NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F089463

Metagenome Family F089463

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089463
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 51 residues
Representative Sequence MKRMILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS
Number of Associated Samples 90
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 9.17 %
% of genes near scaffold ends (potentially truncated) 22.02 %
% of genes from short scaffolds (< 2000 bps) 81.65 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(22.018 % of family members)
Environment Ontology (ENVO) Unclassified
(37.615 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.294 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.30%    β-sheet: 0.00%    Coil/Unstructured: 55.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF14026DUF4242 11.01
PF04397LytTR 8.26
PF13191AAA_16 2.75
PF00171Aldedh 0.92
PF08541ACP_syn_III_C 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.92
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.92
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.92

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_100897368All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium662Open in IMG/M
3300000956|JGI10216J12902_105482925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium959Open in IMG/M
3300004022|Ga0055432_10047100All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1017Open in IMG/M
3300004114|Ga0062593_100520577All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1109Open in IMG/M
3300004114|Ga0062593_100536809All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1096Open in IMG/M
3300004114|Ga0062593_100769048All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium952Open in IMG/M
3300004157|Ga0062590_102212134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium576Open in IMG/M
3300004463|Ga0063356_100002204All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes15734Open in IMG/M
3300004463|Ga0063356_101259821All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300004643|Ga0062591_101956577All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium603Open in IMG/M
3300005290|Ga0065712_10001290All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis6263Open in IMG/M
3300005290|Ga0065712_10070250All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes6174Open in IMG/M
3300005290|Ga0065712_10575359All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium587Open in IMG/M
3300005294|Ga0065705_10877489All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium566Open in IMG/M
3300005334|Ga0068869_101916215All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium531Open in IMG/M
3300005337|Ga0070682_100112085All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1819Open in IMG/M
3300005340|Ga0070689_101150009All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium695Open in IMG/M
3300005343|Ga0070687_100495083All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium822Open in IMG/M
3300005354|Ga0070675_101825779All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium561Open in IMG/M
3300005356|Ga0070674_100672529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium882Open in IMG/M
3300005356|Ga0070674_100997093All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium735Open in IMG/M
3300005364|Ga0070673_100835289All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium852Open in IMG/M
3300005456|Ga0070678_101874264All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium566Open in IMG/M
3300005459|Ga0068867_102240909All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium519Open in IMG/M
3300005466|Ga0070685_10005892All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae6236Open in IMG/M
3300005615|Ga0070702_100780996All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium737Open in IMG/M
3300005834|Ga0068851_10154052All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1258Open in IMG/M
3300005841|Ga0068863_100014415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes7614Open in IMG/M
3300005841|Ga0068863_100934276All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium868Open in IMG/M
3300006031|Ga0066651_10283205All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium882Open in IMG/M
3300006046|Ga0066652_101335618All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium674Open in IMG/M
3300006163|Ga0070715_10277660All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium887Open in IMG/M
3300006358|Ga0068871_100065513All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2976Open in IMG/M
3300006358|Ga0068871_101089223All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium747Open in IMG/M
3300006844|Ga0075428_101146824All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium820Open in IMG/M
3300006904|Ga0075424_101630057All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium684Open in IMG/M
3300009100|Ga0075418_10088107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3299Open in IMG/M
