Basic Information | |
---|---|
Family ID | F089426 |
Family Type | Metagenome |
Number of Sequences | 109 |
Average Sequence Length | 38 residues |
Representative Sequence | MLIYGKTPNDYLKLAKAHKKKVAVGLIIVVAVLSCIF |
Number of Associated Samples | 60 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 82.57 % |
% of genes near scaffold ends (potentially truncated) | 20.18 % |
% of genes from short scaffolds (< 2000 bps) | 79.82 % |
Associated GOLD sequencing projects | 51 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (64.220 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (41.284 % of family members) |
Environment Ontology (ENVO) | Unclassified (91.743 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.321 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.62% β-sheet: 0.00% Coil/Unstructured: 55.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF00476 | DNA_pol_A | 63.30 |
PF01612 | DNA_pol_A_exo1 | 7.34 |
PF13361 | UvrD_C | 1.83 |
PF11753 | DUF3310 | 0.92 |
PF01597 | GCV_H | 0.92 |
PF01636 | APH | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 63.30 |
COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 64.22 % |
All Organisms | root | All Organisms | 35.78 % |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 41.28% |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 31.19% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.34% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.75% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.75% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.83% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.83% |
Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.83% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.83% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.92% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.92% |
Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 0.92% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.92% |
Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.92% |
Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.92% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.92% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000148 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100m | Environmental | Open in IMG/M |
3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
3300001683 | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly | Environmental | Open in IMG/M |
3300001743 | Marine viral communities from the Pacific Ocean - LP-38 | Environmental | Open in IMG/M |
3300006083 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS908_Marker33_DNA | Environmental | Open in IMG/M |
3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
