NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089425

Metagenome / Metatranscriptome Family F089425

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089425
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 88 residues
Representative Sequence MMHLYAQYFHPTTLLERVRDVRFYRQPRTMFKGFKVPDWATAKEAHGWEIDMYSRQAWDNAMHDFHSEWTPT
Number of Associated Samples 100
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 47.17 %
% of genes near scaffold ends (potentially truncated) 57.80 %
% of genes from short scaffolds (< 2000 bps) 96.33 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (94.495 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(9.174 % of family members)
Environment Ontology (ENVO) Unclassified
(33.945 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(41.284 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.00%    β-sheet: 0.00%    Coil/Unstructured: 56.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.25 %
UnclassifiedrootN/A2.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001963|GOS2229_1037675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1507Open in IMG/M
3300002027|MIS_10155701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1649Open in IMG/M
3300002305|B570J29619_1010971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea695Open in IMG/M
3300002835|B570J40625_100854680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia793Open in IMG/M
3300003345|JGI26080J50196_1044620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea878Open in IMG/M
3300004112|Ga0065166_10154741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea878Open in IMG/M
3300004112|Ga0065166_10202649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea782Open in IMG/M
3300004463|Ga0063356_101075078All Organisms → Viruses → Predicted Viral1157Open in IMG/M
3300004765|Ga0007745_1341168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1006Open in IMG/M
3300004787|Ga0007755_1448733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea509Open in IMG/M
3300004788|Ga0007742_10000232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1478Open in IMG/M
3300004802|Ga0007801_10038997All Organisms → Viruses → Predicted Viral1428Open in IMG/M
3300005069|Ga0071350_1342211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea532Open in IMG/M
3300005758|Ga0078117_1024413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1603Open in IMG/M
3300006037|Ga0075465_10013688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1545Open in IMG/M
3300006037|Ga0075465_10072508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea745Open in IMG/M
3300006164|Ga0075441_10079780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1268Open in IMG/M
3300006165|Ga0075443_10040333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1563Open in IMG/M
3300006165|Ga0075443_10097816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1010Open in IMG/M
3300006355|Ga0075501_1239397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea584Open in IMG/M
3300006415|Ga0099654_10292073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1412Open in IMG/M
3300006641|Ga0075471_10348119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea749Open in IMG/M
3300006875|Ga0075473_10180440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii851Open in IMG/M
3300006875|Ga0075473_10346802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea601Open in IMG/M
3300007169|Ga0102976_1096192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1185Open in IMG/M
3300007231|Ga0075469_10213285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea514Open in IMG/M
3300007561|Ga0102914_1119292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata820Open in IMG/M
