Basic Information | |
---|---|
Family ID | F089458 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 109 |
Average Sequence Length | 44 residues |
Representative Sequence | PREYARMQSLGRPGSILAKTLIIHHEPTSRITVILVPETLGF |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 9.17 % |
% of genes near scaffold ends (potentially truncated) | 88.99 % |
% of genes from short scaffolds (< 2000 bps) | 80.73 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.569 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (14.679 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.945 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.706 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.43% β-sheet: 31.43% Coil/Unstructured: 57.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF04964 | Flp_Fap | 12.84 |
PF00440 | TetR_N | 5.50 |
PF00483 | NTP_transferase | 4.59 |
PF00583 | Acetyltransf_1 | 3.67 |
PF00903 | Glyoxalase | 2.75 |
PF11141 | DUF2914 | 2.75 |
PF00392 | GntR | 2.75 |
PF04672 | Methyltransf_19 | 2.75 |
PF12681 | Glyoxalase_2 | 2.75 |
PF02589 | LUD_dom | 1.83 |
PF00210 | Ferritin | 1.83 |
PF03176 | MMPL | 1.83 |
PF08818 | DUF1801 | 1.83 |
PF00381 | PTS-HPr | 0.92 |
PF02769 | AIRS_C | 0.92 |
PF00920 | ILVD_EDD | 0.92 |
PF01988 | VIT1 | 0.92 |
PF08240 | ADH_N | 0.92 |
PF08044 | DUF1707 | 0.92 |
PF13649 | Methyltransf_25 | 0.92 |
PF07676 | PD40 | 0.92 |
PF13271 | DUF4062 | 0.92 |
PF13560 | HTH_31 | 0.92 |
PF13673 | Acetyltransf_10 | 0.92 |
PF02803 | Thiolase_C | 0.92 |
PF00248 | Aldo_ket_red | 0.92 |
PF12706 | Lactamase_B_2 | 0.92 |
PF00872 | Transposase_mut | 0.92 |
PF02073 | Peptidase_M29 | 0.92 |
PF04069 | OpuAC | 0.92 |
PF00205 | TPP_enzyme_M | 0.92 |
PF13556 | HTH_30 | 0.92 |
PF01569 | PAP2 | 0.92 |
PF12802 | MarR_2 | 0.92 |
PF00293 | NUDIX | 0.92 |
PF00731 | AIRC | 0.92 |
PF13561 | adh_short_C2 | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 12.84 |
COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.83 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 1.83 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 1.83 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.83 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.83 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.83 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.92 |
COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.92 |
COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.92 |
COG1925 | HPr or related phosphotransfer protein | Signal transduction mechanisms [T] | 0.92 |
COG2309 | Leucyl aminopeptidase (aminopeptidase T) | Amino acid transport and metabolism [E] | 0.92 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.49 % |
Unclassified | root | N/A | 16.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908038|B3_all_c_ConsensusfromContig53073 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 806 | Open in IMG/M |
2199352024|deeps__Contig_156771 | All Organisms → cellular organisms → Bacteria | 2323 | Open in IMG/M |
3300000789|JGI1027J11758_11755484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
3300001664|P5cmW16_1013262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1581 | Open in IMG/M |
3300002347|JGIcombinedJ26865_1068597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 567 | Open in IMG/M |
3300004013|Ga0055465_10253021 | Not Available | 594 | Open in IMG/M |
3300004633|Ga0066395_10699560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 601 | Open in IMG/M |
3300005332|Ga0066388_102787436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 893 | Open in IMG/M |
3300005334|Ga0068869_100836137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
3300005343|Ga0070687_100242751 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300005354|Ga0070675_100408634 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300005364|Ga0070673_100828177 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300005436|Ga0070713_100128255 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
3300005436|Ga0070713_100157469 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
3300005437|Ga0070710_10021806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3343 | Open in IMG/M |
3300005468|Ga0070707_101733747 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300005539|Ga0068853_102490075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