3300009100|Ga0075418_11175465All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium831Open in IMG/M
3300009156|Ga0111538_10586272All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1414Open in IMG/M
3300009156|Ga0111538_11540787All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium838Open in IMG/M
3300009553|Ga0105249_11308468All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium796Open in IMG/M
3300009610|Ga0105340_1279958All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium722Open in IMG/M
3300010036|Ga0126305_10000033All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes55238Open in IMG/M
3300010401|Ga0134121_13067485All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium514Open in IMG/M
3300010403|Ga0134123_10787299All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium942Open in IMG/M
3300010403|Ga0134123_13630089All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium501Open in IMG/M
3300011423|Ga0137436_1142675All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium640Open in IMG/M
3300012232|Ga0137435_1280138All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium504Open in IMG/M
3300012882|Ga0157304_1054761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium624Open in IMG/M
3300012882|Ga0157304_1096767All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium532Open in IMG/M
3300012892|Ga0157294_10041713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1007Open in IMG/M
3300012892|Ga0157294_10092372All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium764Open in IMG/M
3300012893|Ga0157284_10006065All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1991Open in IMG/M
3300012898|Ga0157293_10326853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium517Open in IMG/M
3300012899|Ga0157299_10167447All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium636Open in IMG/M
3300012901|Ga0157288_10173048All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium665Open in IMG/M
3300012907|Ga0157283_10373163All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium521Open in IMG/M
3300012909|Ga0157290_10004554All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2348Open in IMG/M
3300012912|Ga0157306_10470335All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium509Open in IMG/M
3300012984|Ga0164309_11249869All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium626Open in IMG/M
3300013296|Ga0157374_10372140All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1422Open in IMG/M
3300014325|Ga0163163_11660102All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium700Open in IMG/M
3300014326|Ga0157380_11695019All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium689Open in IMG/M
3300014745|Ga0157377_10451896All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium887Open in IMG/M
3300014969|Ga0157376_10616069All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1082Open in IMG/M
3300014969|Ga0157376_12312852All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium577Open in IMG/M
3300015201|Ga0173478_10612494All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium567Open in IMG/M
3300015371|Ga0132258_10838452All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2319Open in IMG/M
3300015371|Ga0132258_13579870All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1062Open in IMG/M
3300015373|Ga0132257_101476604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium867Open in IMG/M
3300017792|Ga0163161_10065168All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2658Open in IMG/M
3300017792|Ga0163161_11358241All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium619Open in IMG/M
3300018072|Ga0184635_10023592All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2274Open in IMG/M
3300018083|Ga0184628_10123998All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1337Open in IMG/M
3300018476|Ga0190274_10080403All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2505Open in IMG/M
3300019356|Ga0173481_10149488All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium962Open in IMG/M
3300019361|Ga0173482_10064775All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1231Open in IMG/M
3300019361|Ga0173482_10209501All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium804Open in IMG/M
3300019362|Ga0173479_10128598All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae982Open in IMG/M
3300019362|Ga0173479_10644409All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium562Open in IMG/M
3300021415|Ga0193694_1000001All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1862607Open in IMG/M
3300021968|Ga0193698_1015253All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium988Open in IMG/M
3300022870|Ga0247782_1060035All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium510Open in IMG/M
3300022886|Ga0247746_1180065All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium548Open in IMG/M