3300007658|Ga0102898_1064785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea831Open in IMG/M
3300007860|Ga0105735_1044074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea868Open in IMG/M
3300007861|Ga0105736_1042931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea892Open in IMG/M
3300007954|Ga0105739_1070170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata780Open in IMG/M
3300008116|Ga0114350_1100364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea915Open in IMG/M
3300008120|Ga0114355_1123940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea967Open in IMG/M
3300008120|Ga0114355_1216044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata599Open in IMG/M
3300009006|Ga0103710_10159268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea599Open in IMG/M
3300009068|Ga0114973_10149690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1298Open in IMG/M
3300009159|Ga0114978_10439264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia775Open in IMG/M
3300009163|Ga0114970_10161075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1342Open in IMG/M
3300009436|Ga0115008_10285542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1172Open in IMG/M
3300010354|Ga0129333_10796086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata806Open in IMG/M
3300012212|Ga0150985_105202908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea525Open in IMG/M
3300012935|Ga0138257_1195057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1095Open in IMG/M
3300012953|Ga0163179_11779960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea562Open in IMG/M
3300016695|Ga0180059_1170156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea822Open in IMG/M
3300017709|Ga0181387_1011959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1678Open in IMG/M
3300017967|Ga0181590_10489123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata859Open in IMG/M
3300018762|Ga0192963_1015523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1261Open in IMG/M
3300019017|Ga0193569_10032020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2034Open in IMG/M
3300019048|Ga0192981_10052946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1476Open in IMG/M
3300019048|Ga0192981_10253293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea673Open in IMG/M
3300019085|Ga0188830_1001002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1470Open in IMG/M
3300019201|Ga0180032_1093414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia1550Open in IMG/M
3300020074|Ga0194113_10383607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1038Open in IMG/M
3300020083|Ga0194111_10601553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata690Open in IMG/M
3300020160|Ga0211733_10636215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata942Open in IMG/M
3300020162|Ga0211735_10332566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea792Open in IMG/M
3300020172|Ga0211729_10205493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea655Open in IMG/M
3300020183|Ga0194115_10288433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea756Open in IMG/M
3300020196|Ga0194124_10293421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii789Open in IMG/M
3300020382|Ga0211686_10348944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea603Open in IMG/M
3300020603|Ga0194126_10501179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea748Open in IMG/M
3300020725|Ga0214200_1044146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea695Open in IMG/M
3300021169|Ga0206687_1571524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1162Open in IMG/M
3300021340|Ga0194041_10044115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1441Open in IMG/M
