210382_1035624023300021080Groundwater SedimentLLRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGN
Ga0207654_1100805813300025911Corn RhizosphereMGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLHGNP
Ga0207663_1092611823300025916Corn, Switchgrass And Miscanthus RhizosphereMGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMALHGNPQFTFST
Ga0207676_1042948033300026095Switchgrass RhizosphereMGVAAAIVLVAEGLAVPAAQAKQHMLVGIQDDAMTLHG
Ga0209689_134609523300027748SoilLPRRIGVAAAIVFVAAGLCVPVASAKAHMLVGIQDDAMTLHGNPTFTFPTLKQL
Ga0307293_1028261413300028711SoilLFRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPTFTFSTLK
Ga0307303_1018535013300028713SoilLLRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDSMTLRGNPTFTFSTLK
Ga0307307_1030700613300028718SoilLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNPTLT
Ga0307290_1034587913300028791SoilLFRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDD
Ga0307299_1027430323300028793SoilLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNPTFTFQTLK
Ga0307287_1019205713300028796SoilLRKRIGVFAAIALLAAALSVPAAQAKRHMLIGLQDDAMVLF
Ga0307503_1060962923300028802SoilLRRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPSFTFP
Ga0307305_1027520513300028807SoilLFRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPTFTF
Ga0307305_1041041723300028807SoilLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAM
Ga0307292_1007503313300028811SoilLFRRIGVAAAIVFVAAGLSVPAAQAKAHMLVGIQDDAMTL
Ga0307292_1020400613300028811SoilLPRRIGVAAAIVLVAAGLAVPAASAKAHMLIGIQDDAMT
Ga0307302_1012017213300028814SoilLPRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGLQDDAMTLRGNPTSTF
Ga0307302_1062389723300028814SoilLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNTTFTFQT
Ga0307277_1024926023300028881SoilLPRRIGVAAAIVLVAAGLAVPAASAKAHMLVGIQDDA
Ga0307308_1043489723300028884SoilLRRRIGVAAAIVFVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNPT
Ga0102757_1128038423300030785SoilLHRRIGVAAAIVLVAAGLAVPAAQAKAHMLVGIQDDAMTLRGNP
Ga0308206_102494223300030903SoilLRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMTLHGNPQFT
Ga0308190_102289213300030993SoilLRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMALHGNP
Ga0308189_1041457323300031058SoilLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRG
Ga0308199_112938113300031094SoilLPRRIGVAAAIVFVAAGLCVPAASAKAHMLVGIQDDAMTLRGNPTFTF
Ga0307506_1027626523300031366SoilLRRRIGVAAAIVLVAAGLAVPAAQAKQHMLVGIQDDAMT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.