3300006304 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_1000m | Environmental | Open in IMG/M |
3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
3300006324 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0500m | Environmental | Open in IMG/M |
3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
3300009595 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500 | Environmental | Open in IMG/M |
3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
3300020303 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556095-ERR599124) | Environmental | Open in IMG/M |
3300022902 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_135_MG | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
3300025039 | Marine viral communities from the Pacific Ocean - LP-41 (SPAdes) | Environmental | Open in IMG/M |
3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
3300025050 | Marine viral communities from the Pacific Ocean - LP-54 (SPAdes) | Environmental | Open in IMG/M |
3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
3300025237 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes) | Environmental | Open in IMG/M |
3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
3300031601 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133 | Environmental | Open in IMG/M |
3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
3300034629 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
SI47jul10_100mDRAFT_10261212 | 3300000148 | Marine | MLIYGKTPKDYLELAKAHKKATAIAVIIVIAVLYCIF* |
JGI24006J15134_100330883 | 3300001450 | Marine | MLIYGKTPNDYLELAKAHKKETAIAAIIVIAVLYCIF* |
JGI24006J15134_100974052 | 3300001450 | Marine | MLIYGKTPNDYLKVAKAHKKQTAIAAIIVIAVLYCIF* |
GBIDBA_101002205 | 3300001683 | Hydrothermal Vent Plume | MLIYGKTPNDYLKLAKAHKKKVAIGLIIVVVVLSWIF* |
JGI24515J20084_10053854 | 3300001743 | Marine | IYGKTPNDYLKLAKAHKKKVAVGLIIVVAVLSWIF* |
Ga0081762_10850972 | 3300006083 | Diffuse Hydrothermal Flow Volcanic Vent | MLIYGKTPNDYLKLAKAHKKKVAVGLIIVIAVLSWIF* |
Ga0075441_100738583 | 3300006164 | Marine | MLIYGKTPKDYLELAKAHKKGTAVAAIIVIAILYCIS* |
Ga0075441_101048221 | 3300006164 | Marine | GVIMLIYGKTPQDYLELAKAHKKETAIAAIIVIAVLYCIF* |
Ga0075446_100929933 | 3300006190 | Marine | MLIYGKTPNDYLKLAKAHKKKVAIGLIIVVAVLSWIF* |
Ga0068504_13439181 | 3300006304 | Marine | MLIYGKTPNDYLKLAKAHKKKVAVGLIIVVAVLSFIF* |
Ga0068470_11494083 | 3300006308 | Marine | MLIYGKTLNDYLKLAKAHKKKVAVGLIIVVVVLSWIF* |
Ga0068470_11494093 | 3300006308 | Marine | MLIYGKTLNDYLKLAKAHKRKVAVGLIIVVAVLYSIF* |
Ga0068471_110386813 | 3300006310 | Marine | MLIYGKTLNDYLKLAKAHKRKVAVGLIIVIAVLSWIF* |
Ga0068471_12329341 | 3300006310 | Marine | MLIYGKTPNDYLKLAKAHKKKVAVGLIIVVAVLSFI |