3300022894|Ga0247778_1096159All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium784Open in IMG/M
3300022894|Ga0247778_1192583All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium570Open in IMG/M
3300022899|Ga0247795_1002900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2840Open in IMG/M
3300022915|Ga0247790_10064811All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium860Open in IMG/M
3300023069|Ga0247751_1001064All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3166Open in IMG/M
3300025893|Ga0207682_10373367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium673Open in IMG/M
3300025918|Ga0207662_10138814All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1538Open in IMG/M
3300025926|Ga0207659_11556899All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium565Open in IMG/M
3300025930|Ga0207701_10002300All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes19872Open in IMG/M
3300025931|Ga0207644_11652790All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium537Open in IMG/M
3300025936|Ga0207670_10010522All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5335Open in IMG/M
3300025942|Ga0207689_10511324All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1007Open in IMG/M
3300026041|Ga0207639_11655128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium600Open in IMG/M
3300026075|Ga0207708_11015419All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium721Open in IMG/M
3300026089|Ga0207648_10366193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1301Open in IMG/M
3300026118|Ga0207675_100114039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2552Open in IMG/M
3300026121|Ga0207683_10106522All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2507Open in IMG/M
3300027907|Ga0207428_10389794All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1021Open in IMG/M
3300028380|Ga0268265_10385346All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1291Open in IMG/M
3300028802|Ga0307503_10065491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1442Open in IMG/M
3300031226|Ga0307497_10150014All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium967Open in IMG/M
3300031231|Ga0170824_109661613All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium705Open in IMG/M
3300031858|Ga0310892_10944977All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium605Open in IMG/M
3300031908|Ga0310900_11351242All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium597Open in IMG/M
3300033412|Ga0310810_11122438All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium651Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil22.02%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.59%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere4.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere4.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.67%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.75%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.75%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere2.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.83%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.92%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300021968Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1EnvironmentalOpen in IMG/M
3300022870Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L019-104C-5EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300022894Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023069Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10089736823300000559SoilMKRMILFIGHSFKKRKTFKRLFSEALSEGIRDTMLEMGYRFEDTKKDTDKSSQS*
JGI10216J12902_10548292523300000956SoilMKRMILFIVHSFKKRRKFKTLFSEAVAEGIRDTMLEMGYRLEATKQDADKSLRN*
Ga0055432_1004710013300004022Natural And Restored WetlandsMKKLILIIAHPFRKRKKTFTTLFSEAMAEGIRDTMKEMGYFFEPPKKKSA
Ga0062593_10052057723300004114SoilLKRIILFIAHRFKKRKTFKILFSEAVAEGIRDTMLEMGYRFKDTKKDTDKN*
Ga0062593_10053680933300004114SoilMKRIILFIAHSFKNRKTFKTLFSEALSEGIRDTMLEMGYRFEDTKKDTDKS*
Ga0062593_10076904823300004114SoilMLFIVHRFKKRKTFKTLFSEAVAEGIRDTMVEMGYRFEATKKSTDKDQ*
Ga0062590_10221213423300004157SoilMKRIMLFIVHRFKKRKTFKTLFSEAVAEGIRDTMVEMGYRFEATKKSTDKDQ*
Ga0063356_10000220493300004463Arabidopsis Thaliana RhizosphereMKRMILFIAHSFKKRKTLKKLLSEAVAEGIRDTMLEMGYHFEETKKDTDKTLRN*
Ga0063356_10125982133300004463Arabidopsis Thaliana RhizosphereMKRVTRLIAYFFKKRKTFKTLFSEAVSEGIQDVMLEMGYRFEDTKKDTDKSIRD*
Ga0062591_10195657723300004643SoilMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFEDTKKDTDKS*
Ga0065712_1000129033300005290Miscanthus RhizosphereMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDTDKS*
Ga0065712_1007025043300005290Miscanthus RhizosphereMKRIMLFIVHSFKKSKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKSSRS*
Ga0065712_1057535913300005290Miscanthus RhizosphereLKRIILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKSFQLIVDHI
Ga0065705_1087748923300005294Switchgrass RhizosphereMKRIILLIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKDPDKSIRN*