3300021350|Ga0206692_1547412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea615Open in IMG/M
3300021376|Ga0194130_10244264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1030Open in IMG/M
3300021927|Ga0063103_1092730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1338Open in IMG/M
3300022935|Ga0255780_10275674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata814Open in IMG/M
3300024544|Ga0255294_1029448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea984Open in IMG/M
3300024547|Ga0255292_1040740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea918Open in IMG/M
3300024857|Ga0256339_1100568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea594Open in IMG/M
3300025451|Ga0208426_1007624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1545Open in IMG/M
3300025451|Ga0208426_1078478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea510Open in IMG/M
3300025591|Ga0208496_1032414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia1320Open in IMG/M
3300025608|Ga0209654_1079452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea926Open in IMG/M
3300025732|Ga0208784_1185064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea610Open in IMG/M
3300026461|Ga0247600_1095145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea589Open in IMG/M
3300027720|Ga0209617_10217053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea733Open in IMG/M
3300027760|Ga0209598_10061007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1897Open in IMG/M
3300027771|Ga0209279_10029870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1608Open in IMG/M
3300027771|Ga0209279_10132075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii723Open in IMG/M
3300027786|Ga0209812_10064979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1775Open in IMG/M
3300027797|Ga0209107_10269006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata813Open in IMG/M
3300027805|Ga0209229_10223789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea840Open in IMG/M
3300027833|Ga0209092_10593947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea554Open in IMG/M
3300028102|Ga0247586_1078289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea622Open in IMG/M
3300028106|Ga0247596_1133480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea565Open in IMG/M
3300030553|Ga0247645_1064064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea739Open in IMG/M
3300030575|Ga0210288_1110667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea682Open in IMG/M
3300030591|Ga0247626_1146427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea642Open in IMG/M
3300030607|Ga0247615_10198588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea661Open in IMG/M
3300030671|Ga0307403_10216996All Organisms → Viruses → Predicted Viral1002Open in IMG/M
3300030738|Ga0265462_10177861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1129Open in IMG/M
3300030840|Ga0074020_10011873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1184Open in IMG/M
3300031086|Ga0074002_12876920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea615Open in IMG/M
3300031710|Ga0307386_10616792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata575Open in IMG/M
3300031735|Ga0307394_10259936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300031739|Ga0307383_10124698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1163Open in IMG/M
3300031743|Ga0307382_10505832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300031758|Ga0315907_10212698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia1616Open in IMG/M
3300031784|Ga0315899_10223392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia1889Open in IMG/M
3300031784|Ga0315899_11398841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea592Open in IMG/M
