NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F089395

Metagenome Family F089395

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089395
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 46 residues
Representative Sequence MYRYRFPLFLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVKDKK
Number of Associated Samples 88
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.17 %
% of genes near scaffold ends (potentially truncated) 98.17 %
% of genes from short scaffolds (< 2000 bps) 91.74 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.083 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere
(10.092 % of family members)
Environment Ontology (ENVO) Unclassified
(54.128 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(67.890 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 55.26%    β-sheet: 0.00%    Coil/Unstructured: 44.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF14060DUF4252 21.10
PF08281Sigma70_r4_2 4.59
PF02954HTH_8 0.92



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.08 %
UnclassifiedrootN/A0.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000953|JGI11615J12901_10746813All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300001904|JGI24736J21556_1038095All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300003319|soilL2_10019069All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia6685Open in IMG/M
3300003319|soilL2_10139420All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2004Open in IMG/M
3300004114|Ga0062593_102640278All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300004156|Ga0062589_102865348All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300004480|Ga0062592_100549280All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300004643|Ga0062591_102596146All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300005093|Ga0062594_102630054All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300005328|Ga0070676_10654554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300005332|Ga0066388_106443544All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300005334|Ga0068869_100355697All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1195Open in IMG/M
3300005343|Ga0070687_101299044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300005345|Ga0070692_11028349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300005438|Ga0070701_10851506All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300005438|Ga0070701_10904013All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300005444|Ga0070694_100618881All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium873Open in IMG/M
3300005445|Ga0070708_102133267All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300005458|Ga0070681_10523534All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1099Open in IMG/M
3300005543|Ga0070672_102127578All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300005545|Ga0070695_101737279All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300005546|Ga0070696_101550883All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300005547|Ga0070693_101479520All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300005563|Ga0068855_100956328All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium902Open in IMG/M
3300005577|Ga0068857_100193953All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1850Open in IMG/M
3300005578|Ga0068854_100167489All Organisms → cellular organisms → Bacteria1707Open in IMG/M
3300005618|Ga0068864_101243459All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300005841|Ga0068863_100355274All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1428Open in IMG/M
3300005841|Ga0068863_100546279All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1144Open in IMG/M