Ga0068471_14176642 | 3300006310 | Marine | MLIYGKTLNNYLKLAKAHKKKIAVGLIIVVAVLYCIF* |
Ga0068471_14279114 | 3300006310 | Marine | MLIYGKTLNDYLKLAKANKKKVAIGLIIVVAVLSWIF* |
Ga0068471_15049393 | 3300006310 | Marine | MLIYGKTPNDYLKLAKAHKRKVAVGLIIVVAVLYSIF* |
Ga0068471_16458062 | 3300006310 | Marine | MLIYGKTLNDYLKLAKAHKKKVAVGLIIVVAVLSWIF* |
Ga0068476_11853672 | 3300006324 | Marine | MLIYGKTPNDYLKLAKAHKKKVAVGLIIVVAVLSCIF* |
Ga0068502_13149362 | 3300006336 | Marine | MLIYGKTLNDYLKLAKAHKRKVAVGLIIVVAVLSCIF* |
Ga0068502_14241042 | 3300006336 | Marine | MLIYGKTPNEYLKLAKAHKKKVAVGLIIVVVVLSWIF* |
Ga0068502_14905733 | 3300006336 | Marine | MLIYGKTPNDYLKLAKAHKKKVAIGLIIVIAVLSWIF* |
Ga0068482_12598033 | 3300006338 | Marine | MLIYGKTPNDYLKLAKAHQRKIAVGLIIVVAVLYCIF* |
Ga0068503_1024230610 | 3300006340 | Marine | MLIYGKTLNDYLELAKAHKKKVAVGLIVVAVLYCIF* |
Ga0068503_102482343 | 3300006340 | Marine | MLIYGKTLNDYLKLVKANKKKVAIGLIIVVAVLSWIF* |
Ga0068503_102748132 | 3300006340 | Marine | MLIYGRTLNDYLKLAKAHKKKVAVGLIIVVAVLSFIF* |
Ga0068503_102825603 | 3300006340 | Marine | MLIYGKTPNDYLKLAKAHKKKVVVGLIIVVAVLSFIF* |
Ga0068503_103210563 | 3300006340 | Marine | MLIYGKTLNDYLKLAKAHKRKVAVGLIIVVAVLSWIF* |
Ga0068503_104322262 | 3300006340 | Marine | MLIYGKTPNEYLKLAKAHKKKVAVGLIIVVAVLSWIF* |
Ga0068503_104322275 | 3300006340 | Marine | MLIYGKTLNDYLKLAKAHKRKVAIGLIIVVAVLSWIF* |
Ga0068503_104445282 | 3300006340 | Marine | MLIYGRTPNDYLKLAKAHKKKVAVGLIIVIAVLSWIF* |
Ga0068503_104445292 | 3300006340 | Marine | MLIYGKTLNDYLKLAKAHKKKVVIGLIIVVAVLSWIF* |
Ga0068503_104445912 | 3300006340 | Marine | MLIYGKTPNDYLKLAKAHKKKVVIGLIIVVAVLSFIF* |
Ga0068503_104809865 | 3300006340 | Marine | MLIYGKTPNDYLKLAKAHKKKVAVGLIKVVAVLSWIF* |
Ga0068503_104983221 | 3300006340 | Marine | MLIYGKTPNDYLKLAKAHKKKVAIGLIIVVAVISFIF* |
Ga0068503_105531665 | 3300006340 | Marine | MLIYGKTPNDYLKLAKAHQKKVAVGLIIVIAVLYCIF* |
Ga0068503_105614052 | 3300006340 | Marine | MLIYGRTPNDYLKLAKAHKKKVAIGLIIVIAVLYCIF* |
Ga0068503_105636671 | 3300006340 | Marine | MLIYGKTPNDYLKLAKAHKKKVAIGLIIVVAVLSFIF* |
Ga0068503_105886381 | 3300006340 | Marine | YGRTPNDYLKLAKAHKRKVAIGLIIVVVVLYCIF* |
Ga0068503_105947593 | 3300006340 | Marine | MLIYGKTPNDYLKLAKAHKRKVAVGLIIVVAVLYWIF* |
Ga0068503_107496521 | 3300006340 | Marine | MLIYGKTPNDYLKLAKAHKKKVAVGLKIVVAVLSWIF* |
Ga0068503_108181141 | 3300006340 | Marine | MLIYGKTLDDYLKLAKAHKRKVAVGLIIVVAVLYSIF* |
Ga0068503_108518242 | 3300006340 | Marine | MLIYGRTPNDYLKLAKAHKKKVAVGLIIVIAVLYCIF* |
Ga0098039_11221402 | 3300006753 | Marine | MLIYGKTPNDYLKLAKAHKRKVAVGLIIVVAVLSWIF* |
Ga0098044_12089472 | 3300006754 | Marine | MLIYGKTLNDYLKLAKAHKRKVAAGIIIVIVVLYSIF* |
Ga0066372_104088851 | 3300006902 | Marine | MLIYGKTLNDYLKLAKAHKRKVAIGLIIVVAVLYSIF* |