3300032742|Ga0314710_10078016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1185Open in IMG/M
3300033572|Ga0307390_10747196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea615Open in IMG/M
3300033978|Ga0334977_0214641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia961Open in IMG/M
3300034355|Ga0335039_0551293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea571Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.17%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.17%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine8.26%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.42%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.50%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.75%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.75%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater2.75%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.75%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.75%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.75%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.75%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.75%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.83%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.83%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.92%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.92%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.92%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.92%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.92%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.92%
Sinkhole FreshwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater0.92%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.92%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.92%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.92%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.92%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.92%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.92%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.92%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001963Marine microbial communities from Nags Head, North Carolina, USA - GS013EnvironmentalOpen in IMG/M
3300002027Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5kEnvironmentalOpen in IMG/M
3300002305Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003345Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNAEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004765Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004787Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004788Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2MEnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007658Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3EnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300007861Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3umEnvironmentalOpen in IMG/M
3300007954Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2umEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300009006Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300016695Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES164 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019085Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dTEnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020603Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150mEnvironmentalOpen in IMG/M
3300020725Freshwater microbial communities from Trout Bog Lake, WI - 23OCT2008 epilimnionEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021340Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-9mEnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022935Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaGEnvironmentalOpen in IMG/M
3300024544Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024547Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024857Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025591Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M (SPAdes)EnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030553Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030575Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030591Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030607Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030840Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031086Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GOS2229_103767523300001963MarineMRVEDVYANKFHKEPYIMFHMYAQYFHPSTLLERVREVRFYRQPRTMFKGFRVPDWATSKEHHKWEFDAYSRQAWENAMHDMQAE
MIS_1015570123300002027Sinkhole FreshwaterMNKFHKEPYIQFHIYAQYFHPETLLERVRDVNFYRRPRTLFKGFRVPDWATSEKRHGWELDTYSRQVWENALQDLNAEWTPV*
B570J29619_101097113300002305FreshwaterMHHIYAQYFHPETLLERVRDVRFYRTPRTLFKGFTVPDWARSKEKHGWEIDTYSREAWENAMHDLHAEWTPQPWGGERQKPNPL*
B570J40625_10085468023300002835FreshwaterMRVEDLYENKFHKEPYIMHHIYAQYFHPDTLLERVRNVRFYRQPRTIFKGFKVPDWANAKEQGLSEWDAHSRQAWDNAMQDMRSEWTPTPFVGERQEPNVLQWF
JGI26080J50196_104462013300003345MarineMMNHIYAQNFHPESLLERVRDVSFYRRPRTLFKGFKVPDWATAENRNGWQIDAYSRQAWDNAMAEFNSEWTPMQFWGERQ
Ga0065166_1015474113300004112Freshwater LakeMNKFHKEPYIQHHIFAQYFHPDSLLERVREVRFYRQPRTLFKGFRVPDWATAEKNHGWELDTYSRQAWDNAMHDMNSEWTPM*
Ga0065166_1020264923300004112Freshwater LakeMLVVVLVLIVFNLIYYIGIRIEDFYSNKFHKEPYIQHHIYAQYFHPDTLLERVREVNFYRRPRTLFKGFKVPDWATAEKQHGWELDAYSRQAWENAMHDMNSEWTPMQFTGERLEPNILNWFRLE
Ga0063356_10107507823300004463Arabidopsis Thaliana RhizosphereMRIEDVYANKFFKEPYIQFHIYQQYFHPDTLLERVRNVNFYRRPRTLFKGFKVPDWATSEKMYGWEIDTYSRQAWANAMHDLESEWTPMQFSGERLEPNAIQWFRLE*
Ga0007745_134116823300004765Freshwater LakeMRVEDVYCNKFHKEPYIMMHMYAQYFHPTTMLERVRDVRFYRQPRTLFKGFKVPDWATSKEHSGWEVDAYSRQAWENAMNDMHSEWTPM*
Ga0007755_144873313300004787Freshwater LakeKFHVEKAREAGLRVEDIYCNKFHKEPYIMMHVYAQYFHPTTMLERVRDVRFYRNPRTMFKGFRVPDWATSKEHAGWEFDAYSRQAW*
Ga0007742_1000023223300004788Freshwater LakeMMHLYAQHFHPHTLLERVRDVRFYRAPRTIFKGFRVPDWATAKEHHGWEIDAYSRKAWENVMQDFYSEWTP*
Ga0007801_1003899723300004802FreshwaterMRVEDVYANKFHKEPYIMMHLYAQYFHPSTLLERVRDVRFYRNPRTIFKGFKVPDWATAKEQHGWEFDAYSRQAWANAMSDFHSEWTPTQFAGERQEPNVL*
Ga0071350_134221113300005069FreshwaterMNKFHKEPYIQHHIFAQYFHPDSLLERVREVRFYRQPRTLFKGFRVPDWATAEKNHGWELDTYSRQAWDNAMHDMNS
Ga0049083_1026929823300005580Freshwater LenticMHLTVVLFVCQSSPILIDYFIGMRVEDVYCNKFHKEPYIMMHMYAQYFHPTTMLERVRDVRFYRQPRTLFKGFKVPDWATSKEHSGWEVDAYSRQAWENAMNDMHSEWTPM*
Ga0078117_102441323300005758Lake WaterMNHVYAQYFHPETLLERVRDVRFYRNPRTLFKGFTVPDWARPKEKHGWDIDVYSRQAWESAMDDMKAEWTPAPWGGQNRQGPNAL*
Ga0075465_1001368823300006037AqueousMRVEDTYCNKFHKEPYMMHHIYAQYFHPSTLLERVRDVRFYRQPRTLFKGFRVPDWATAKEQHGWEFDAYSREAWDNAMEDMHSEWTPVQFAGERQDPNVL*
Ga0075465_1007250823300006037AqueousMNHIYVQYFHPETLLERVRDVRFYRMPRTLFKGFTVPDWARPKEKHGWEIDPYSREAWENAIHDMHAEWTPQPWGGER
Ga0075441_1007978023300006164MarineIYCNKFHKEPYIMHHIYAQYFHPETLLERVRDVRFYRQPRTMFKGFKVPDWATSKEKHGWEVDAYSRNAWDNAMADMKSEWTPVQHPGERQEPNPLQWLR*
Ga0075443_1004033343300006165MarineMHKFHKEPYIMNHIYAQYFHPTTVLERVRDVSFYRRPRTLFKGFKVPDWATAEKRHGWEVDAYSRQAWDNAMHDFNSEWTPMQFWGER*
Ga0075443_1009781613300006165MarineMHHIYAQYFHPETLLERVRDVRFYRQPRTMFKGFKVPDWATSKEKHGWEVDAYSRNAWDNAMADMKSEWTPVQHPGERQEPNPLQWLR*
Ga0075501_123939713300006355AqueousAYIMNHVYAQNFHPETLLERVRDVRFYRLPRTLFKGFTVPDWARPKEKHGWEMDTYSRTAWENAMDEMKQEWTPMPYAGER*
Ga0099654_1029207323300006415LakeMNHIYVQYFHPETLLERVRDVRFYRMPRTLFKGFTVPDWARPKEKHGWEIDPYSREAWENAIHDMHAEWTPQPWGGER*