3300005564|Ga0070664_101188162 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300005577|Ga0068857_102375290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 521 | Open in IMG/M |
3300005614|Ga0068856_100160910 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
3300005764|Ga0066903_106925281 | Not Available | 588 | Open in IMG/M |
3300005764|Ga0066903_108206429 | Not Available | 534 | Open in IMG/M |
3300005843|Ga0068860_100236239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1777 | Open in IMG/M |
3300006028|Ga0070717_11456763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 621 | Open in IMG/M |
3300006059|Ga0075017_100453210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 968 | Open in IMG/M |
3300006162|Ga0075030_101122447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 618 | Open in IMG/M |
3300006163|Ga0070715_10438551 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300006163|Ga0070715_10839271 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300006173|Ga0070716_100023340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3279 | Open in IMG/M |
3300006175|Ga0070712_100868463 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300006804|Ga0079221_11419918 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanoculleus → unclassified Methanoculleus → Methanoculleus sp. MH98A | 553 | Open in IMG/M |
3300006806|Ga0079220_10004559 | All Organisms → cellular organisms → Bacteria | 4865 | Open in IMG/M |
3300006954|Ga0079219_12214432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Thermithiobacillaceae → Thermithiobacillus → Thermithiobacillus tepidarius | 529 | Open in IMG/M |
3300007788|Ga0099795_10304373 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300009036|Ga0105244_10417277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 617 | Open in IMG/M |
3300009038|Ga0099829_11751471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 509 | Open in IMG/M |
3300009089|Ga0099828_10841235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 821 | Open in IMG/M |
3300009090|Ga0099827_11921714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 515 | Open in IMG/M |
3300009098|Ga0105245_12261313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300009174|Ga0105241_10972156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 793 | Open in IMG/M |
3300009545|Ga0105237_10144193 | All Organisms → cellular organisms → Bacteria | 2376 | Open in IMG/M |
3300010043|Ga0126380_12000020 | Not Available | 530 | Open in IMG/M |
3300010358|Ga0126370_12172157 | Not Available | 546 | Open in IMG/M |
3300010376|Ga0126381_104062299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
3300010396|Ga0134126_10346081 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
3300010399|Ga0134127_10579370 | Not Available | 1147 | Open in IMG/M |
3300010403|Ga0134123_12427655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 589 | Open in IMG/M |
3300011119|Ga0105246_10595654 | Not Available | 954 | Open in IMG/M |
3300011270|Ga0137391_10316359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1345 | Open in IMG/M |
3300012189|Ga0137388_11565970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 595 | Open in IMG/M |
3300012677|Ga0153928_1053112 | Not Available | 789 | Open in IMG/M |
3300012922|Ga0137394_10181558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1795 | Open in IMG/M |
3300012989|Ga0164305_10905131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 742 | Open in IMG/M |
3300013100|Ga0157373_10806696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 692 | Open in IMG/M |
3300015241|Ga0137418_10946754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
3300015373|Ga0132257_103419116 | Not Available | 578 | Open in IMG/M |
3300016294|Ga0182041_11020595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 748 | Open in IMG/M |
3300016341|Ga0182035_10175090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1673 | Open in IMG/M |
3300016387|Ga0182040_11788973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
3300017955|Ga0187817_10703996 | Not Available | 644 | Open in IMG/M |
3300017970|Ga0187783_10811830 | Not Available | 675 | Open in IMG/M |