3300005841|Ga0068863_100628680All Organisms → cellular organisms → Bacteria → Acidobacteria1064Open in IMG/M
3300005841|Ga0068863_101792509All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300005842|Ga0068858_101936502All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300005844|Ga0068862_102633637All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300006058|Ga0075432_10070502All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1255Open in IMG/M
3300006169|Ga0082029_1001188All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300006791|Ga0066653_10703913All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300006846|Ga0075430_101612632All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300006904|Ga0075424_101410300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300006904|Ga0075424_101906277All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300006918|Ga0079216_10357848All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium895Open in IMG/M
3300009011|Ga0105251_10278232All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium756Open in IMG/M
3300009147|Ga0114129_10196207All Organisms → cellular organisms → Bacteria → Acidobacteria2737Open in IMG/M
3300009148|Ga0105243_10752609All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium955Open in IMG/M
3300009148|Ga0105243_11221394All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium766Open in IMG/M
3300009156|Ga0111538_11617835All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium816Open in IMG/M
3300009162|Ga0075423_10121892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2734Open in IMG/M
3300009174|Ga0105241_10942470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium804Open in IMG/M
3300009177|Ga0105248_10144384All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2685Open in IMG/M
3300009789|Ga0126307_10589685All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium897Open in IMG/M
3300009789|Ga0126307_11492430All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300010038|Ga0126315_11109991All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300010047|Ga0126382_10647745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium877Open in IMG/M
3300010358|Ga0126370_10957888All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300010362|Ga0126377_13241821All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300010362|Ga0126377_13350710All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300010400|Ga0134122_12948380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300010401|Ga0134121_10173869All Organisms → cellular organisms → Bacteria → Acidobacteria1850Open in IMG/M
3300010401|Ga0134121_10821584All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium895Open in IMG/M
3300010403|Ga0134123_13551750All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300010403|Ga0134123_13626758All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300013100|Ga0157373_10751721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300013296|Ga0157374_11484529All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300013297|Ga0157378_11382972All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium746Open in IMG/M
3300013307|Ga0157372_11216178All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium870Open in IMG/M
3300013307|Ga0157372_11255307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium855Open in IMG/M
3300013307|Ga0157372_12666713All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300014325|Ga0163163_10225902All Organisms → cellular organisms → Bacteria → Acidobacteria1921Open in IMG/M
3300014325|Ga0163163_11312144All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium786Open in IMG/M
3300014497|Ga0182008_10416371All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium724Open in IMG/M
