| Basic Information | |
|---|---|
| Family ID | F089463 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MKRMILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.17 % |
| % of genes near scaffold ends (potentially truncated) | 22.02 % |
| % of genes from short scaffolds (< 2000 bps) | 81.65 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.018 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.294 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.30% β-sheet: 0.00% Coil/Unstructured: 55.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF14026 | DUF4242 | 11.01 |
| PF04397 | LytTR | 8.26 |
| PF13191 | AAA_16 | 2.75 |
| PF00171 | Aldedh | 0.92 |
| PF08541 | ACP_syn_III_C | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.92 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.92 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100897368 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 662 | Open in IMG/M |
| 3300000956|JGI10216J12902_105482925 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 959 | Open in IMG/M |
| 3300004022|Ga0055432_10047100 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1017 | Open in IMG/M |
| 3300004114|Ga0062593_100520577 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1109 | Open in IMG/M |
| 3300004114|Ga0062593_100536809 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1096 | Open in IMG/M |
| 3300004114|Ga0062593_100769048 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 952 | Open in IMG/M |
| 3300004157|Ga0062590_102212134 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 576 | Open in IMG/M |
| 3300004463|Ga0063356_100002204 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 15734 | Open in IMG/M |
| 3300004463|Ga0063356_101259821 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300004643|Ga0062591_101956577 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 603 | Open in IMG/M |
| 3300005290|Ga0065712_10001290 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis | 6263 | Open in IMG/M |
| 3300005290|Ga0065712_10070250 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 6174 | Open in IMG/M |
| 3300005290|Ga0065712_10575359 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 587 | Open in IMG/M |
| 3300005294|Ga0065705_10877489 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 566 | Open in IMG/M |
| 3300005334|Ga0068869_101916215 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 531 | Open in IMG/M |
| 3300005337|Ga0070682_100112085 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1819 | Open in IMG/M |
| 3300005340|Ga0070689_101150009 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 695 | Open in IMG/M |
| 3300005343|Ga0070687_100495083 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 822 | Open in IMG/M |
| 3300005354|Ga0070675_101825779 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 561 | Open in IMG/M |
| 3300005356|Ga0070674_100672529 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 882 | Open in IMG/M |
| 3300005356|Ga0070674_100997093 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 735 | Open in IMG/M |
| 3300005364|Ga0070673_100835289 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 852 | Open in IMG/M |
| 3300005456|Ga0070678_101874264 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 566 | Open in IMG/M |
| 3300005459|Ga0068867_102240909 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 519 | Open in IMG/M |
| 3300005466|Ga0070685_10005892 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 6236 | Open in IMG/M |
| 3300005615|Ga0070702_100780996 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 737 | Open in IMG/M |
| 3300005834|Ga0068851_10154052 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1258 | Open in IMG/M |
| 3300005841|Ga0068863_100014415 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 7614 | Open in IMG/M |
| 3300005841|Ga0068863_100934276 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 868 | Open in IMG/M |
| 3300006031|Ga0066651_10283205 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 882 | Open in IMG/M |
| 3300006046|Ga0066652_101335618 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 674 | Open in IMG/M |
| 3300006163|Ga0070715_10277660 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 887 | Open in IMG/M |