3300017973|Ga0187780_11128398 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300018061|Ga0184619_10225628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 862 | Open in IMG/M |
3300020082|Ga0206353_10928907 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300021372|Ga0213877_10041461 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300021560|Ga0126371_11363300 | Not Available | 841 | Open in IMG/M |
3300022467|Ga0224712_10686255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 503 | Open in IMG/M |
3300024331|Ga0247668_1025317 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300025625|Ga0208219_1008759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3345 | Open in IMG/M |
3300025857|Ga0209014_10173501 | Not Available | 768 | Open in IMG/M |
3300025898|Ga0207692_10010876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3851 | Open in IMG/M |
3300025898|Ga0207692_10875026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 590 | Open in IMG/M |
3300025905|Ga0207685_10015535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2415 | Open in IMG/M |
3300025906|Ga0207699_10024218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3316 | Open in IMG/M |
3300025911|Ga0207654_10169222 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
3300025912|Ga0207707_10290387 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
3300025914|Ga0207671_11261606 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300025915|Ga0207693_10105995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2204 | Open in IMG/M |
3300025922|Ga0207646_10147601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2119 | Open in IMG/M |
3300025927|Ga0207687_10295738 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
3300025928|Ga0207700_10013089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5383 | Open in IMG/M |
3300025935|Ga0207709_10085591 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
3300025945|Ga0207679_10941136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 791 | Open in IMG/M |
3300025961|Ga0207712_10370996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1195 | Open in IMG/M |
3300025961|Ga0207712_11417739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 622 | Open in IMG/M |
3300025981|Ga0207640_11713327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300026319|Ga0209647_1292511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 547 | Open in IMG/M |
3300027902|Ga0209048_10090155 | All Organisms → cellular organisms → Bacteria | 2381 | Open in IMG/M |
3300027908|Ga0209006_10699532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
3300027911|Ga0209698_10619358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 830 | Open in IMG/M |
3300028577|Ga0265318_10033817 | Not Available | 1972 | Open in IMG/M |
3300030838|Ga0311335_11010033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
3300031226|Ga0307497_10226247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 824 | Open in IMG/M |
3300031366|Ga0307506_10017529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1723 | Open in IMG/M |
3300031544|Ga0318534_10303236 | Not Available | 920 | Open in IMG/M |
3300031668|Ga0318542_10039693 | All Organisms → cellular organisms → Bacteria | 2084 | Open in IMG/M |
3300031668|Ga0318542_10094884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1432 | Open in IMG/M |
3300031736|Ga0318501_10323069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 826 | Open in IMG/M |
3300031740|Ga0307468_101399294 | Not Available | 643 | Open in IMG/M |
3300031765|Ga0318554_10861384 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300031779|Ga0318566_10497819 | Not Available | 597 | Open in IMG/M |
3300032068|Ga0318553_10429214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 692 | Open in IMG/M |
3300032180|Ga0307471_100419984 | Not Available | 1470 | Open in IMG/M |
3300032205|Ga0307472_100032756 | All Organisms → cellular organisms → Bacteria | 3038 | Open in IMG/M |
3300032261|Ga0306920_102651687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 686 | Open in IMG/M |
3300032770|Ga0335085_10012973 | All Organisms → cellular organisms → Bacteria | 12237 | Open in IMG/M |
3300032782|Ga0335082_10251278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis acididurans | 1651 | Open in IMG/M |