Ga0075444_101511882 | 3300006947 | Marine | MLIYGKTPNDYLKLAKAHQKKVAIGLIIVIAVLYCIF* |
Ga0075444_102025132 | 3300006947 | Marine | MLIYGKTPNDYLELAKAHKKQTAIAVIIVIAVLYCIF* |
Ga0075444_102828892 | 3300006947 | Marine | MLIYGKTPNDYLKLAKAHKKEVAIGLIIVVAVLSWIF* |
Ga0114916_11224453 | 3300008221 | Deep Ocean | IILRIKIGVIMLIYGKTPNDYLKVAKAHKKETAIAAIIVIAVLYCIF* |
Ga0115371_110232591 | 3300008470 | Sediment | ILEIKLALIMLIYGKTTNDYLLLAKSHKTQTAIAVIIVIAVLYCIF* |
Ga0114918_101048773 | 3300009149 | Deep Subsurface | MLIYGKTPNDYLKLAKAHKKETAVIAIIVIAVLYCIF* |
Ga0114918_101335563 | 3300009149 | Deep Subsurface | MLIYGKTPNDYLELAKAHKKATAIAAIIVIAVLYCIF* |
Ga0114996_107874331 | 3300009173 | Marine | MLIYGKTPKDYLNVAKAHKKETAIAAIIVIAVLYCIF* |
Ga0114996_112862201 | 3300009173 | Marine | MLLYNTQIKIGVIMLIYGKTPKDYLELAKAHKKGTAVAAIIVIAILYCIS* |
Ga0114996_112929592 | 3300009173 | Marine | IYGKTPKDYLELAKAHKKGTAVAAIIVIAILYCIS* |
Ga0114993_105262512 | 3300009409 | Marine | MLIYGKELKDYLELAKVHKKETAIAAIIVIAVLYCIF* |
Ga0114993_110629502 | 3300009409 | Marine | MLIYGKTPNDYLKVAKAHKKQTAIAAIIEIAILYCIF* |
Ga0114993_111216572 | 3300009409 | Marine | MLIYGKTLKDYLKVVKEHKKETAIVAIIVIAILYCIS* |
Ga0114994_103860282 | 3300009420 | Marine | MLIYGKKLKDYLELAKVHKKETAIAAIIVIAVLYCIF* |
Ga0114994_109884181 | 3300009420 | Marine | MLIYGKTPNDYLKVAKAHKKETAIAAIIVIAILYCIF* |
Ga0114997_1000566916 | 3300009425 | Marine | MLIYGKTPNDYVKIAKAHKKETAIAVIIVIAVLYCIF* |
Ga0114997_103203091 | 3300009425 | Marine | MLIYGKTPNDYLKVAKAHKKQTAIAVIVVIAVLYCIF* |
Ga0114997_104255811 | 3300009425 | Marine | MLIYGKTPNDYLELAKAHKKATAIAAIIVIAVLYC |
Ga0115005_116972901 | 3300009432 | Marine | MLIYGKTPNDYLELAKAHKKATVIAAIIVIAILYCIF* |
Ga0105214_1037501 | 3300009595 | Marine Oceanic | MLIYGKTPNDYLKLAKAHKKKVAIGLIIVIAVLSFIF* |
Ga0105173_10440701 | 3300009622 | Marine Oceanic | MLIYGKTPNDYLKLAKAHKKKVAVGLIIVVAVLSWIF* |
Ga0115000_101661081 | 3300009705 | Marine | IYGKTPNDYLELAKAHKKETAIAAIIVIAILYCIF* |
Ga0115000_107156673 | 3300009705 | Marine | MLIYGKTLNDYLKLAKAHKKQTAIAVIIVIADLYCIF* |
Ga0115002_112273182 | 3300009706 | Marine | MLIYGKTPKDYLELAKAHKKGTAVAVIIVIAILYCIS* |
Ga0114999_105963922 | 3300009786 | Marine | MLIYGKTPNDYLKLAKAHQKKVAVGLIIVVAVLSWIF* |
Ga0114999_111914362 | 3300009786 | Marine | MLIYGKTPNDYLKVAKAHKKETAIAAIIVIAVLYCIF* |
Ga0133547_105509712 | 3300010883 | Marine | MLIYGKTPNDYLELAKAHKKATAVAAIIVIAVLYCIF* |
Ga0133547_116796973 | 3300010883 | Marine | MLIYGKTLNDYLKLAKAHKKQTAIAVIIVIAVLYCIF* |
Ga0181432_13025682 | 3300017775 | Seawater | MLIYGKTPNDYLKLAKSHKKEVAIGLIVVIAILYCIF |
Ga0211692_10192052 | 3300020303 | Marine | MLIYGKTPNDYLKLAKAHKKKVVVGLIIVVAVLSFIF |
(restricted) Ga0233429_10445004 | 3300022902 | Seawater | MLIYGKTPKDYLELAKAHKKATAIAVIIVIAVLYCIF |
Ga0210003_11105013 | 3300024262 | Deep Subsurface | MLIYGKTPNDYLKLAKAHKKETAVIAIIVIAVLYCIF |