Ga0068869_10191621523300005334Miscanthus RhizosphereFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN*
Ga0070682_10011208513300005337Corn RhizosphereMILFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN*
Ga0070689_10115000923300005340Switchgrass RhizosphereLFIVHRFKKRKTFKSLFSEAVSEGIRDTMLEMGYRFEDAKKDADKS*
Ga0070687_10049508323300005343Switchgrass RhizosphereMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFEDTKKDTDKS
Ga0070675_10182577913300005354Miscanthus RhizosphereMKRMILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS*
Ga0070674_10067252923300005356Miscanthus RhizosphereMKRMILFIVHRFQKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKK*
Ga0070674_10099709323300005356Miscanthus RhizosphereMILFIVNRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS*
Ga0070673_10083528913300005364Switchgrass RhizosphereMLFIVHSFKKRKTFKTLFSEALSEGIRDTMLEMGYRFRDTKKDTDKS*
Ga0070678_10187426423300005456Miscanthus RhizosphereMKRIMLFIVHSFKKRKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKS*
Ga0068867_10224090923300005459Miscanthus RhizosphereMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDSKKDTDKRFPN*
Ga0070685_1000589233300005466Switchgrass RhizosphereMKRIMLFIVHSFKKRKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKSSRS*
Ga0070702_10078099623300005615Corn, Switchgrass And Miscanthus RhizosphereMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFEDAKKDADKS*
Ga0068851_1015405213300005834Corn RhizosphereMLFIVHSFKKSKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKSSRS*
Ga0068863_100014415113300005841Switchgrass RhizosphereMKRIMLFIVHSFKKRKTFKTLFSEALSEGIRDTMLEMGYRFEDTKKDTDKSSRS*
Ga0068863_10093427613300005841Switchgrass RhizosphereHSFKKRKTFKTLFSEALSEGIRDTMLEMGYRFEDTKKDTDKSSRS*
Ga0066651_1028320523300006031SoilMKRVILLIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKDTDRNIRN*
Ga0066652_10133561823300006046SoilMKRVILLIVHRFKKRKTFKKLFSDAVSEGIRDTMLEMGYRFEDTKKDTDKSIRN*
Ga0070715_1027766023300006163Corn, Switchgrass And Miscanthus RhizosphereMKRMILFIVHSFKKRKTFKTLFSEAVTEGIRDTMLEMGYHFEDTKKDTDKSSSR*
Ga0068871_10006551343300006358Miscanthus RhizosphereMKRIMLFIVHSFKKRKTFKTLFSEAMAEGIRDTMLEMGYRFRDTKKDTDKS*
Ga0068871_10108922323300006358Miscanthus RhizosphereLKRIILFIVHRFKKRKTFKSLFSEAVSEGIRDTMLEMGYRFENTKKDADKS*
Ga0075428_10114682423300006844Populus RhizosphereMKRMILFISRSLKKRKTFKTLFSEAMAEGIRDTMLEMGYRFEATKKDTDKSFRN*
Ga0075424_10163005723300006904Populus RhizosphereMKRMLLFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS*
Ga0075418_1008810723300009100Populus RhizosphereMILFISRSLKKRKTFKTLFSEAMAEGIRDTMLEMGYRFEATKEDTDKSFRN*
Ga0075418_1117546513300009100Populus RhizosphereMKRIILFIVHSFKKRKTFKTLFSEAMSEGIRDTMLEMGYRFKDTKKDTDKS*
Ga0111538_1058627223300009156Populus RhizosphereMKRIILLIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKDPDESIRN*
Ga0111538_1154078723300009156Populus RhizosphereMKRIILLIVHRFKKRKPFKTLFSEAVSEGIRDTMVEMGYRFEDTKKGTDKSSRN*
Ga0105249_1130846813300009553Switchgrass RhizosphereKRIMLFIAHSFRKRKKLKTLFSEAVAEGIKDTMLEMGYRFEAPKKDTDKSSRS*
Ga0105340_127995823300009610SoilMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDTDKRFPN*
Ga0126305_10000033433300010036Serpentine SoilMKKIMLFIVHRFKKRKTFKTLFSEAVAEAIRDTMVEMGYRFEATKKDTDKDQ*
Ga0134121_1306748513300010401Terrestrial SoilVKRIILFIAHSFKKRKTFKTLFSEAMAEGIRDTMLEMGYRFKDTKKDTDKS*
Ga0134123_1078729913300010403Terrestrial SoilIILFIAHRFKKRKTFKILFSEAVAEGIRDTMLEMGYRFKDTKKDTDKN*
Ga0134123_1363008923300010403Terrestrial SoilMKKMILFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN*
Ga0137436_114267513300011423SoilFKKRKTFKTLFSEAMAEGIRDTMLEMGYRFEATKKDTDKSFRN*
Ga0137435_128013823300012232SoilMKRVILFIVHRFKKRKTFKTLFSEAVSEGIRDAMLEMGYRFEDSKKDTDKN*
Ga0157304_105476123300012882SoilMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFEDTKKDPDKSIRN*
Ga0157304_109676723300012882SoilMILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS*
Ga0157294_1004171323300012892SoilMILFIINRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS*
Ga0157294_1009237223300012892SoilKRIILFIAHRFKKRKTFKILFSEAVAEGIRDTMLEMGYRFKDTKKDTDKN*
Ga0157284_1000606523300012893SoilMKRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKDPDKSIRN*
Ga0157293_1032685323300012898SoilMKRIMLFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFEDTKKDTDKNFRK*
Ga0157299_1016744713300012899SoilKRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKNPDKSIRN*
Ga0157288_1017304823300012901SoilMKRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKNPDKSIRN*
Ga0157283_1037316323300012907SoilMILFIVNRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDADKS*
Ga0157290_1000455443300012909SoilMKRMILFIAHSFKKRKTLKKLLSEAVAEGIRDTMLEMGYHFEETKK
Ga0157306_1047033523300012912SoilMILFIAHSFKKRKTLKKLLSEAVAEGIRDTMLEMGYHFEETKKDTDKTLRN*
Ga0164309_1124986923300012984SoilMLFIVHSFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKSSRS*
Ga0157374_1037214023300013296Miscanthus RhizosphereMKRIILFIAHRFKKRKTFKILFSEAVAEGIRDTMLEMGYRFKDTKKDTDKSSGVDRF*
Ga0163163_1166010213300014325Switchgrass RhizosphereILFIVYRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS*