3300033289|Ga0310914_11191771 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300034268|Ga0372943_0032415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2846 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 14.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.17% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.34% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.59% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.67% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.75% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.75% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.75% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.75% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.83% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.83% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.83% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.92% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.92% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.92% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.92% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.92% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908038 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012677 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaG | Host-Associated | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B3_all_c_02589100 | 2124908038 | Soil | RMQALGYPGSVLAKTLIIHYDPSSRIKVILVPETLGF |
deeps_02882440 | 2199352024 | Soil | MQAAGFPGTLLAKTLIISYEPGARISVILVPETLGF |
JGI1027J11758_117554842 | 3300000789 | Soil | LPLEHARMQGLGRPGSLLAKTLIISYEPSRRISVMLVPETLGF* |
P5cmW16_10132621 | 3300001664 | Permafrost | IHEYCLPREFARMQTVGYPGSLLAKVLTIYAQPGGRIRVILVPETLGF* |
JGIcombinedJ26865_10685972 | 3300002347 | Arctic Peat Soil | VREYSLPREFARMQSAGYPGSLLAKTLIIHNEPSGRINVILVPETLGY* |
Ga0055465_102530212 | 3300004013 | Natural And Restored Wetlands | YCLPREFQRMQSVGRAGTIWSETLIIHQDPRTRVRVILVPETLGF* |
Ga0066395_106995602 | 3300004633 | Tropical Forest Soil | GEGLRRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF* |
Ga0066388_1027874363 | 3300005332 | Tropical Forest Soil | PREFGRMQGLGRPGTLLAKTLIIDREPTGRVTVILVPETLGF* |
Ga0068869_1008361371 | 3300005334 | Miscanthus Rhizosphere | SLPREYARMRSLGHPGSLLAKTLIIHHDPNGRIKVILVPETLGF* |
Ga0070687_1002427514 | 3300005343 | Switchgrass Rhizosphere | LVRDVAEGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF* |
Ga0070675_1004086341 | 3300005354 | Miscanthus Rhizosphere | DVAEGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF* |
Ga0070673_1008281771 | 3300005364 | Switchgrass Rhizosphere | EGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF* |
Ga0070713_1001282551 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITVILVPETLGF* |
Ga0070713_1001574691 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILLPETLGF* |
Ga0070710_100218064 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | REYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF* |
Ga0070707_1017337472 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF* |
Ga0068853_1024900752 | 3300005539 | Corn Rhizosphere | PREYGRMQSVGYAGSLLAKSLIIEQEPGGRITVILVPETLGF* |
Ga0070664_1011881623 | 3300005564 | Corn Rhizosphere | LPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF* |
Ga0068857_1023752901 | 3300005577 | Corn Rhizosphere | REFGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF* |
Ga0068856_1001609103 | 3300005614 | Corn Rhizosphere | EGLRRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF* |
Ga0066903_1069252812 | 3300005764 | Tropical Forest Soil | SAGRAGSMLTKTLIIHSDPTSRITVILVPETLGF* |
Ga0066903_1082064291 | 3300005764 | Tropical Forest Soil | ARMQSAGRAGSMLTKTLIIHSDPTSRITVILVPETLGF* |
Ga0068860_1002362391 | 3300005843 | Switchgrass Rhizosphere | RLREYSLPREWERMQQAGFPGAVLAKTLIIHYEFGHRIRVILVPETLGF* |
Ga0070717_114567632 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | REYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILLPETLGF* |
Ga0075017_1004532101 | 3300006059 | Watersheds | VREYSLPREYVRMQEAGYPGSLLAKTLIIHYERSGRISVILVPETLGF* |
Ga0075030_1011224472 | 3300006162 | Watersheds | VDEGLRRVREYNLPREYLRMQGQGYPGSLLAKILLICYEPSGRISVILVPQTLGF* |
Ga0070715_104385511 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | YSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF* |
