NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089458

Metagenome / Metatranscriptome Family F089458

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089458
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 44 residues
Representative Sequence PREYARMQSLGRPGSILAKTLIIHHEPTSRITVILVPETLGF
Number of Associated Samples 103
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 9.17 %
% of genes near scaffold ends (potentially truncated) 88.99 %
% of genes from short scaffolds (< 2000 bps) 80.73 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.569 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(14.679 % of family members)
Environment Ontology (ENVO) Unclassified
(33.945 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.706 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.43%    β-sheet: 31.43%    Coil/Unstructured: 57.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF04964Flp_Fap 12.84
PF00440TetR_N 5.50
PF00483NTP_transferase 4.59
PF00583Acetyltransf_1 3.67
PF00903Glyoxalase 2.75
PF11141DUF2914 2.75
PF00392GntR 2.75
PF04672Methyltransf_19 2.75
PF12681Glyoxalase_2 2.75
PF02589LUD_dom 1.83
PF00210Ferritin 1.83
PF03176MMPL 1.83
PF08818DUF1801 1.83
PF00381PTS-HPr 0.92
PF02769AIRS_C 0.92
PF00920ILVD_EDD 0.92
PF01988VIT1 0.92
PF08240ADH_N 0.92
PF08044DUF1707 0.92
PF13649Methyltransf_25 0.92
PF07676PD40 0.92
PF13271DUF4062 0.92
PF13560HTH_31 0.92
PF13673Acetyltransf_10 0.92
PF02803Thiolase_C 0.92
PF00248Aldo_ket_red 0.92
PF12706Lactamase_B_2 0.92
PF00872Transposase_mut 0.92
PF02073Peptidase_M29 0.92
PF04069OpuAC 0.92
PF00205TPP_enzyme_M 0.92
PF13556HTH_30 0.92
PF01569PAP2 0.92
PF12802MarR_2 0.92
PF00293NUDIX 0.92
PF00731AIRC 0.92
PF13561adh_short_C2 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG3847Flp pilus assembly protein, pilin FlpExtracellular structures [W] 12.84
COG0129Dihydroxyacid dehydratase/phosphogluconate dehydrataseCarbohydrate transport and metabolism [G] 1.83
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 1.83
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 1.83
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 1.83
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 1.83
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 1.83
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.92
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 0.92
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 0.92
COG1925HPr or related phosphotransfer proteinSignal transduction mechanisms [T] 0.92
COG2309Leucyl aminopeptidase (aminopeptidase T)Amino acid transport and metabolism [E] 0.92
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.49 %
UnclassifiedrootN/A16.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908038|B3_all_c_ConsensusfromContig53073All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium806Open in IMG/M
2199352024|deeps__Contig_156771All Organisms → cellular organisms → Bacteria2323Open in IMG/M
3300000789|JGI1027J11758_11755484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia530Open in IMG/M
3300001664|P5cmW16_1013262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1581Open in IMG/M
3300002347|JGIcombinedJ26865_1068597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium567Open in IMG/M
3300004013|Ga0055465_10253021Not Available594Open in IMG/M
3300004633|Ga0066395_10699560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium601Open in IMG/M
3300005332|Ga0066388_102787436All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium893Open in IMG/M
3300005334|Ga0068869_100836137All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium793Open in IMG/M
3300005343|Ga0070687_100242751All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300005354|Ga0070675_100408634All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300005364|Ga0070673_100828177All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300005436|Ga0070713_100128255All Organisms → cellular organisms → Bacteria2234Open in IMG/M
3300005436|Ga0070713_100157469All Organisms → cellular organisms → Bacteria2025Open in IMG/M
3300005437|Ga0070710_10021806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3343Open in IMG/M