| 3300006358|Ga0068871_100065513 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2976 | Open in IMG/M |
| 3300006358|Ga0068871_101089223 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 747 | Open in IMG/M |
| 3300006844|Ga0075428_101146824 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 820 | Open in IMG/M |
| 3300006904|Ga0075424_101630057 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 684 | Open in IMG/M |
| 3300009100|Ga0075418_10088107 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3299 | Open in IMG/M |
| 3300009100|Ga0075418_11175465 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 831 | Open in IMG/M |
| 3300009156|Ga0111538_10586272 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1414 | Open in IMG/M |
| 3300009156|Ga0111538_11540787 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 838 | Open in IMG/M |
| 3300009553|Ga0105249_11308468 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 796 | Open in IMG/M |
| 3300009610|Ga0105340_1279958 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 722 | Open in IMG/M |
| 3300010036|Ga0126305_10000033 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 55238 | Open in IMG/M |
| 3300010401|Ga0134121_13067485 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 514 | Open in IMG/M |
| 3300010403|Ga0134123_10787299 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 942 | Open in IMG/M |
| 3300010403|Ga0134123_13630089 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 501 | Open in IMG/M |
| 3300011423|Ga0137436_1142675 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 640 | Open in IMG/M |
| 3300012232|Ga0137435_1280138 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 504 | Open in IMG/M |
| 3300012882|Ga0157304_1054761 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 624 | Open in IMG/M |
| 3300012882|Ga0157304_1096767 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 532 | Open in IMG/M |
| 3300012892|Ga0157294_10041713 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1007 | Open in IMG/M |
| 3300012892|Ga0157294_10092372 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 764 | Open in IMG/M |
| 3300012893|Ga0157284_10006065 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1991 | Open in IMG/M |
| 3300012898|Ga0157293_10326853 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 517 | Open in IMG/M |
| 3300012899|Ga0157299_10167447 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 636 | Open in IMG/M |
| 3300012901|Ga0157288_10173048 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 665 | Open in IMG/M |
| 3300012907|Ga0157283_10373163 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 521 | Open in IMG/M |
| 3300012909|Ga0157290_10004554 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2348 | Open in IMG/M |
| 3300012912|Ga0157306_10470335 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 509 | Open in IMG/M |
| 3300012984|Ga0164309_11249869 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 626 | Open in IMG/M |
| 3300013296|Ga0157374_10372140 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1422 | Open in IMG/M |
| 3300014325|Ga0163163_11660102 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 700 | Open in IMG/M |
| 3300014326|Ga0157380_11695019 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 689 | Open in IMG/M |
| 3300014745|Ga0157377_10451896 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 887 | Open in IMG/M |
| 3300014969|Ga0157376_10616069 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1082 | Open in IMG/M |
| 3300014969|Ga0157376_12312852 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 577 | Open in IMG/M |
| 3300015201|Ga0173478_10612494 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 567 | Open in IMG/M |
| 3300015371|Ga0132258_10838452 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2319 | Open in IMG/M |
| 3300015371|Ga0132258_13579870 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1062 | Open in IMG/M |
| 3300015373|Ga0132257_101476604 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 867 | Open in IMG/M |
| 3300017792|Ga0163161_10065168 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2658 | Open in IMG/M |
| 3300017792|Ga0163161_11358241 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 619 | Open in IMG/M |