Ga0075471_1034811923300006641AqueousMNHVYAQNFHPETLLERVRDVRFYRLPRTLFKGFTVPDWARPKEKHGWEMDTYSRTAWENAMDEMKQEWTPMPYAGER*
Ga0075473_1018044013300006875AqueousMHHVYAQYFHPETLLERVRDVSFYRRPRTIFKGFRVPDWAQSQKMHGWDVDIYSRTAWDNAIHDTEAEWTPRQF
Ga0075473_1034680213300006875AqueousMNHVYAQYFHPETLLERVRDVRFYRLPRTLFKGFTVPDWARPKEKHGWEMDVYSRTAWENAMDDMRSEWTPVPWGGERLKPNPLNWFRMEMFGGGFGSRLFY
Ga0102976_109619223300007169Freshwater LakeMRVEDVYANKFHKEPYIMMHLYAQYFHPSTLLERVRDVRFYRNPRTMFKGFKVPDWATAKEQHGWEFDAYSRQAWANAMSDFHSEWTPTQFAGER*
Ga0075469_1021328523300007231AqueousMHKFHKEPYSHNHVYAQNFHPENLLERVRDVSFYRRPRTLFKGFKVPDWATSDKMNNWQVDAYSRQAWDNAMKDFNSEWTPMQFFGERQE
Ga0102914_111929213300007561EstuarineMRVEDVYNNKFHKEPYVMMHLYAQYFHPTTLLERVRDVRFYRQPRTMFKGFKVPDWATAKEAHGWEIDMYSRQAWDNAMHDFHSE
Ga0102898_106478513300007658EstuarineMHKFHKEPYIMNHVYAQYFHPETLLERVRDVSFYRRPRTIFKGFKVPDWATAGKMNGWEVDAYSRQAWENAWSEFSSEWTPMQFWGERQEPNVIEWFRLEQ
Ga0105735_104407423300007860Estuary WaterMMHIYAQYFHPETLLERVRDVRFYRMPRTLFKGFTVPDWARSKEKHGWEIDPYSREAWENAIHDMHAEWTPQPWGGER*
Ga0105736_104293113300007861Estuary WaterIMNHIYVQYFHPETLLERVRDVRFYRMPRTLFKGFTVPDWARPKEKHGWEIDPYSREAWENAIHDMHAEWTPQPWGGER*
Ga0105739_107017023300007954Estuary WaterMRVEDVYANKFHKEPYIMHHIYAQYFHPDTLLERVRAVRFYRQPRTIFKGFKVPDWATAKEQHGWEVDAYSRQAWENAMQDMY
Ga0114350_110036413300008116Freshwater, PlanktonMNHVYAQYFHPETLLERVRDVRFYRLPRTIFKGFTVPDWARSKEKHGWEIDVYSRTAWENAMEDMRQEWTPMQSGGNRQGPNPL*
Ga0114355_112394013300008120Freshwater, PlanktonRIEDFYMNKFHKEPYIQHHIFAQYFHPDSLLERVREVRFYRQPRTLFKGFRVPDWATAEKNHGWELDTYSRQAWDNAMHDMNSEWTPM*
Ga0114355_121604413300008120Freshwater, PlanktonIGFRIEDIYVNKFHKDSYIMNHVYAQYFHPETLLERVRDVRFYRLPRTIFKGFTVPDWARSKEKHGWEIDVYSRTAWENAMEDMRQEWTPMQSGGNRQGPNPL*
Ga0103710_1015926813300009006Ocean WaterMHHIYAQYFHPETLLERVRDVRFYRNPRTIFKGFKVPDWATAKEKHGWDIDAYSRQAWDNAMNDMKAEWAPTQFSGER
Ga0114973_1014969033300009068Freshwater LakeYIGIRIEDFYMNKFHKEPYIQHHIFAQYFHPDSLLERVREVRFYRQPRTLFKGFRVPDWATAEKNHGWELDTYSRQAWDNAMHDMNSEWTPM*
Ga0114978_1043926413300009159Freshwater LakeMRVEDVYVNKFHKEPYVMMHLYAQYFHPSTLLERVRDVRFYRNPRTMFKGFKVPDWATAKEQHGWEFDAYSRQAWANAMSDFHSEWT
Ga0114970_1016107523300009163Freshwater LakeMMHLYAQHFHPHTLLERVRDVRFYRQPRTIFKGFKVPDWATAKEHHGWEIDAYSRKAWENVMQDFYSEWTP*
Ga0115008_1028554233300009436MarineFHPSTLLERVRDVTFYRRTRTLYKGFKVPEWATADKMNGWQVDAYSREAWDNAMHDFNAEVTPMPFFGERQEPNPLEWFRLE*
Ga0129333_1079608613300010354Freshwater To Marine Saline GradientLERVRDVRFYRLPRTIFKGFTVPDWARSKEKHGWEIDVYSRTAWENAMEDMRQEWTPMQSGGNRQGPNPL*
Ga0150985_10520290813300012212Avena Fatua RhizosphereAGIRIEDFYCNKFHKEPYIQFHIYAQYFHPDTLLERVRDVHFYRRPRTLFKGFKVPDWATAEKRHGWEIDIYSRTAWENANNDFISEWTP*
Ga0138257_119505713300012935Polar MarineVYCNKFHKEPYIMHHLYAQYFHPHTMLERVRNVRFYRQPRTLFKGFKVPDWATAKEHDGWEYDAYSRTAWDNAMHDLHSEWTPMQF*
Ga0163179_1177996013300012953SeawaterVYANKFHKEPLIHMHMYAQYFHPHTLVERVRNVSFYRRPRILYKGFRVPDWATAENTDGGWEVDLYSRQAWDNCMHDMHSEWTPQQFSGTRQEPNILQWLRNE
Ga0180059_117015613300016695FreshwaterHIFAQYFHPDSLLERVREVRFYRQPRTLFKGFRVPDWATAEKNHGWELDTYSRQAWDNAMHDMNSEWTPM
Ga0181387_101195923300017709SeawaterMRIEDVYCNKFHKEPYIMHHIYAQYFHPETLLERVRDVRFYRQPRTMFKGFKVPDWATSKEKHGWEVDAYSRNAWDNAMQDMKSEWTPLQHPGERQEPNPLQWLRQDHLG
Ga0181590_1048912313300017967Salt MarshMRIEDVYNNKFHKEPYIMHHIYAQYFHPETLLERVRDVRFYRQPRTIFKGFKVPDWATSKEKHGWEVDYHSRQAWDNAMNDMKSEWTPTQFSGERQEPNVLQ
Ga0192963_101552313300018762MarineHIYAQYFHPETLLERVRDVRFYRQPRTMFKGFKVPDWATSKEKHGWEVDAYSRNAWDNAMADMKSEWTPVQHPGERQEPNPLQWLR
Ga0193569_1003202033300019017MarineMHHVYAQYFHPDTLLERVRDVSFYRRPRTIFKGFRVPDWAQNQNKHGWDFDAYSRQAWNNAMLDLEAEWTPK
Ga0192981_1005294623300019048MarineMHIYAQYFHPSTLLERVRDVRMYRQPRTMFKGFRVPDWATAKEQHGWEFDDYSRIAWENAMHDMLSETTPMQFAGER
Ga0192981_1025329313300019048MarineMHKFHKEPYIMNHIYAQYFHPTTVLERVRDVSFYRRPRTLFKGFKVPDWATAEKRHGWEVDAYSRQAWDNAMHDF