3300005468|Ga0070707_101733747All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300005539|Ga0068853_102490075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300005564|Ga0070664_101188162All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300005577|Ga0068857_102375290All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium521Open in IMG/M
3300005614|Ga0068856_100160910All Organisms → cellular organisms → Bacteria2255Open in IMG/M
3300005764|Ga0066903_106925281Not Available588Open in IMG/M
3300005764|Ga0066903_108206429Not Available534Open in IMG/M
3300005843|Ga0068860_100236239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1777Open in IMG/M
3300006028|Ga0070717_11456763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium621Open in IMG/M
3300006059|Ga0075017_100453210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium968Open in IMG/M
3300006162|Ga0075030_101122447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium618Open in IMG/M
3300006163|Ga0070715_10438551All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300006163|Ga0070715_10839271All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300006173|Ga0070716_100023340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3279Open in IMG/M
3300006175|Ga0070712_100868463All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300006804|Ga0079221_11419918All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanoculleus → unclassified Methanoculleus → Methanoculleus sp. MH98A553Open in IMG/M
3300006806|Ga0079220_10004559All Organisms → cellular organisms → Bacteria4865Open in IMG/M
3300006954|Ga0079219_12214432All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Thermithiobacillaceae → Thermithiobacillus → Thermithiobacillus tepidarius529Open in IMG/M
3300007788|Ga0099795_10304373All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300009036|Ga0105244_10417277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium617Open in IMG/M
3300009038|Ga0099829_11751471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium509Open in IMG/M
3300009089|Ga0099828_10841235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium821Open in IMG/M
3300009090|Ga0099827_11921714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium515Open in IMG/M
3300009098|Ga0105245_12261313All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300009174|Ga0105241_10972156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium793Open in IMG/M
3300009545|Ga0105237_10144193All Organisms → cellular organisms → Bacteria2376Open in IMG/M
3300010043|Ga0126380_12000020Not Available530Open in IMG/M
3300010358|Ga0126370_12172157Not Available546Open in IMG/M
3300010376|Ga0126381_104062299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300010396|Ga0134126_10346081All Organisms → cellular organisms → Bacteria1735Open in IMG/M
3300010399|Ga0134127_10579370Not Available1147Open in IMG/M
3300010403|Ga0134123_12427655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium589Open in IMG/M
3300011119|Ga0105246_10595654Not Available954Open in IMG/M
3300011270|Ga0137391_10316359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1345Open in IMG/M
3300012189|Ga0137388_11565970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium595Open in IMG/M
3300012677|Ga0153928_1053112Not Available789Open in IMG/M
3300012922|Ga0137394_10181558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1795Open in IMG/M
3300012989|Ga0164305_10905131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium742Open in IMG/M
3300013100|Ga0157373_10806696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium692Open in IMG/M
3300015241|Ga0137418_10946754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300015373|Ga0132257_103419116Not Available578Open in IMG/M
3300016294|Ga0182041_11020595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria748Open in IMG/M
3300016341|Ga0182035_10175090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1673Open in IMG/M
3300016387|Ga0182040_11788973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium526Open in IMG/M