Ga0070715_108392711 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EYSLPREFERMQGLGRPGTLLAKTLIIDREPTGRVTVILVPETLGF* |
Ga0070716_1000233407 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILLPETLGF* |
Ga0070712_1008684633 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF* |
Ga0079221_114199181 | 3300006804 | Agricultural Soil | LRRVREYSLPREHARMQSAGRAGSILTKTLIIHSDPTSRITIILVPETLGF* |
Ga0079220_100045599 | 3300006806 | Agricultural Soil | VRDVAEGLERLQQYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF* |
Ga0079219_122144321 | 3300006954 | Agricultural Soil | GEGLRRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILLPETLGF* |
Ga0099795_103043732 | 3300007788 | Vadose Zone Soil | RRLREYSVPREFARMQPAGFPGTMLAKTLIIHHEPSRRITVILVPETLGF* |
Ga0105244_104172773 | 3300009036 | Miscanthus Rhizosphere | EGLERLQEYSLPREWDRMQAAGFPGTLLAKTLIISYEPGARISVILVPETLGF* |
Ga0099829_117514711 | 3300009038 | Vadose Zone Soil | MQSVGYPGSLLAKTLIIHTEPGNRISVILVPETLGF* |
Ga0099828_108412351 | 3300009089 | Vadose Zone Soil | RMQSVGRPGSLLAKTLIIHHEPSGRIKVILVPETLGF* |
Ga0099827_119217141 | 3300009090 | Vadose Zone Soil | IREYSLPREFVRMQSVGYPGSLLAKTLIIHTEPGNRISVILVPETLGF* |
Ga0105245_122613132 | 3300009098 | Miscanthus Rhizosphere | REYSLPREYARMRSLGHPGSLLAKTLIIHHDPNGRIKVILVPETLGF* |
Ga0105241_109721563 | 3300009174 | Corn Rhizosphere | GLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF* |
Ga0105237_101441931 | 3300009545 | Corn Rhizosphere | RLREYSLPREFGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF* |
Ga0126380_120000201 | 3300010043 | Tropical Forest Soil | HARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF* |
Ga0126370_121721571 | 3300010358 | Tropical Forest Soil | SAGRAGSMLTKTLIIHSDPTSRVTVILVPETLGF* |
Ga0126381_1040622992 | 3300010376 | Tropical Forest Soil | LPREHARMQSIGRPGSLLAKTLIISYDRPGRITVILVPETLGF* |
Ga0134126_103460811 | 3300010396 | Terrestrial Soil | EFGRMQGLGRPGTLLAKTLIIDREPTGRVTVILVPETLGF* |
Ga0134127_105793701 | 3300010399 | Terrestrial Soil | SLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF* |
Ga0134123_124276553 | 3300010403 | Terrestrial Soil | WDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF* |
Ga0105246_105956542 | 3300011119 | Miscanthus Rhizosphere | EHARMQSAGRAGSMLTKTLIIHSDPTSRITVILVPETLGF* |
Ga0137391_103163594 | 3300011270 | Vadose Zone Soil | SLPREFARMQAAGFPGTMLAKTLIIHHEPSARITVILVPERLGF* |
Ga0137388_115659702 | 3300012189 | Vadose Zone Soil | MQSVGRPGSLLAKTLIIHHEPSGRIKVILVPETLGF* |
Ga0153928_10531121 | 3300012677 | Attine Ant Fungus Gardens | DAGYPGSLLAKTLIMHYEPSGRISVILVPETLGF* |
Ga0137394_101815581 | 3300012922 | Vadose Zone Soil | LRRLREYSLPREFARMQDAGFPGTMLAKTLIIHYEPSARITVILVPETLGF* |
Ga0164305_109051311 | 3300012989 | Soil | PREYVRMQEAGYPGSLLAKTLIMHYEPSGRISVILVPEALGF* |
Ga0157373_108066961 | 3300013100 | Corn Rhizosphere | EWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF* |
Ga0137418_109467542 | 3300015241 | Vadose Zone Soil | YARMQSVGYPGSVLAKTLIIHFEPSGRIKVILVPETLGF* |
Ga0132257_1034191162 | 3300015373 | Arabidopsis Rhizosphere | ARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF* |
Ga0182041_110205951 | 3300016294 | Soil | EHARMQNLGLPGSLLAKTLIIHQEPSRRITVILIPDTLGF |
Ga0182035_101750901 | 3300016341 | Soil | RMQNLGLPGSLLAKTLIIHQEPSRRITVILIPDTLGF |
Ga0182040_117889731 | 3300016387 | Soil | EYSLPREHTRMQSLGHPGSLLAKTLIIHQEPSRRITVILIPDTLGF |
Ga0187817_107039961 | 3300017955 | Freshwater Sediment | LPREFARMQGIGRPGSLLAKTLIISYEPSGRIDVILVPETLGF |
Ga0187783_108118301 | 3300017970 | Tropical Peatland | PREHARMQSLGRPGSMLTKTLIIHSDPTSRIAVILVPETLGF |
Ga0187780_111283982 | 3300017973 | Tropical Peatland | PREYARMQSLGRPGSILAKTLIIHHEPTSRITVILVPETLGF |
Ga0184619_102256282 | 3300018061 | Groundwater Sediment | RPREYSLPREYARLQSLGHMGSALGKTLIFHQEFSGRTHVMLVPETLGF |
Ga0206353_109289073 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | LREYSLPREFGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF |
Ga0213877_100414614 | 3300021372 | Bulk Soil | YSFPREFARMQATGMPGTILAKTLILHREPQRRTHVILVPQTLGF |
Ga0126371_113633001 | 3300021560 | Tropical Forest Soil | SLPREHARMQSAGRAGSMLTKTLIIHSDPTSRVTIILVPETLGF |
Ga0224712_106862552 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | FGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF |
Ga0247668_10253173 | 3300024331 | Soil | REFGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF |
Ga0208219_10087593 | 3300025625 | Arctic Peat Soil | MQGLGHMGSALGKTLIFHQEFSGRTRVILVPETLGF |
Ga0209014_101735011 | 3300025857 | Arctic Peat Soil | RLREYSLPREYARMQSLGHPGSALGKTLILHLELSGRTRVILVPETLGH |
Ga0207692_100108767 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | QGLGRPGTLLAKTLIIDREPTGRVTVILVPETLGF |
Ga0207692_108750261 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | REYSLPREFGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF |
Ga0207685_100155353 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF |
Ga0207699_100242184 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | RRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITVILVPETLGF |
Ga0207654_101692224 | 3300025911 | Corn Rhizosphere | PREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF |
Ga0207707_102903871 | 3300025912 | Corn Rhizosphere | SLPREFGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF |
Ga0207671_112616062 | 3300025914 | Corn Rhizosphere | DVAEGLERLQEYSLPREWDRMQAAGFPGTLLAKTLIISYEPGARISVRA |
Ga0207693_101059953 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | EHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF |
Ga0207646_101476013 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSLGRPGSLLAKTLIISYEPSARISVILVPETLGF |
Ga0207687_102957381 | 3300025927 | Miscanthus Rhizosphere | QKLVRDVAEGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLG |
Ga0207700_100130891 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF |
Ga0207709_100855911 | 3300025935 | Miscanthus Rhizosphere | ERLQHYSLPREWDRMQAAGFPGTVLAKTLTISYEPGARISVILVPETLGF |
Ga0207679_109411363 | 3300025945 | Corn Rhizosphere | KLVRDVAEGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF |
Ga0207712_103709961 | 3300025961 | Switchgrass Rhizosphere | LREYSLPREWERMQQAGFPGAVLAKTLIIHYEFGHRIRVILVPETLGF |
Ga0207712_114177391 | 3300025961 | Switchgrass Rhizosphere | EGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF |
Ga0207640_117133271 | 3300025981 | Corn Rhizosphere | LREYSLPREYARMRSLGHPGSLLAKTLIIHHDPNGRIKVILVPETLGF |
Ga0209647_12925111 | 3300026319 | Grasslands Soil | EYSVPREFARMQEAGFPGTILAKTLLIHHDPTSRTTVILVPETLGF |
Ga0209048_100901554 | 3300027902 | Freshwater Lake Sediment | MQSIGYPGSLLAKTLIIHHEPSARITVILVPETLGF |
Ga0209006_106995322 | 3300027908 | Forest Soil | MQDAGYPGSLLAKTLIVHYEPSGRISVILVPEILGF |
Ga0209698_106193581 | 3300027911 | Watersheds | REYVRMQEAGYPGSLLAKTLIIHYEPSGRISVILVPEALGF |
Ga0265318_100338171 | 3300028577 | Rhizosphere | REYSLPREYLRMQSVGYPGSLLTKTLIVEREPGGRITVILVAETLGF |
Ga0311335_110100333 | 3300030838 | Fen | LPREFVRMQGVGYPGSLLAKTLIIHNEPSGRIRVILVPETLGY |
Ga0307497_102262472 | 3300031226 | Soil | RMQDTGFPGTLLAKTLIIHHEPSARITVILVPETLGF |
Ga0307506_100175291 | 3300031366 | Soil | GLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF |
Ga0318534_103032361 | 3300031544 | Soil | MQSLGRPGSTLAKTLIIDREPSRRITVILVPETLGF |
Ga0318542_100396931 | 3300031668 | Soil | KALGRPGRTLAKTLIIDREPSRRITVIVVPERLGF |
Ga0318542_100948841 | 3300031668 | Soil | YSLPREHARMQNLGLPGSLLAKTLIIHQEPSRRITVILIPDTLGF |
Ga0318501_103230691 | 3300031736 | Soil | VADVREHARMQSLGRPGSTLVKTLIIDREPSRWITVILVPE |
Ga0307468_1013992942 | 3300031740 | Hardwood Forest Soil | PREYLRMQEVGYPGSLLAKTLLIEHEPGGRISVILVPETLGF |
Ga0318554_108613842 | 3300031765 | Soil | VREYSLPREHARMQSVGRQGSLLAKTLIISYDRPGRITVILVPETLGF |
Ga0318566_104978191 | 3300031779 | Soil | VADVREHARMQSLGRPGSTLAKTLIIDREPSRRITVILVPETLGF |
Ga0318553_104292142 | 3300032068 | Soil | TRMQSAGFPGSLLAKTLIIHHDRPGRITVILVPETLGF |
Ga0307471_1004199841 | 3300032180 | Hardwood Forest Soil | HARMQSAGRAGSMLTKTLIIHSDPTSRITIILLPETLGF |
Ga0307472_1000327564 | 3300032205 | Hardwood Forest Soil | DLSEGLRRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILLPETLGF |
Ga0306920_1026516872 | 3300032261 | Soil | HTRMQSAGFPGSLLAKTLIIHHDRPGRITVILVPETLGF |
Ga0335085_100129733 | 3300032770 | Soil | MQSLGRPGSMLTKTLIIHSDPTSRISVILVPQTFGF |
Ga0335082_102512783 | 3300032782 | Soil | YSLPREFARMQGAGFPGTLLAKTLLIHQEPRGRITVILVPETLGF |
Ga0310914_111917711 | 3300033289 | Soil | LVADVREHARMQSLGRPGSTLVKTLIIDREPSRRITVILVPETLGF |
Ga0372943_0032415_7_117 | 3300034268 | Soil | MQTVGYPGSILAKTLLIEREPGGRITVLLVPETLGF |
⦗Top⦘ |