3300014968|Ga0157379_10096791All Organisms → cellular organisms → Bacteria → Acidobacteria2649Open in IMG/M
3300014969|Ga0157376_10007435All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes7822Open in IMG/M
3300015374|Ga0132255_100102687All Organisms → cellular organisms → Bacteria → Acidobacteria3888Open in IMG/M
3300021445|Ga0182009_10226947All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium919Open in IMG/M
3300025735|Ga0207713_1066283All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1352Open in IMG/M
3300025904|Ga0207647_10622315All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300025911|Ga0207654_10290984All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1108Open in IMG/M
3300025911|Ga0207654_11257766All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300025912|Ga0207707_11114253Not Available643Open in IMG/M
3300025913|Ga0207695_10630860All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium953Open in IMG/M
3300025914|Ga0207671_11000034All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium659Open in IMG/M
3300025918|Ga0207662_10844273All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300025924|Ga0207694_10293922All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1336Open in IMG/M
3300025935|Ga0207709_11468968All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300025935|Ga0207709_11794769All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300025937|Ga0207669_11536881All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300025941|Ga0207711_10016871All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes6064Open in IMG/M
3300025942|Ga0207689_10626039All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium906Open in IMG/M
3300025949|Ga0207667_11080074All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium786Open in IMG/M
3300025949|Ga0207667_12094711All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300025960|Ga0207651_11831673All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300025961|Ga0207712_11106249All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium705Open in IMG/M
3300025981|Ga0207640_10355120All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1179Open in IMG/M
3300025981|Ga0207640_11969605All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300025986|Ga0207658_11094749All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300026075|Ga0207708_10654273All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium895Open in IMG/M
3300026078|Ga0207702_11063278All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium803Open in IMG/M
3300026078|Ga0207702_12432402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300026095|Ga0207676_10264662All Organisms → cellular organisms → Bacteria → Acidobacteria1554Open in IMG/M
3300027765|Ga0209073_10126912All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium924Open in IMG/M
3300030510|Ga0268243_1133838All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300031548|Ga0307408_100304697All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1336Open in IMG/M
3300031548|Ga0307408_101801580All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300031716|Ga0310813_11154833All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300031852|Ga0307410_10769621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium816Open in IMG/M
3300031995|Ga0307409_100771646All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium967Open in IMG/M
3300032179|Ga0310889_10733999All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300033412|Ga0310810_10340626All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1584Open in IMG/M