3300017955|Ga0187817_10703996Not Available644Open in IMG/M
3300017970|Ga0187783_10811830Not Available675Open in IMG/M
3300017973|Ga0187780_11128398All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300018061|Ga0184619_10225628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium862Open in IMG/M
3300020082|Ga0206353_10928907All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300021372|Ga0213877_10041461All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300021560|Ga0126371_11363300Not Available841Open in IMG/M
3300022467|Ga0224712_10686255All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium503Open in IMG/M
3300024331|Ga0247668_1025317All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300025625|Ga0208219_1008759All Organisms → cellular organisms → Bacteria → Terrabacteria group3345Open in IMG/M
3300025857|Ga0209014_10173501Not Available768Open in IMG/M
3300025898|Ga0207692_10010876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3851Open in IMG/M
3300025898|Ga0207692_10875026All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium590Open in IMG/M
3300025905|Ga0207685_10015535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2415Open in IMG/M
3300025906|Ga0207699_10024218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3316Open in IMG/M
3300025911|Ga0207654_10169222All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300025912|Ga0207707_10290387All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300025914|Ga0207671_11261606All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300025915|Ga0207693_10105995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2204Open in IMG/M
3300025922|Ga0207646_10147601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2119Open in IMG/M
3300025927|Ga0207687_10295738All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300025928|Ga0207700_10013089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5383Open in IMG/M
3300025935|Ga0207709_10085591All Organisms → cellular organisms → Bacteria2044Open in IMG/M
3300025945|Ga0207679_10941136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium791Open in IMG/M
3300025961|Ga0207712_10370996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1195Open in IMG/M
3300025961|Ga0207712_11417739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium622Open in IMG/M
3300025981|Ga0207640_11713327All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300026319|Ga0209647_1292511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium547Open in IMG/M
3300027902|Ga0209048_10090155All Organisms → cellular organisms → Bacteria2381Open in IMG/M
3300027908|Ga0209006_10699532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria830Open in IMG/M
3300027911|Ga0209698_10619358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium830Open in IMG/M
3300028577|Ga0265318_10033817Not Available1972Open in IMG/M
3300030838|Ga0311335_11010033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300031226|Ga0307497_10226247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria824Open in IMG/M
3300031366|Ga0307506_10017529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1723Open in IMG/M
3300031544|Ga0318534_10303236Not Available920Open in IMG/M
3300031668|Ga0318542_10039693All Organisms → cellular organisms → Bacteria2084Open in IMG/M
3300031668|Ga0318542_10094884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1432Open in IMG/M
3300031736|Ga0318501_10323069All Organisms → cellular organisms → Bacteria → Terrabacteria group826Open in IMG/M
3300031740|Ga0307468_101399294Not Available643Open in IMG/M
3300031765|Ga0318554_10861384All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300031779|Ga0318566_10497819Not Available597Open in IMG/M
3300032068|Ga0318553_10429214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces692Open in IMG/M
3300032180|Ga0307471_100419984Not Available1470Open in IMG/M
3300032205|Ga0307472_100032756All Organisms → cellular organisms → Bacteria3038Open in IMG/M
3300032261|Ga0306920_102651687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces686Open in IMG/M
3300032770|Ga0335085_10012973All Organisms → cellular organisms → Bacteria12237Open in IMG/M