Ga0157380_1169501923300014326Switchgrass RhizosphereMLFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFKDTKKDTDKN*
Ga0157377_1045189623300014745Miscanthus RhizosphereMKRIILFIAHRFKKRKTFKILFSEAVAEGIRDTMLEMGYRFEDTKKDTDKS*
Ga0157376_1061606933300014969Miscanthus RhizosphereILFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN*
Ga0157376_1231285223300014969Miscanthus RhizosphereMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKD
Ga0173478_1061249423300015201SoilMKRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKK
Ga0132258_1083845213300015371Arabidopsis RhizosphereRIILFIVHRFKKRNTFKTLFSEAVAEGIRDTMLEMGYHFEDTKKDTNKN*
Ga0132258_1357987023300015371Arabidopsis RhizosphereMKRIILLIVHRFKKRKTFKKLFSDAVSEGIRDTMLEMGYHFEDTKKDTDKNIRN*
Ga0132257_10147660423300015373Arabidopsis RhizosphereLFSKPNKKITVKKMILFIARSFKKRKTFKTLFSEAMAEGIRDTMLEMGYHFEDTKKDTDKS*
Ga0163161_1006516823300017792Switchgrass RhizosphereMKRIMLFIVHSFKKSKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKSSGVDRF
Ga0163161_1135824123300017792Switchgrass RhizosphereMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDTDKS
Ga0184635_1002359243300018072Groundwater SedimentMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDTDKRFPN
Ga0184628_1012399833300018083Groundwater SedimentMILFIVNRFKKRKTFKTLFSDAVSEGIRDTMLEMGYRFEDTKKDTDKS
Ga0190274_1008040323300018476SoilMILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFENTKKDTDKS
Ga0173481_1014948813300019356SoilMKRIILFIAHSFKNRKTFKTLFSEALSEGIRDTMLEMGYRFEDTKKDTDKS
Ga0173482_1006477523300019361SoilLKRIILFIAHRFKKRKTFKILFSEAVAEGIRDTMLEMGYRFKDTKKDTDKN
Ga0173482_1020950123300019361SoilMKRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKDPDKSIRN
Ga0173479_1012859833300019362SoilMKRMILFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDP
Ga0173479_1064440923300019362SoilMILFIVHRFKKRKTFKTLFSEAVAEGIRDTMVEMGYRFEATKKSTDKDQ
Ga0193694_10000015533300021415SoilMILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYHFEDKKKDTDKVSINFP
Ga0193698_101525323300021968SoilMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDSDKS
Ga0247782_106003513300022870Plant LitterMILFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN
Ga0247746_118006523300022886SoilMKRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKNPDKSIRN
Ga0247778_109615923300022894Plant LitterMILFIVNRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS
Ga0247778_119258323300022894Plant LitterMKRMILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS
Ga0247795_100290033300022899SoilMKRIMLFIVHSFKKRKTFKTLFSEALSEGIRDTMLEMGYRFEDTKKDTDKSSRS
Ga0247790_1006481123300022915SoilMILFIVNRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKNPDKSIRN
Ga0247751_100106423300023069SoilMKRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS
Ga0207682_1037336723300025893Miscanthus RhizosphereMKRMILFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN
Ga0207662_1013881413300025918Switchgrass RhizosphereMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDTDKN
Ga0207659_1155689923300025926Miscanthus RhizosphereMILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS
Ga0207701_1000230093300025930Corn, Switchgrass And Miscanthus RhizosphereMKRIMLFIVHSFKKSKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKSSRS
Ga0207644_1165279023300025931Switchgrass RhizosphereMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDTD
Ga0207670_1001052273300025936Switchgrass RhizosphereMKRIMLFIVHSFKKRKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKSSRS
Ga0207689_1051132433300025942Miscanthus RhizosphereFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN
Ga0207639_1165512813300026041Corn RhizosphereMKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFEDAKKDADKS
Ga0207708_1101541913300026075Corn, Switchgrass And Miscanthus RhizosphereMKRIILFIAHSFKNRKTFKTLFSEALSEGIRDTMLEMGYRFEDT
Ga0207648_1036619313300026089Miscanthus RhizosphereMILFIVHRFQKRKTFKTLFSEAVSEGIRDTMLEMGYHFEDSKKD
Ga0207675_10011403933300026118Switchgrass RhizosphereMKRIMLFIVHSFKKRKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKS
Ga0207683_1010652233300026121Miscanthus RhizosphereMKRIMLFIVHSFKKRKTFKTLFSEAVSEAIRDTMLEMGYHFKDTKKDTDKS
Ga0207428_1038979413300027907Populus RhizosphereMKRMLLFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS
Ga0268265_1038534623300028380Switchgrass RhizosphereMLFIVHSFKKRKTFKTLFSEALSEGIRDTMLEMGYRFEDTKKDTDKSSRS
Ga0307503_1006549123300028802SoilMLFIVHSFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKSSRS
Ga0307497_1015001413300031226SoilMKRIILFIADRFKKRKTFKTLFSEAVTEGIRDTMLEMGYRFEDTKKDADKSFRQ
Ga0170824_10966161313300031231Forest SoilMKRIILFIVRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFEDTKKDTDKS
Ga0310892_1094497723300031858SoilMSRLIAYFFKKRKTFKTLFSEAVSEGIRDAMLEMGYRFEDTKKGTDKSIRD
Ga0310900_1135124223300031908SoilMKRMSRLIAYFFKKRKTFKTLFSEAVSEGIRDAMLEMGYRFEDTKKGTD
Ga0310810_1112243823300033412SoilMKRIIFLITHSFKKRKTFETLFSEAVAEGIRNTMLEMGYRFEDTKKDTDKDFRN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.