3300033412|Ga0310810_11378653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300033475|Ga0310811_11137307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere10.09%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.26%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.34%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.50%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere4.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.67%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.67%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.83%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.83%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.83%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.83%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.83%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2Host-AssociatedOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300030510Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11615J12901_1074681323300000953SoilMYRYRFPLLLLFILGTFASLPVNGQEVEDTIKIKTRVVFLDALVK
JGI24736J21556_103809513300001904Corn RhizosphereMHRTLLLLVILAALASFPVRAQEVEDTIKIKTRVVFLDALVKDK
soilL2_1001906923300003319Sugarcane Root And Bulk SoilMYKYRFPLLLLFILATFASLPVNAQEVEDTIKIKTRVVFLDALVKDK
soilL2_1013942063300003319Sugarcane Root And Bulk SoilMNRYRFPLLILFILATFASLSIKAQEVEDTIKIKTRVVFLDA
Ga0062593_10264027813300004114SoilMNRYRFPLLLLFILATFASLPAYAQEVEDTIKIKTRVVFLDALVKDK
Ga0062589_10286534823300004156SoilMYRFRLNLLLLFILATFASLPAHAQEVEDTIKIKTRVVFLDALVKDK
Ga0062592_10054928013300004480SoilMYRYRFPLLLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVKDKKTNLPISNL
Ga0062591_10259614623300004643SoilMYRHRFSFVLLAVIALLASVSVHAQEVEDTIRIKTRVVFLDALVKDKK
Ga0062594_10263005423300005093SoilMYRYRFSLLLLFILATFASLSTQAQEVEDTIKIKTRVVFLDA
Ga0070676_1065455423300005328Miscanthus RhizosphereMYRYRFPLFLLFILATFASLPIHAQEVEDTIKIKTRVVFL
Ga0066388_10644354413300005332Tropical Forest SoilMSKYFLLLIVLLASFPAKAQEVEDTIKIKTRVVFLDALVKDKKTNLP
Ga0068869_10035569733300005334Miscanthus RhizosphereMHRYRFTLLLLFILATFVSLPATAQEVEDTIKIKTRVVFLDALVKDK
Ga0070687_10129904413300005343Switchgrass RhizosphereMHRILFLLVLLAALASFPVRAQQVEDTIRIKTRVVFLDAL
Ga0070692_1102834913300005345Corn, Switchgrass And Miscanthus RhizosphereMYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVKDKK
Ga0070701_1085150623300005438Corn, Switchgrass And Miscanthus RhizosphereMRRLLILIVLAAVSFISIQAQEVEDTIKIKTRVVFLDALVKDKKT
Ga0070701_1090401323300005438Corn, Switchgrass And Miscanthus RhizosphereMYRYRFPLFLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVKDK
Ga0070694_10061888113300005444Corn, Switchgrass And Miscanthus RhizosphereMYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVKDKKTN
Ga0070708_10213326713300005445Corn, Switchgrass And Miscanthus RhizosphereMHRILFLLFVLAALASFPVRAQEVEDTIKIKTRVVFLDALVK
Ga0070681_1052353413300005458Corn RhizosphereMRKYRFPLLLLFILATFASLPAHGQEVEDTIKIRTRVVFLDALVKDK
Ga0070672_10212757823300005543Miscanthus RhizosphereMHRILFLLVVLAALASFPVRAQEVEEVIKIKTRVVFLDA
Ga0070695_10173727923300005545Corn, Switchgrass And Miscanthus RhizosphereMNRYRFPLLILFILATFASLSVHAQEVEDTIKIKTRVVFLDALVKDKKT
Ga0070696_10155088313300005546Corn, Switchgrass And Miscanthus RhizosphereMSRFRFLALLIIATLSSFTAHAQEVEDTIKIKTRVVFLDALVKDK
Ga0070693_10147952013300005547Corn, Switchgrass And Miscanthus RhizosphereMYRLRWNILLLVVIAALASLPIHAQEVEDTIRIKTRAVFLDALVK
Ga0068855_10095632813300005563Corn RhizosphereMRRLLLLIVLAAISFVSIHAQEVEDTIKIKTRVVFLDALV
Ga0068857_10019395313300005577Corn RhizosphereMHRILFLLVVLAALASFPVRAQEVEDTIKIKTRVVFLDAL
Ga0068854_10016748913300005578Corn RhizosphereMYRYRFPLLLLFILATFASLPAHAQEVEDTIKIKTRVVF
Ga0068864_10124345913300005618Switchgrass RhizosphereMRRLLILIVLAAISFISVQAQEVEDTIKIKTRVVFLDALVKDKK
Ga0068863_10035527443300005841Switchgrass RhizosphereMYRHRFPLLLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVKDKK
Ga0068863_10054627913300005841Switchgrass RhizosphereMSKYRLSFLLLIVLFASFSINAQEVDDTIKIKTRVVFLDALVKDKKTNLPI