3300032782|Ga0335082_10251278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis acididurans1651Open in IMG/M
3300033289|Ga0310914_11191771All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300034268|Ga0372943_0032415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2846Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere14.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.17%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.67%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.75%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.75%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.83%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.83%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.92%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.92%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.92%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.92%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.92%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.92%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908038Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001664Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembledEnvironmentalOpen in IMG/M
3300002347Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219)EnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012677Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaGHost-AssociatedOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025857Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B3_all_c_025891002124908038SoilRMQALGYPGSVLAKTLIIHYDPSSRIKVILVPETLGF
deeps_028824402199352024SoilMQAAGFPGTLLAKTLIISYEPGARISVILVPETLGF
JGI1027J11758_1175548423300000789SoilLPLEHARMQGLGRPGSLLAKTLIISYEPSRRISVMLVPETLGF*
P5cmW16_101326213300001664PermafrostIHEYCLPREFARMQTVGYPGSLLAKVLTIYAQPGGRIRVILVPETLGF*
JGIcombinedJ26865_106859723300002347Arctic Peat SoilVREYSLPREFARMQSAGYPGSLLAKTLIIHNEPSGRINVILVPETLGY*
Ga0055465_1025302123300004013Natural And Restored WetlandsYCLPREFQRMQSVGRAGTIWSETLIIHQDPRTRVRVILVPETLGF*
Ga0066395_1069956023300004633Tropical Forest SoilGEGLRRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF*
Ga0066388_10278743633300005332Tropical Forest SoilPREFGRMQGLGRPGTLLAKTLIIDREPTGRVTVILVPETLGF*
Ga0068869_10083613713300005334Miscanthus RhizosphereSLPREYARMRSLGHPGSLLAKTLIIHHDPNGRIKVILVPETLGF*
Ga0070687_10024275143300005343Switchgrass RhizosphereLVRDVAEGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF*
Ga0070675_10040863413300005354Miscanthus RhizosphereDVAEGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF*
Ga0070673_10082817713300005364Switchgrass RhizosphereEGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF*
Ga0070713_10012825513300005436Corn, Switchgrass And Miscanthus RhizosphereRRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITVILVPETLGF*
Ga0070713_10015746913300005436Corn, Switchgrass And Miscanthus RhizosphereRRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILLPETLGF*
Ga0070710_1002180643300005437Corn, Switchgrass And Miscanthus RhizosphereREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF*
Ga0070707_10173374723300005468Corn, Switchgrass And Miscanthus RhizosphereLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF*
Ga0068853_10249007523300005539Corn RhizospherePREYGRMQSVGYAGSLLAKSLIIEQEPGGRITVILVPETLGF*
Ga0070664_10118816233300005564Corn RhizosphereLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF*
Ga0068857_10237529013300005577Corn RhizosphereREFGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF*
Ga0068856_10016091033300005614Corn RhizosphereEGLRRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF*
Ga0066903_10692528123300005764Tropical Forest SoilSAGRAGSMLTKTLIIHSDPTSRITVILVPETLGF*
Ga0066903_10820642913300005764Tropical Forest SoilARMQSAGRAGSMLTKTLIIHSDPTSRITVILVPETLGF*
Ga0068860_10023623913300005843Switchgrass RhizosphereRLREYSLPREWERMQQAGFPGAVLAKTLIIHYEFGHRIRVILVPETLGF*
Ga0070717_1145676323300006028Corn, Switchgrass And Miscanthus RhizosphereREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILLPETLGF*