| 3300018072|Ga0184635_10023592 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2274 | Open in IMG/M |
| 3300018083|Ga0184628_10123998 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1337 | Open in IMG/M |
| 3300018476|Ga0190274_10080403 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2505 | Open in IMG/M |
| 3300019356|Ga0173481_10149488 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 962 | Open in IMG/M |
| 3300019361|Ga0173482_10064775 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1231 | Open in IMG/M |
| 3300019361|Ga0173482_10209501 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 804 | Open in IMG/M |
| 3300019362|Ga0173479_10128598 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 982 | Open in IMG/M |
| 3300019362|Ga0173479_10644409 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 562 | Open in IMG/M |
| 3300021415|Ga0193694_1000001 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1862607 | Open in IMG/M |
| 3300021968|Ga0193698_1015253 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 988 | Open in IMG/M |
| 3300022870|Ga0247782_1060035 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 510 | Open in IMG/M |
| 3300022886|Ga0247746_1180065 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 548 | Open in IMG/M |
| 3300022894|Ga0247778_1096159 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 784 | Open in IMG/M |
| 3300022894|Ga0247778_1192583 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 570 | Open in IMG/M |
| 3300022899|Ga0247795_1002900 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2840 | Open in IMG/M |
| 3300022915|Ga0247790_10064811 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 860 | Open in IMG/M |
| 3300023069|Ga0247751_1001064 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 3166 | Open in IMG/M |
| 3300025893|Ga0207682_10373367 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 673 | Open in IMG/M |
| 3300025918|Ga0207662_10138814 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1538 | Open in IMG/M |
| 3300025926|Ga0207659_11556899 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 565 | Open in IMG/M |
| 3300025930|Ga0207701_10002300 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 19872 | Open in IMG/M |
| 3300025931|Ga0207644_11652790 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 537 | Open in IMG/M |
| 3300025936|Ga0207670_10010522 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5335 | Open in IMG/M |
| 3300025942|Ga0207689_10511324 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1007 | Open in IMG/M |
| 3300026041|Ga0207639_11655128 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 600 | Open in IMG/M |
| 3300026075|Ga0207708_11015419 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 721 | Open in IMG/M |
| 3300026089|Ga0207648_10366193 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1301 | Open in IMG/M |
| 3300026118|Ga0207675_100114039 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2552 | Open in IMG/M |
| 3300026121|Ga0207683_10106522 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2507 | Open in IMG/M |
| 3300027907|Ga0207428_10389794 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1021 | Open in IMG/M |
| 3300028380|Ga0268265_10385346 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1291 | Open in IMG/M |
| 3300028802|Ga0307503_10065491 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1442 | Open in IMG/M |
| 3300031226|Ga0307497_10150014 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 967 | Open in IMG/M |
| 3300031231|Ga0170824_109661613 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 705 | Open in IMG/M |
| 3300031858|Ga0310892_10944977 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 605 | Open in IMG/M |
| 3300031908|Ga0310900_11351242 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 597 | Open in IMG/M |
| 3300033412|Ga0310810_11122438 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 651 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.02% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.59% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.67% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.83% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300022870 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L019-104C-5 | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300022894 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5 | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1008973682 | 3300000559 | Soil | MKRMILFIGHSFKKRKTFKRLFSEALSEGIRDTMLEMGYRFEDTKKDTDKSSQS* |