Ga0068863_10062868033300005841Switchgrass RhizosphereMYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVKDKKTNLPISNLTT
Ga0068863_10179250913300005841Switchgrass RhizosphereMHRILFLLVVLAALASFPVRAQEVEEVIKIKTRVVFLDALVKDKKTS
Ga0068858_10193650223300005842Switchgrass RhizosphereMHRILLLLVVLAALASFLVRAQEVEDTIKIKTRVVFLDALVKDKKT
Ga0068862_10263363723300005844Switchgrass RhizosphereMHRILFLLIVLAALASFPVRAQEVEDTIKIKTRVVFLDALVK
Ga0075432_1007050233300006058Populus RhizosphereMRRLLLLIVLAAISFVSIHAQEVEDTIKIKTRVVFLDALVKDKKTSLPISNL
Ga0082029_100118823300006169Termite NestMRRLLLLIVLAAISFVSIHAQEVEDTIKIKTRVVFLDALVKDKKTNLPIS
Ga0066653_1070391323300006791SoilMHRIRWNVLLLVLIATLAATAIRAQEVEDTIRIKTRVVFLDALVKD
Ga0075430_10161263223300006846Populus RhizosphereMYRLLLLALIAALSFVSINAQEVEDTIKIKTRVVFLDALVKDKKTSLPIS
Ga0075424_10141030023300006904Populus RhizosphereMFRYRFSLLLLALIAVVAVSVRAQEVEDTIKIKTRVVFLDALVKDKKTNLP
Ga0075424_10190627713300006904Populus RhizosphereMYRYRLHLLLFVIIAALAPISIRAQEVEDTVRIKTRVVFLDAL
Ga0079216_1035784833300006918Agricultural SoilMYRYRLNLLLLVIIATLASVSIHAQVVEDTIRIKTRVVFLDALVKDKKTN
Ga0105251_1027823233300009011Switchgrass RhizosphereMYRYRFLVLVIIATLTSFSARAQEVEDTIKIKTRVVFLDALV
Ga0114129_1019620763300009147Populus RhizosphereMHKHYLRFFLLLVVLVLTVSSVNAQEVEDTIKIKTRVVFLDALVKDKKTN
Ga0105243_1075260913300009148Miscanthus RhizosphereMHRILLLLVVLAALASFLVRAQEVEDTIKIKTRVVFLDALVKDKKTNLPISDLTTANFEV
Ga0105243_1122139433300009148Miscanthus RhizosphereMHKHRFSFLLLFILATFASLSINAQEVEDTIKIKTRVVFLDALV
Ga0111538_1161783513300009156Populus RhizosphereMYRYRFLVLLIIATLTSFSARAQEVEDTIKIKTRVVF
Ga0075423_1012189213300009162Populus RhizosphereMHRILFLLVVLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKKTNLPISELT
Ga0105241_1094247033300009174Corn RhizosphereMRRNILLVVLFANLASFSVNAQEVEDTIKIKTRVVFLDALV
Ga0105248_1014438453300009177Switchgrass RhizosphereMYRIPFLLFVLAALASFPVRAQEVEDTIMIKTRVVFLDALVKDKKTSLPISDLTSA
Ga0126307_1058968533300009789Serpentine SoilMYRYRLSLLLLFIFTTLASLSAHAQEVEDTIKIKTRVVFLDA
Ga0126307_1149243023300009789Serpentine SoilMYRYRFLLLILFATLACFSTHAQEVEDTIKIKTRVVFLDALV
Ga0126315_1110999113300010038Serpentine SoilMHRILFLLVVLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKKTNLPIS
Ga0126382_1064774513300010047Tropical Forest SoilMSKSHLSFLLLIVLFASFAINAQEVEDTIKIKTRVVFLDALVKDK
Ga0126370_1095788813300010358Tropical Forest SoilMSKYFLLLIVLLSSFPAKAQEVEDTIKIKTRVVFLDALVKDRKTNLQISNLTSENFA
Ga0126377_1324182113300010362Tropical Forest SoilMHRILFLLVVLAALASFPVRAQEVEDTIKIKTRVVFL
Ga0126377_1335071013300010362Tropical Forest SoilMHRYRFPLLLLFILATFASLPIQAQEVEDTIKIKTRVVFLDALVKDKKTNLPISNLAT
Ga0134122_1294838023300010400Terrestrial SoilMNRYRFPLTILFILATFASLSVHAQEVEDTIKIKTRVVFLDALVKDKKTS
Ga0134121_1017386913300010401Terrestrial SoilMYKYRFPLFLLFILGTFASLPASISVCAQEVEDTIKIKTRVVFLDALVKDKKTNLPISNL
Ga0134121_1082158413300010401Terrestrial SoilMSKYFLLLIVLLASFSAQAQEVEDTIKIKTRVVFLDALVKDKKTS
Ga0134123_1355175023300010403Terrestrial SoilMHRILFLLVVLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKKTSLP
Ga0134123_1362675823300010403Terrestrial SoilMYRYRFPLFLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVKDKK
Ga0157373_1075172123300013100Corn RhizosphereMYRYRFSLLLLFILASLSVNAQEVEDTIKIKTRVVFLDALVKDKK
Ga0157374_1148452923300013296Miscanthus RhizosphereMFRYRFSLLLLVIVALASVSIRAQEVEDTVRIKTRVVFLDALV
Ga0157378_1138297223300013297Miscanthus RhizosphereMHRILFPLVVLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKKTSLPIS
Ga0157372_1121617833300013307Corn RhizosphereMYRYRLHLSLLAIIAALASVSIRAQEVEDTIRIKTRVVFLDALVKDKK
Ga0157372_1125530713300013307Corn RhizosphereMYRYRFPLFLLFILATFASLPIHAQEVEDTIKIKTRVVF
Ga0157372_1266671323300013307Corn RhizosphereMFRYRFSLLLLALIAIAAISVRAQEVEDTIKIKTRVVFLDALVKDKKT
Ga0163163_1022590253300014325Switchgrass RhizosphereMRRNILLVVLFATLASFSVNAQEVEDTIKIKTRVVFLDALV