Ga0075017_10045321013300006059WatershedsVREYSLPREYVRMQEAGYPGSLLAKTLIIHYERSGRISVILVPETLGF*
Ga0075030_10112244723300006162WatershedsVDEGLRRVREYNLPREYLRMQGQGYPGSLLAKILLICYEPSGRISVILVPQTLGF*
Ga0070715_1043855113300006163Corn, Switchgrass And Miscanthus RhizosphereYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF*
Ga0070715_1083927113300006163Corn, Switchgrass And Miscanthus RhizosphereEYSLPREFERMQGLGRPGTLLAKTLIIDREPTGRVTVILVPETLGF*
Ga0070716_10002334073300006173Corn, Switchgrass And Miscanthus RhizosphereLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILLPETLGF*
Ga0070712_10086846333300006175Corn, Switchgrass And Miscanthus RhizosphereRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF*
Ga0079221_1141991813300006804Agricultural SoilLRRVREYSLPREHARMQSAGRAGSILTKTLIIHSDPTSRITIILVPETLGF*
Ga0079220_1000455993300006806Agricultural SoilVRDVAEGLERLQQYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF*
Ga0079219_1221443213300006954Agricultural SoilGEGLRRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILLPETLGF*
Ga0099795_1030437323300007788Vadose Zone SoilRRLREYSVPREFARMQPAGFPGTMLAKTLIIHHEPSRRITVILVPETLGF*
Ga0105244_1041727733300009036Miscanthus RhizosphereEGLERLQEYSLPREWDRMQAAGFPGTLLAKTLIISYEPGARISVILVPETLGF*
Ga0099829_1175147113300009038Vadose Zone SoilMQSVGYPGSLLAKTLIIHTEPGNRISVILVPETLGF*
Ga0099828_1084123513300009089Vadose Zone SoilRMQSVGRPGSLLAKTLIIHHEPSGRIKVILVPETLGF*
Ga0099827_1192171413300009090Vadose Zone SoilIREYSLPREFVRMQSVGYPGSLLAKTLIIHTEPGNRISVILVPETLGF*
Ga0105245_1226131323300009098Miscanthus RhizosphereREYSLPREYARMRSLGHPGSLLAKTLIIHHDPNGRIKVILVPETLGF*
Ga0105241_1097215633300009174Corn RhizosphereGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF*
Ga0105237_1014419313300009545Corn RhizosphereRLREYSLPREFGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF*
Ga0126380_1200002013300010043Tropical Forest SoilHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF*
Ga0126370_1217215713300010358Tropical Forest SoilSAGRAGSMLTKTLIIHSDPTSRVTVILVPETLGF*
Ga0126381_10406229923300010376Tropical Forest SoilLPREHARMQSIGRPGSLLAKTLIISYDRPGRITVILVPETLGF*
Ga0134126_1034608113300010396Terrestrial SoilEFGRMQGLGRPGTLLAKTLIIDREPTGRVTVILVPETLGF*
Ga0134127_1057937013300010399Terrestrial SoilSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF*
Ga0134123_1242765533300010403Terrestrial SoilWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF*
Ga0105246_1059565423300011119Miscanthus RhizosphereEHARMQSAGRAGSMLTKTLIIHSDPTSRITVILVPETLGF*
Ga0137391_1031635943300011270Vadose Zone SoilSLPREFARMQAAGFPGTMLAKTLIIHHEPSARITVILVPERLGF*
Ga0137388_1156597023300012189Vadose Zone SoilMQSVGRPGSLLAKTLIIHHEPSGRIKVILVPETLGF*
Ga0153928_105311213300012677Attine Ant Fungus GardensDAGYPGSLLAKTLIMHYEPSGRISVILVPETLGF*
Ga0137394_1018155813300012922Vadose Zone SoilLRRLREYSLPREFARMQDAGFPGTMLAKTLIIHYEPSARITVILVPETLGF*
Ga0164305_1090513113300012989SoilPREYVRMQEAGYPGSLLAKTLIMHYEPSGRISVILVPEALGF*
Ga0157373_1080669613300013100Corn RhizosphereEWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF*
Ga0137418_1094675423300015241Vadose Zone SoilYARMQSVGYPGSVLAKTLIIHFEPSGRIKVILVPETLGF*
Ga0132257_10341911623300015373Arabidopsis RhizosphereARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF*
Ga0182041_1102059513300016294SoilEHARMQNLGLPGSLLAKTLIIHQEPSRRITVILIPDTLGF
Ga0182035_1017509013300016341SoilRMQNLGLPGSLLAKTLIIHQEPSRRITVILIPDTLGF
Ga0182040_1178897313300016387SoilEYSLPREHTRMQSLGHPGSLLAKTLIIHQEPSRRITVILIPDTLGF
Ga0187817_1070399613300017955Freshwater SedimentLPREFARMQGIGRPGSLLAKTLIISYEPSGRIDVILVPETLGF
Ga0187783_1081183013300017970Tropical PeatlandPREHARMQSLGRPGSMLTKTLIIHSDPTSRIAVILVPETLGF
Ga0187780_1112839823300017973Tropical PeatlandPREYARMQSLGRPGSILAKTLIIHHEPTSRITVILVPETLGF
Ga0184619_1022562823300018061Groundwater SedimentRPREYSLPREYARLQSLGHMGSALGKTLIFHQEFSGRTHVMLVPETLGF
Ga0206353_1092890733300020082Corn, Switchgrass And Miscanthus RhizosphereLREYSLPREFGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF
Ga0213877_1004146143300021372Bulk SoilYSFPREFARMQATGMPGTILAKTLILHREPQRRTHVILVPQTLGF
Ga0126371_1136330013300021560Tropical Forest SoilSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRVTIILVPETLGF
Ga0224712_1068625523300022467Corn, Switchgrass And Miscanthus RhizosphereFGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF
Ga0247668_102531733300024331SoilREFGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF
Ga0208219_100875933300025625Arctic Peat SoilMQGLGHMGSALGKTLIFHQEFSGRTRVILVPETLGF
Ga0209014_1017350113300025857Arctic Peat SoilRLREYSLPREYARMQSLGHPGSALGKTLILHLELSGRTRVILVPETLGH
Ga0207692_1001087673300025898Corn, Switchgrass And Miscanthus RhizosphereQGLGRPGTLLAKTLIIDREPTGRVTVILVPETLGF
Ga0207692_1087502613300025898Corn, Switchgrass And Miscanthus RhizosphereREYSLPREFGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF
Ga0207685_1001553533300025905Corn, Switchgrass And Miscanthus RhizosphereVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF
Ga0207699_1002421843300025906Corn, Switchgrass And Miscanthus RhizosphereRRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITVILVPETLGF
Ga0207654_1016922243300025911Corn RhizospherePREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF
Ga0207707_1029038713300025912Corn RhizosphereSLPREFGRMQGLGRPGTLLAKTLIIDREPTSRVTVILVPETLGF
Ga0207671_1126160623300025914Corn RhizosphereDVAEGLERLQEYSLPREWDRMQAAGFPGTLLAKTLIISYEPGARISVRA
Ga0207693_1010599533300025915Corn, Switchgrass And Miscanthus RhizosphereEHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF
Ga0207646_1014760133300025922Corn, Switchgrass And Miscanthus RhizosphereMQSLGRPGSLLAKTLIISYEPSARISVILVPETLGF
Ga0207687_1029573813300025927Miscanthus RhizosphereQKLVRDVAEGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLG
Ga0207700_1001308913300025928Corn, Switchgrass And Miscanthus RhizosphereLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILVPETLGF
Ga0207709_1008559113300025935Miscanthus RhizosphereERLQHYSLPREWDRMQAAGFPGTVLAKTLTISYEPGARISVILVPETLGF
Ga0207679_1094113633300025945Corn RhizosphereKLVRDVAEGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF
Ga0207712_1037099613300025961Switchgrass RhizosphereLREYSLPREWERMQQAGFPGAVLAKTLIIHYEFGHRIRVILVPETLGF
Ga0207712_1141773913300025961Switchgrass RhizosphereEGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF
Ga0207640_1171332713300025981Corn RhizosphereLREYSLPREYARMRSLGHPGSLLAKTLIIHHDPNGRIKVILVPETLGF
Ga0209647_129251113300026319Grasslands SoilEYSVPREFARMQEAGFPGTILAKTLLIHHDPTSRTTVILVPETLGF
Ga0209048_1009015543300027902Freshwater Lake SedimentMQSIGYPGSLLAKTLIIHHEPSARITVILVPETLGF
Ga0209006_1069953223300027908Forest SoilMQDAGYPGSLLAKTLIVHYEPSGRISVILVPEILGF
Ga0209698_1061935813300027911WatershedsREYVRMQEAGYPGSLLAKTLIIHYEPSGRISVILVPEALGF
Ga0265318_1003381713300028577RhizosphereREYSLPREYLRMQSVGYPGSLLTKTLIVEREPGGRITVILVAETLGF
Ga0311335_1101003333300030838FenLPREFVRMQGVGYPGSLLAKTLIIHNEPSGRIRVILVPETLGY
Ga0307497_1022624723300031226SoilRMQDTGFPGTLLAKTLIIHHEPSARITVILVPETLGF
Ga0307506_1001752913300031366SoilGLERLQHYSLPREWDRMQAAGFPGTVLAKTLIISYEPGARISVILVPETLGF
Ga0318534_1030323613300031544SoilMQSLGRPGSTLAKTLIIDREPSRRITVILVPETLGF
Ga0318542_1003969313300031668SoilKALGRPGRTLAKTLIIDREPSRRITVIVVPERLGF
Ga0318542_1009488413300031668SoilYSLPREHARMQNLGLPGSLLAKTLIIHQEPSRRITVILIPDTLGF
Ga0318501_1032306913300031736SoilVADVREHARMQSLGRPGSTLVKTLIIDREPSRWITVILVPE
Ga0307468_10139929423300031740Hardwood Forest SoilPREYLRMQEVGYPGSLLAKTLLIEHEPGGRISVILVPETLGF
Ga0318554_1086138423300031765SoilVREYSLPREHARMQSVGRQGSLLAKTLIISYDRPGRITVILVPETLGF
Ga0318566_1049781913300031779SoilVADVREHARMQSLGRPGSTLAKTLIIDREPSRRITVILVPETLGF
Ga0318553_1042921423300032068SoilTRMQSAGFPGSLLAKTLIIHHDRPGRITVILVPETLGF
Ga0307471_10041998413300032180Hardwood Forest SoilHARMQSAGRAGSMLTKTLIIHSDPTSRITIILLPETLGF
Ga0307472_10003275643300032205Hardwood Forest SoilDLSEGLRRVREYSLPREHARMQSAGRAGSMLTKTLIIHSDPTSRITIILLPETLGF
Ga0306920_10265168723300032261SoilHTRMQSAGFPGSLLAKTLIIHHDRPGRITVILVPETLGF
Ga0335085_1001297333300032770SoilMQSLGRPGSMLTKTLIIHSDPTSRISVILVPQTFGF
Ga0335082_1025127833300032782SoilYSLPREFARMQGAGFPGTLLAKTLLIHQEPRGRITVILVPETLGF
Ga0310914_1119177113300033289SoilLVADVREHARMQSLGRPGSTLVKTLIIDREPSRRITVILVPETLGF
Ga0372943_0032415_7_1173300034268SoilMQTVGYPGSILAKTLLIEREPGGRITVLLVPETLGF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.