(restricted) Ga0255047_101144471 | 3300024520 | Seawater | MLIYGKTPKDYLELAKAHKKATAIAAIAVIIVIAVLYCIF |
Ga0207878_1107274 | 3300025039 | Marine | MLIYGKTLNDYLELAKAHKKKVAVGLIVVAVLYCIF |
Ga0207878_1141901 | 3300025039 | Marine | MLIYGKTPNDYLKLAKAHKKKVAVGLIIVVAVLSFIF |
Ga0207901_10314033 | 3300025045 | Marine | INKIGVIMLIYGRTPNDYLKLAKAHKKKVAVGLIIVIAVLSWIF |
Ga0207892_10109171 | 3300025050 | Marine | MLIYGRTPNDYLKLAKAHKKKVAVGLIIVIAVLSWIF |
Ga0207892_10277531 | 3300025050 | Marine | IILTTKIGIIMLIYGKTLNDYLELAKAHKKKVAVGLIVVAVLYCIF |
Ga0207906_10534552 | 3300025052 | Marine | MLIYGKTPNDYLKLAKAHKKKVAVGLIIVVAVLSWI |
Ga0208668_10045834 | 3300025078 | Marine | MLIYGKTLNNYLKLAKAHKKKIAVGLIIVVAVLYCIF |
Ga0208433_10176642 | 3300025114 | Marine | MLIYGKTLNDYLKLAKAHKRKVAVGLIIVVAVLSWIF |
Ga0209337_10095526 | 3300025168 | Marine | MLIYGKTPNDYLKVAKAHKKQTAIAAIIVIAVLYCIF |
Ga0209337_10433842 | 3300025168 | Marine | MLIYGKTPNDYVKIAKAHKKETAIAVIIVIAVLYCIF |
Ga0209337_11398142 | 3300025168 | Marine | MLIYGKTPKDYLNVAKAHKKETAIAAIIVIAVLYCIF |
Ga0209337_13329031 | 3300025168 | Marine | TILQIKIGVIMLIYGKTPNDYLELAKAHKKQTAIAVIIVIAVLYCIF |
Ga0208031_10407192 | 3300025237 | Deep Ocean | MLIYGKTPNDYLELAKAHKKQTAIAVIIVIAVLYCIF |
Ga0209425_100439121 | 3300025897 | Pelagic Marine | MLIYGKTPKDYLELAKAHKKATAIAVIIVIAVLYC |
Ga0209710_11247196 | 3300027687 | Marine | MLIYGKTPNDYLELAKAHKKATAIAAIIVIAVLYCIF |
Ga0209815_12259662 | 3300027714 | Marine | MLIYGKTPKDYLELAKAHKKGTAVAAIIVIAILYCIS |
Ga0209709_100282622 | 3300027779 | Marine | MLIYGKTPNDYLELAKAHKKETAIAAIIVIAVLYCIF |
Ga0209091_100339487 | 3300027801 | Marine | MLIYGKTPNDYLKVAKAHKKQTAIAVIVVIAVLYCIF |
Ga0209090_105077362 | 3300027813 | Marine | MLIYGKTPNDYLELAKAHKKETAIAAIIVIAVLYC |
Ga0209403_103948772 | 3300027839 | Marine | MLIYGKTPKDYLELAKAHKKGTAVAAIIVIAILYC |
Ga0209403_106411472 | 3300027839 | Marine | IYGKTPKDYLELAKAHKKGTAVAAIIVIAILYCIS |
Ga0209501_105238021 | 3300027844 | Marine | LQIKIGVIMLIYGKTPNDYLKVAKAHKKQTAIAAIIVIAVLYCIF |
Ga0307992_10654702 | 3300031601 | Marine | MLIYGKTPKDYLELAKAHKKETAIAAIIVIAVLYCIF |
Ga0302118_103239151 | 3300031627 | Marine | MLIYGKTPNDYLELVKEHKKATAIAAIIVIAVLYCIF |
Ga0307984_10677692 | 3300031658 | Marine | MLIYGKTPRDYLELAKAHKKETAIAAIIVLAVLYCIF |
Ga0307986_104517811 | 3300031659 | Marine | GVIMLIYGKTPNDYLELAKAHKKATAIAAIIVIAVLYCIF |
Ga0310121_101789775 | 3300031801 | Marine | CINKIGVIMLIYGKTPNDYLKLAKAHKKKVAVGLIIVVAVLSWIF |
Ga0310121_103366211 | 3300031801 | Marine | MLIYGKTLNDYLKLVKANKKKVAIGLIIVIAVLSWIF |
Ga0315334_116706233 | 3300032360 | Seawater | IMLIYGKTPNDYLKLAKAHKKKVAVGLIIVVAVLSWIF |
Ga0326756_027471_268_381 | 3300034629 | Filtered Seawater | MLIYGKTLNDYLKLAKANKKKVAVGLIIVVAVLSWIF |
⦗Top⦘ |