Ga0188830_100100233300019085Freshwater LakeMRVEDVYANKFHKEPYVMMHLYAQYFHPTTLLERVRDVRFYRNPRTMFKGFKVPDWATAKEQHGWEFDAYSRQAWANAMSDFHSEWTPT
Ga0180032_109341413300019201EstuarineMRVEDVYNNKFHKEPYVMMHLYAQYFHPTTLLERVRDVRFYRQPRTMFKGFKVPDWATAKEAHGWEIDMYSRQAWDNAMHDFHSEWTPT
Ga0194113_1038360723300020074Freshwater LakeMFHMYAQYFHPSTMLERVRDVRFYRQPRTIFKGFRVPDWATSKEQHGWEFDAYSRQAWQNAMDDLHSEWTPMQFAGERQEPNVL
Ga0194111_1060155323300020083Freshwater LakeMFHMYAQYFHPSTMLERVRDVRFYRQPRTIFKGFRVPDWATSKEHHRSELDAYSRQAWQNAMDDLHSEWTPMQFAGERQEPNVL
Ga0211733_1063621533300020160FreshwaterYIMMHLYAQYFHPSTLLERVRDVRFYRNPRTMFKGFKVPDWATAKEQHGWEFDAYSRQAWANAMSDFHSEWTPT
Ga0211735_1033256623300020162FreshwaterMRVEDLYENKFHKEPYIMHHIYAQYFHPDTLLERVRNVRFYRQPRTIFKGFKVPDWANAKEQGLSEWDAHSRQAWDNAMHDMNSEW
Ga0211729_1020549313300020172FreshwaterMRVEDVYNNKFHKEPYVMMHLYAQYFHPTTLLERVRDVRFYRQPRTMFKGFKVPEWATAKEAHGWEIDMYSRQAWDNAMHDFHSEWTPTQFSGERQEPN
Ga0194115_1028843323300020183Freshwater LakeVEDVYCNKFHKEPYIMFHMYAQYFHPSTMLERVRDVRFYRQPRTIFKGFRVPDWATSKEQHGWEFDAYSRQAWQNAMDDLHSEWTPMQFAGERQEPNVL
Ga0194124_1029342113300020196Freshwater LakeMLHMYAQYFHPSTMLERVRDVRFYRQPRTMFKGFRVPDWATSKEQHGWEFDAYSRQAWQNAMDDLHSEWTPMQFAGERQEPNVL
Ga0194128_1035530713300020197Freshwater LakeVAVGRVFFSQWILIYYYIGFRVEDIYVNKFHKEAYIMNHVYQQYFHPETLLERIRDVRFYRLPRTIFKGFTVPDWARSKDKHGWEIDLYSRQAWENAMEDMR
Ga0211686_1034894413300020382MarineMFHIYAQNFHPDSLLERVRDVNFYRRTRTLYKGFKVPEWATAQKQTDGWQVDAYSREAWDQALGDFHAEATPMPFFGE
Ga0194126_1050117923300020603Freshwater LakeMFHMYAQYFHPSTMLERVRDVRFYRQPRTIFKGFRVPDWATSKEQHGWEFDAYSRQAWQNAMDDLHSEWTPMQF
Ga0214200_104414623300020725FreshwaterMHHIYAQYFHPETMLERVREVQFYRRPRTLFKGFKVPDWATAEKTHGWELDAYSRQSWENAMHDLNSEW
Ga0206687_157152413300021169SeawaterPYLFFVTYRFHVEKARDGGFRVEDVYCNKFHKEPYIMHHLYAQYFHPSTMLERVRNVRFYRQPRTLFKGFKVPDWATAKEQDGWEYDAYSRTAWENAMHDLHSEWTPMQF
Ga0194041_1004411543300021340Anoxic Zone FreshwaterMMHLYAQHFHPHTLLERVRDVRFYRQPRTIFKGFKVPDWATAKEHHGWEIDAYSRKAWENVMQDFYSEWTP
Ga0206692_154741223300021350SeawaterMNHIWAQHFHPENLLERVRDTSFYRRPRTLYKGFRVPDWATAEKRSGWELDAYSRQAWDNAMADFHSEWTPMQFWGERQEPNPVEWLRLEQFGKGTS
Ga0194130_1024426423300021376Freshwater LakeMFHMYAQYFHPSTMLERVRDVRFYRQPRTMFKGFRVPDWATSKEQHGWEFDAYSRQAWQNAMDDLHSEWTPMQFAGERQEPNVL
Ga0063103_109273013300021927MarineMMHIYAQYFHPSTLLERVRDVRMYRQPRTMFKGFRVPDWATAKEQHGWEFDDYSRQAWENAMHDMLSETTPMQFAGERQEPNVLQWFRLE
Ga0255780_1027567423300022935Salt MarshMHHIYAQYFHPETLLERVRDVRFYRQPRTIFKGFKVPDWATSKEKHGWEVDYHSRQAWDNAMNDMKSEWT
Ga0255294_102944833300024544FreshwaterDNKFHKEAYIMNHVYAQNFHPETLLERVRDVRFYRLPRTLFKGFTVPDWARPKEKHGWEMDTYSRTAWENAMDEMKQEWTPMPYAGER
Ga0255292_104074023300024547FreshwaterMNHVYAQNFHPETLLERVRDVRFYRLPRTLFKGFTVPDWARPKEKHGWEMDTYSRTAWENAMDEMKQEWTPMPYAGER
Ga0256339_110056813300024857FreshwaterEKSREIGIRIEDFYMNKFHKEPYIQHHIFAQYFHPDSLLERVREVRFYRQPRTLFKGFRVPDWATAEKNHKWELDTYSRQAWDNAMHDMNSEWTPM
Ga0208426_100762423300025451AqueousMRVEDTYCNKFHKEPYMMHHIYAQYFHPSTLLERVRDVRFYRQPRTLFKGFRVPDWATAKEQHGWEFDAYSREAWDNAMEDMHSEWTPVQFAGERQDPNVL
Ga0208426_107847813300025451AqueousMFHIYAQYFHPSTLLERVRDVRFYRQPRTIFKGFKVPDWATAKESYGWEHDAYSRQAWDNAMQDMYSEWTPMPFAGERQEPNVLQWFRREQYGC
Ga0208496_103241423300025591FreshwaterMRVEDVYANKFHKEPYIMMHLYAQYFHPSTLLERVRDVRFYRNPRTIFKGFKVPDWATAKEQHGWEFDAYSRQAWANAMSDFHSEWTPTQFAGERQEPNVL
Ga0209654_107945213300025608MarineMMNHIYAQNFHPESLLERVRDVSFYRRPRTLFKGFKVPDWATAENRNGWQIDAYSRQAWDNAMAEFNSEWTPMQFWGERQEPNIIEWFRLEQFGKG
Ga0208784_118506423300025732AqueousMNHVYAQYFHPETLLERVRDVRFYRLPRTLFKGFTVPDWARPKEKHGWEMDVYSRTAWENAMDDMRSEWTPVPWGGERLKPNPLNWFRMEMFGGGFGSRLFYNEV
Ga0247600_109514523300026461SeawaterFMHHVYAQYFHPETLLERVRDVNFYRRTRTLYKGFKVPEWAQASKMNGWEVDAYSREAWDNAMHDFNAEVTP
Ga0208951_116414813300027621Freshwater LenticMHLTVVLFVCQSSPILIDYFIGMRVEDVYCNKFHKEPYIMMHMYAQYFHPTTMLERVRDVRFYRQPRTLFKGFKVPDWATSKEHSGWEVDAYSRQAWENAMNDMHSEWTPM