| JGI10216J12902_1054829252 | 3300000956 | Soil | MKRMILFIVHSFKKRRKFKTLFSEAVAEGIRDTMLEMGYRLEATKQDADKSLRN* |
| Ga0055432_100471001 | 3300004022 | Natural And Restored Wetlands | MKKLILIIAHPFRKRKKTFTTLFSEAMAEGIRDTMKEMGYFFEPPKKKSA |
| Ga0062593_1005205772 | 3300004114 | Soil | LKRIILFIAHRFKKRKTFKILFSEAVAEGIRDTMLEMGYRFKDTKKDTDKN* |
| Ga0062593_1005368093 | 3300004114 | Soil | MKRIILFIAHSFKNRKTFKTLFSEALSEGIRDTMLEMGYRFEDTKKDTDKS* |
| Ga0062593_1007690482 | 3300004114 | Soil | MLFIVHRFKKRKTFKTLFSEAVAEGIRDTMVEMGYRFEATKKSTDKDQ* |
| Ga0062590_1022121342 | 3300004157 | Soil | MKRIMLFIVHRFKKRKTFKTLFSEAVAEGIRDTMVEMGYRFEATKKSTDKDQ* |
| Ga0063356_1000022049 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKRMILFIAHSFKKRKTLKKLLSEAVAEGIRDTMLEMGYHFEETKKDTDKTLRN* |
| Ga0063356_1012598213 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKRVTRLIAYFFKKRKTFKTLFSEAVSEGIQDVMLEMGYRFEDTKKDTDKSIRD* |
| Ga0062591_1019565772 | 3300004643 | Soil | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFEDTKKDTDKS* |
| Ga0065712_100012903 | 3300005290 | Miscanthus Rhizosphere | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDTDKS* |
| Ga0065712_100702504 | 3300005290 | Miscanthus Rhizosphere | MKRIMLFIVHSFKKSKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKSSRS* |
| Ga0065712_105753591 | 3300005290 | Miscanthus Rhizosphere | LKRIILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKSFQLIVDHI |
| Ga0065705_108774892 | 3300005294 | Switchgrass Rhizosphere | MKRIILLIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKDPDKSIRN* |
| Ga0068869_1019162152 | 3300005334 | Miscanthus Rhizosphere | FIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN* |
| Ga0070682_1001120851 | 3300005337 | Corn Rhizosphere | MILFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN* |
| Ga0070689_1011500092 | 3300005340 | Switchgrass Rhizosphere | LFIVHRFKKRKTFKSLFSEAVSEGIRDTMLEMGYRFEDAKKDADKS* |
| Ga0070687_1004950832 | 3300005343 | Switchgrass Rhizosphere | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFEDTKKDTDKS |
| Ga0070675_1018257791 | 3300005354 | Miscanthus Rhizosphere | MKRMILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS* |
| Ga0070674_1006725292 | 3300005356 | Miscanthus Rhizosphere | MKRMILFIVHRFQKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKK* |
| Ga0070674_1009970932 | 3300005356 | Miscanthus Rhizosphere | MILFIVNRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS* |
| Ga0070673_1008352891 | 3300005364 | Switchgrass Rhizosphere | MLFIVHSFKKRKTFKTLFSEALSEGIRDTMLEMGYRFRDTKKDTDKS* |
| Ga0070678_1018742642 | 3300005456 | Miscanthus Rhizosphere | MKRIMLFIVHSFKKRKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKS* |
| Ga0068867_1022409092 | 3300005459 | Miscanthus Rhizosphere | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDSKKDTDKRFPN* |
| Ga0070685_100058923 | 3300005466 | Switchgrass Rhizosphere | MKRIMLFIVHSFKKRKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKSSRS* |
| Ga0070702_1007809962 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFEDAKKDADKS* |
| Ga0068851_101540521 | 3300005834 | Corn Rhizosphere | MLFIVHSFKKSKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKSSRS* |
| Ga0068863_10001441511 | 3300005841 | Switchgrass Rhizosphere | MKRIMLFIVHSFKKRKTFKTLFSEALSEGIRDTMLEMGYRFEDTKKDTDKSSRS* |
| Ga0068863_1009342761 | 3300005841 | Switchgrass Rhizosphere | HSFKKRKTFKTLFSEALSEGIRDTMLEMGYRFEDTKKDTDKSSRS* |
| Ga0066651_102832052 | 3300006031 | Soil | MKRVILLIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKDTDRNIRN* |
| Ga0066652_1013356182 | 3300006046 | Soil | MKRVILLIVHRFKKRKTFKKLFSDAVSEGIRDTMLEMGYRFEDTKKDTDKSIRN* |
| Ga0070715_102776602 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRMILFIVHSFKKRKTFKTLFSEAVTEGIRDTMLEMGYHFEDTKKDTDKSSSR* |
| Ga0068871_1000655134 | 3300006358 | Miscanthus Rhizosphere | MKRIMLFIVHSFKKRKTFKTLFSEAMAEGIRDTMLEMGYRFRDTKKDTDKS* |
| Ga0068871_1010892232 | 3300006358 | Miscanthus Rhizosphere | LKRIILFIVHRFKKRKTFKSLFSEAVSEGIRDTMLEMGYRFENTKKDADKS* |
| Ga0075428_1011468242 | 3300006844 | Populus Rhizosphere | MKRMILFISRSLKKRKTFKTLFSEAMAEGIRDTMLEMGYRFEATKKDTDKSFRN* |
| Ga0075424_1016300572 | 3300006904 | Populus Rhizosphere | MKRMLLFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS* |
| Ga0075418_100881072 | 3300009100 | Populus Rhizosphere | MILFISRSLKKRKTFKTLFSEAMAEGIRDTMLEMGYRFEATKEDTDKSFRN* |
| Ga0075418_111754651 | 3300009100 | Populus Rhizosphere | MKRIILFIVHSFKKRKTFKTLFSEAMSEGIRDTMLEMGYRFKDTKKDTDKS* |
| Ga0111538_105862722 | 3300009156 | Populus Rhizosphere | MKRIILLIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKDPDESIRN* |
| Ga0111538_115407872 | 3300009156 | Populus Rhizosphere | MKRIILLIVHRFKKRKPFKTLFSEAVSEGIRDTMVEMGYRFEDTKKGTDKSSRN* |
| Ga0105249_113084681 | 3300009553 | Switchgrass Rhizosphere | KRIMLFIAHSFRKRKKLKTLFSEAVAEGIKDTMLEMGYRFEAPKKDTDKSSRS* |
| Ga0105340_12799582 | 3300009610 | Soil | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDTDKRFPN* |
| Ga0126305_1000003343 | 3300010036 | Serpentine Soil | MKKIMLFIVHRFKKRKTFKTLFSEAVAEAIRDTMVEMGYRFEATKKDTDKDQ* |
| Ga0134121_130674851 | 3300010401 | Terrestrial Soil | VKRIILFIAHSFKKRKTFKTLFSEAMAEGIRDTMLEMGYRFKDTKKDTDKS* |
| Ga0134123_107872991 | 3300010403 | Terrestrial Soil | IILFIAHRFKKRKTFKILFSEAVAEGIRDTMLEMGYRFKDTKKDTDKN* |
| Ga0134123_136300892 | 3300010403 | Terrestrial Soil | MKKMILFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN* |
| Ga0137436_11426751 | 3300011423 | Soil | FKKRKTFKTLFSEAMAEGIRDTMLEMGYRFEATKKDTDKSFRN* |
| Ga0137435_12801382 | 3300012232 | Soil | MKRVILFIVHRFKKRKTFKTLFSEAVSEGIRDAMLEMGYRFEDSKKDTDKN* |
| Ga0157304_10547612 | 3300012882 | Soil | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFEDTKKDPDKSIRN* |
| Ga0157304_10967672 | 3300012882 | Soil | MILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS* |
| Ga0157294_100417132 | 3300012892 | Soil | MILFIINRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS* |
| Ga0157294_100923722 | 3300012892 | Soil | KRIILFIAHRFKKRKTFKILFSEAVAEGIRDTMLEMGYRFKDTKKDTDKN* |
| Ga0157284_100060652 | 3300012893 | Soil | MKRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKDPDKSIRN* |
| Ga0157293_103268532 | 3300012898 | Soil | MKRIMLFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFEDTKKDTDKNFRK* |
| Ga0157299_101674471 | 3300012899 | Soil | KRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKNPDKSIRN* |
| Ga0157288_101730482 | 3300012901 | Soil | MKRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKNPDKSIRN* |
| Ga0157283_103731632 | 3300012907 | Soil | MILFIVNRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDADKS* |
| Ga0157290_100045544 | 3300012909 | Soil | MKRMILFIAHSFKKRKTLKKLLSEAVAEGIRDTMLEMGYHFEETKK |
| Ga0157306_104703352 | 3300012912 | Soil | MILFIAHSFKKRKTLKKLLSEAVAEGIRDTMLEMGYHFEETKKDTDKTLRN* |
| Ga0164309_112498692 | 3300012984 | Soil | MLFIVHSFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKSSRS* |
| Ga0157374_103721402 | 3300013296 | Miscanthus Rhizosphere | MKRIILFIAHRFKKRKTFKILFSEAVAEGIRDTMLEMGYRFKDTKKDTDKSSGVDRF* |
| Ga0163163_116601021 | 3300014325 | Switchgrass Rhizosphere | ILFIVYRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS* |
| Ga0157380_116950192 | 3300014326 | Switchgrass Rhizosphere | MLFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFKDTKKDTDKN* |
| Ga0157377_104518962 | 3300014745 | Miscanthus Rhizosphere | MKRIILFIAHRFKKRKTFKILFSEAVAEGIRDTMLEMGYRFEDTKKDTDKS* |
| Ga0157376_106160693 | 3300014969 | Miscanthus Rhizosphere | ILFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN* |
| Ga0157376_123128522 | 3300014969 | Miscanthus Rhizosphere | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKD |
| Ga0173478_106124942 | 3300015201 | Soil | MKRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKK |
| Ga0132258_108384521 | 3300015371 | Arabidopsis Rhizosphere | RIILFIVHRFKKRNTFKTLFSEAVAEGIRDTMLEMGYHFEDTKKDTNKN* |
| Ga0132258_135798702 | 3300015371 | Arabidopsis Rhizosphere | MKRIILLIVHRFKKRKTFKKLFSDAVSEGIRDTMLEMGYHFEDTKKDTDKNIRN* |
| Ga0132257_1014766042 | 3300015373 | Arabidopsis Rhizosphere | LFSKPNKKITVKKMILFIARSFKKRKTFKTLFSEAMAEGIRDTMLEMGYHFEDTKKDTDKS* |
| Ga0163161_100651682 | 3300017792 | Switchgrass Rhizosphere | MKRIMLFIVHSFKKSKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKSSGVDRF |
| Ga0163161_113582412 | 3300017792 | Switchgrass Rhizosphere | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDTDKS |
| Ga0184635_100235924 | 3300018072 | Groundwater Sediment | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDTDKRFPN |
| Ga0184628_101239983 | 3300018083 | Groundwater Sediment | MILFIVNRFKKRKTFKTLFSDAVSEGIRDTMLEMGYRFEDTKKDTDKS |
| Ga0190274_100804032 | 3300018476 | Soil | MILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFENTKKDTDKS |
| Ga0173481_101494881 | 3300019356 | Soil | MKRIILFIAHSFKNRKTFKTLFSEALSEGIRDTMLEMGYRFEDTKKDTDKS |
| Ga0173482_100647752 | 3300019361 | Soil | LKRIILFIAHRFKKRKTFKILFSEAVAEGIRDTMLEMGYRFKDTKKDTDKN |
| Ga0173482_102095012 | 3300019361 | Soil | MKRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKDPDKSIRN |
| Ga0173479_101285983 | 3300019362 | Soil | MKRMILFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDP |
| Ga0173479_106444092 | 3300019362 | Soil | MILFIVHRFKKRKTFKTLFSEAVAEGIRDTMVEMGYRFEATKKSTDKDQ |
| Ga0193694_1000001553 | 3300021415 | Soil | MILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYHFEDKKKDTDKVSINFP |
| Ga0193698_10152532 | 3300021968 | Soil | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDSDKS |
| Ga0247782_10600351 | 3300022870 | Plant Litter | MILFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN |
| Ga0247746_11800652 | 3300022886 | Soil | MKRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKNPDKSIRN |
| Ga0247778_10961592 | 3300022894 | Plant Litter | MILFIVNRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS |
| Ga0247778_11925832 | 3300022894 | Plant Litter | MKRMILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS |
| Ga0247795_10029003 | 3300022899 | Soil | MKRIMLFIVHSFKKRKTFKTLFSEALSEGIRDTMLEMGYRFEDTKKDTDKSSRS |
| Ga0247790_100648112 | 3300022915 | Soil | MILFIVNRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKNPDKSIRN |
| Ga0247751_10010642 | 3300023069 | Soil | MKRIILFIVHRFKKRKTFKKLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS |
| Ga0207682_103733672 | 3300025893 | Miscanthus Rhizosphere | MKRMILFIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN |
| Ga0207662_101388141 | 3300025918 | Switchgrass Rhizosphere | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDTDKN |
| Ga0207659_115568992 | 3300025926 | Miscanthus Rhizosphere | MILFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS |
| Ga0207701_100023009 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRIMLFIVHSFKKSKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKSSRS |
| Ga0207644_116527902 | 3300025931 | Switchgrass Rhizosphere | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYHFKDTKKDTD |
| Ga0207670_100105227 | 3300025936 | Switchgrass Rhizosphere | MKRIMLFIVHSFKKRKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKSSRS |
| Ga0207689_105113243 | 3300025942 | Miscanthus Rhizosphere | FIVHRFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFDDPKKDCDKNFGN |
| Ga0207639_116551281 | 3300026041 | Corn Rhizosphere | MKRIILFIIRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFEDAKKDADKS |
| Ga0207708_110154191 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRIILFIAHSFKNRKTFKTLFSEALSEGIRDTMLEMGYRFEDT |
| Ga0207648_103661931 | 3300026089 | Miscanthus Rhizosphere | MILFIVHRFQKRKTFKTLFSEAVSEGIRDTMLEMGYHFEDSKKD |
| Ga0207675_1001140393 | 3300026118 | Switchgrass Rhizosphere | MKRIMLFIVHSFKKRKTFKTLFSEAMSEGIRDTMLEMGYRFEDTKKDTDKS |
| Ga0207683_101065223 | 3300026121 | Miscanthus Rhizosphere | MKRIMLFIVHSFKKRKTFKTLFSEAVSEAIRDTMLEMGYHFKDTKKDTDKS |
| Ga0207428_103897941 | 3300027907 | Populus Rhizosphere | MKRMLLFIVHRFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKS |
| Ga0268265_103853462 | 3300028380 | Switchgrass Rhizosphere | MLFIVHSFKKRKTFKTLFSEALSEGIRDTMLEMGYRFEDTKKDTDKSSRS |
| Ga0307503_100654912 | 3300028802 | Soil | MLFIVHSFKKRKTFKTLFSEAVSEGIRDTMLEMGYRFEDTKKDTDKSSRS |
| Ga0307497_101500141 | 3300031226 | Soil | MKRIILFIADRFKKRKTFKTLFSEAVTEGIRDTMLEMGYRFEDTKKDADKSFRQ |
| Ga0170824_1096616131 | 3300031231 | Forest Soil | MKRIILFIVRPFKKRKTFKTLFSEAVAEGIRDTMLEMGYRFEDTKKDTDKS |
| Ga0310892_109449772 | 3300031858 | Soil | MSRLIAYFFKKRKTFKTLFSEAVSEGIRDAMLEMGYRFEDTKKGTDKSIRD |
| Ga0310900_113512422 | 3300031908 | Soil | MKRMSRLIAYFFKKRKTFKTLFSEAVSEGIRDAMLEMGYRFEDTKKGTD |
| Ga0310810_111224382 | 3300033412 | Soil | MKRIIFLITHSFKKRKTFETLFSEAVAEGIRNTMLEMGYRFEDTKKDTDKDFRN |
| ⦗Top⦘ |