Ga0209617_1021705323300027720Freshwater And SedimentMRVEDLYENKFHKEPYIMHHIYAQYFHPDTLLERVRNVRFYRQPRTIFKGFKVPDWANAKEQGLTEWDAHSRQAWDNAM
Ga0209598_1006100723300027760Freshwater LakeMNKFHKEPYIQHHIFAQYFHPDSLLERVREVRFYRQPRTLFKGFRVPDWATAEKNHGWELDTYSRQAWDNAMHDMNSEWTPM
Ga0209279_1002987033300027771MarineMHKFHKEPYIMNHIYAQYFHPTTVLERVRDVSFYRRPRTLFKGFKVPDWATAEKRHGWEVDAYSRQAWDNAMHDFNSEWTPMQFWGER
Ga0209279_1013207523300027771MarineMRIEDIYCNKFHKEPYIMHHIYAQYFHPETLLERVRDVRFYRQPRTMFKGFKVPDWATSKEKHGWEVDAYSRNAWDNAMADMKSEWTPVQHPGERQEPNPL
Ga0209812_1006497913300027786Wastewater EffluentMNKFHKEPYIQFHIYAQYFHPDTLLERVRDVNFYRKPRTLFKGFRVPDWATAEKRHGWELDAYSRQAWENALHDLNSEWTPTQFTGERQEPNIIEWFRFE
Ga0209107_1026900613300027797Freshwater And SedimentMRVEDVYNNKFHKEPYVMMHLYAQYFHPTTLLERVRDVRFYRQPRTMFKGFKVPEWATAKEAHGWEIDMYSRQAWDNAMHDFHSEW
Ga0209229_1022378913300027805Freshwater And SedimentFAQYFHPDSLLERVREVRFYRQPRTLFKGFRVPDWATAEKNHKWELDTYSRQAWDNAMHDMNSEWTPM
Ga0209092_1059394723300027833MarineMRIEDVYCNKFHKEPYIMHHIYAQYFHPETLLERVRDVRFYRQPRTMFKGFKVPDWATSKEKHGWEVDAYSRNAWDNAMQDMKSEWTPVQHPGERQE
Ga0247586_107828923300028102SeawaterMNHIWAQHFHPENLLERVRDTSFYRRPRTLYKGFRVPDWATAEKRSGWELDAYSRQAWDNAMADFHSEWTPMQFWGERQEPNPVEWLRLEQFGKGTSSRLFYN
Ga0247596_113348023300028106SeawaterHVEKSREIGIRIEDFYHNKFHKEPYFMHHVYAQYFHPETLLERVRDVNFYRRTRTLYKGFKVPEWAQASKMNGWEVDAYSREAWDNAMHDFNAEVTP
Ga0247645_106406413300030553SoilHVYAQYFHPHTLLERVRDVAFYRRPRTLFKGFKVPDWATAEKRHGWEVDHYSRTAWENALDDLRSEWTPMQFVGDRLEPNPLNWFRLE
Ga0210288_111066713300030575SoilMNKFHKEPYIQYHIFAQYFHPETLLERVRDVNFYRRPRTLFKGFKVPDWATAETRHGWELDTYSRQVWENALNDFTSEWTPQ
Ga0247626_114642713300030591SoilYVQFHMYAQYFHPETLLERVRDVAFYRRPRTLFKGFNVPDWATAEKRHGWELDTYSRQVWDNAMNDLNSEWTPMQFVGERLEPNPV
Ga0247615_1019858813300030607SoilMNKFHKEPYIQFHIYAQYFHPETLLERVRDVNFYRRPRTLFKGFKVPDWATAEQRHGWELDTYSRQAWENAINDL
Ga0307403_1021699633300030671MarineEPYIMNHIFAQYFHPESLLERVRDVSFYRRPRTLFKGFKVPDWGTAEVRNGWEIDAYSRQAWDNAMHEFNSEWTPQQFFGER
Ga0265462_1017786113300030738SoilFHVEKAREAGIRIEDFYMNKFHKEPYIQYHIFAQYFHPETLLERVRDVNFYRRPRTLFKGFKVPDWATAETRHGWELDTYSRQVWENALNDFTSEWTPQ
Ga0074020_1001187333300030840SoilFHVEKAREAGIRVEDFYVHKFHKEPYIQFHIYAQYFHPATLLERVRDVRFFRAPRTLFKGFSIPDWAGSSQRDGWELDTYSRQAWENALNDMNSEWTP
Ga0074002_1287692013300031086SoilEDFYVQKFHKEPMIQFHIYAQYFHPDTLLERVRDVRFFRAPRTLFKGFTVPEWAGSHKREGWDHDTYSRKAWENAMHDMRSEWTPT
Ga0307386_1061679223300031710MarineEPYIMMHMYAQYFHPSTLLERVRDVRFYRQPRTLFKGFRVPDWATAKEQHGWEHDAYSRAAWDNAMLDMHAEWTPTQFVGERQEPNVL
Ga0307394_1025993623300031735MarineMMHIYAQYFHPSTLLERVRDVRMYRQPRTMFKGFRVPDWATAKEQHGWEFDDYSRIAWENAMHDMLSETTPMQFAGER
Ga0307383_1012469813300031739MarineLERVRDVRFYRQPRTLFKGFRVPDWATAKEQHGWEHDAYSRAAWDNAMQDMHAEWTPTQFVGERQEPNVL
Ga0307382_1050583213300031743MarineHAEQARDVGIRVEDIYNNKFHKEPYIMMHMYAQYFHPDTLLERVRHVRFYRQPRTMFKGFRVPEWAQAKEQHGWEFDDYSRQAWENAMHDFHSECTPM
Ga0315907_1021269823300031758FreshwaterMNHVYAQYFHPETLLERVRDVRFYRLPRTIFKGFTVPDWARSKEKHGWEIDVYSRTAWENAMEDMRQEWTPMQSGGNRQGPNPL
Ga0315899_1022339213300031784FreshwaterMMHLYAQYFHPTTLLERVRDVRFYRQPRTMFKGFKVPDWATAKEAHGWEIDMYSRQAWDNAMHDFHSEWTPT
Ga0315899_1139884113300031784FreshwaterMRVEDLYENKFHKEPYIMHHIYAQYFHPDTLLERVRNVRFYRQPRTIFKGFKVPDWANAKEQGLSEWDAHSRQAWDNAMQDMRSEWTPTPFVGERQEPN
Ga0314710_1007801613300032742SeawaterRIEDFYMHKFHKEPYIMNHIYAQYFHPTTVLERVRDVSFYRRPRTLFKGFKVPDWATAEKRHGWEVDAYSRQAWDNAMHDFNSEWTPMQFWGER
Ga0307390_1074719613300033572MarineEPYIMMHIYAQYFHPSTLLERVRDVRMYRQPRTMFKGFRVPDWATAKEQHGWEFDDYSRIAWENAMHDMLSETTPMQFAGEL
Ga0334977_0214641_174_4283300033978FreshwaterMHHIYAQYFHPETLLERVRDVRFYRTPRTLFKGFTVPDWARSKEKHGWEIDTYSREAWENAMHDLHAEWTPQPWGGERQKPNPL
Ga0335039_0551293_1_2073300034355FreshwaterMNHVYAQYFHPETLLERVRDVRFYRLPRTIFKGFTVPDWARSKEKHGWEIDVYSRTAWENAMEDMRQEW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.