Ga0163163_1131214423300014325Switchgrass RhizosphereMYRIVFLLIVLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKKSSLPISDLTS
Ga0182008_1041637113300014497RhizosphereMSNYVLLLIVILASFPAKAQEVEETIKIKTRVVFLDALVKDKKTNL
Ga0157379_1009679113300014968Switchgrass RhizosphereMYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVKD
Ga0157376_1000743513300014969Miscanthus RhizosphereLRLRLNTLLAVIAVALLCVSATAQEVDDTIRIKTRVVFLDA
Ga0132255_10010268713300015374Arabidopsis RhizosphereMSLLRSLGFIVLVIVVAALSSVTVVAQEVEDTIRIKTRVVFLDALVKDKKTS
Ga0182009_1022694733300021445SoilMYKLRWKILLLAVIATLASLPIHAQEVEDTIRIKTRVVFLDALVKDKKTNL
Ga0207713_106628343300025735Switchgrass RhizosphereMHRYRFNFLLLFILATFASLSAPVCIQAQEVEDTIKIKTRVVFLDAL
Ga0207647_1062231513300025904Corn RhizosphereMHRILFLLVLLAALASFPVRAQQVEDTIRIKTRVVFLDALVKDKKTSLPISDLTSANFE
Ga0207654_1029098443300025911Corn RhizosphereMYRYRFPLFLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVK
Ga0207654_1125776613300025911Corn RhizosphereMHRILFLLIVLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKK
Ga0207707_1111425333300025912Corn RhizosphereMYRYCFRLLLLIVVALASVSIRAQEVEDTIRIKTRVVFLDALVKDKKTN
Ga0207695_1063086013300025913Corn RhizosphereMSKYLLLLIVLLAAFPARAQEIEDTIKIKTRVVFL
Ga0207671_1100003423300025914Corn RhizosphereMYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVKDKKTNLPISNLTPE
Ga0207662_1084427313300025918Switchgrass RhizosphereMHRILFLLVLLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKKTSLPISDLTSANFEV
Ga0207694_1029392213300025924Corn RhizosphereMHRILLLLVVLAACASFPVRAQEVEDTIKIKTRVVFLDALVKDKKT
Ga0207709_1146896813300025935Miscanthus RhizosphereMYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVKDKKTNLPISNLT
Ga0207709_1179476913300025935Miscanthus RhizosphereMRRLLLLIVLAAISFVSIHAQEVEDTIKIKTRVVFLDALVKDKKTSLPISNLTTE
Ga0207669_1153688113300025937Miscanthus RhizosphereMYRHRFPLFLLFIVATFASLPVPLSTEAQEVEDTIKIQTRVVFLD
Ga0207711_1001687113300025941Switchgrass RhizosphereMYRFRLNLLLLVAIATLASISIHAQEVEDTIRIKTRVVFLDALVKDKRT
Ga0207689_1062603933300025942Miscanthus RhizosphereMHRYRFTLLLLFILATFVSLPATAQEVEDTIKIKTRVVFLDALVKDRKTSLPISNL
Ga0207667_1108007413300025949Corn RhizosphereMRRLLLLIVLAAISFVSIHAQEVEDTIKIKTRVVFLDALVKD
Ga0207667_1209471123300025949Corn RhizosphereMYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALV
Ga0207651_1183167313300025960Switchgrass RhizosphereMNRYRFPLLLLFILATFASLPAYAQEVEDTIKIKTRVVFLDALVKDKKTNLPIS
Ga0207712_1110624923300025961Switchgrass RhizosphereMHRYRLRLLLLFILATFASLSTPLSTKAQEVEDTIKIKTRVVFLDALVKDKKTSLPI
Ga0207640_1035512013300025981Corn RhizosphereMYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVK
Ga0207640_1196960513300025981Corn RhizosphereMYRHRFPLLLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVKDKKTNLP
Ga0207658_1109474913300025986Switchgrass RhizosphereMYRYRFSLLLLFILATFASLSTQAQEVEDTIKIKTRVVFLDALVK
Ga0207708_1065427333300026075Corn, Switchgrass And Miscanthus RhizosphereMHKFRLHLLLLFILALSSLSAHAQEVEDTIKIKTRVVFLDA
Ga0207702_1106327813300026078Corn RhizosphereMNRYRFPLLLLFILATFASLSTPLSTKAQEVEDTIKIKTRVVFLDALVKDRR
Ga0207702_1243240213300026078Corn RhizosphereMKRLLLLIIIAVLACVSIHAQEVEDTIKIKTRVVFLDALVKDKKTN
Ga0207676_1026466243300026095Switchgrass RhizosphereMYKYRFPLLLLFILGTLASLPASISVCAQEVEDTIKIKTRVVFLDALVKDKKTNLPISN
Ga0209073_1012691233300027765Agricultural SoilMSKYFLLLVMLFASFPATAQEAEDTIKIKTRVVFLDALVKDRKTN
Ga0268243_113383813300030510SoilMRRKFLLLVIFATLATFSINAQEVDDTIKIKTRVVFLDALVKDKK
Ga0307408_10030469733300031548RhizosphereMYRYRLPFLLSLIIASLASVSIHAQEVDETIRIKTRVVFL
Ga0307408_10180158023300031548RhizosphereMCNRMHRRRLSFLVLIVIATFVSVRAQEVEETIRIKTRVVFL
Ga0310813_1115483323300031716SoilMSKYRLSFLLLIILLASFAATAQEVDDTIKIKTRVVFL
Ga0307410_1076962113300031852RhizosphereMSKYRLSFLLLIVLLASFSINAQEVEDTIKIKTRVVFLD
Ga0307409_10077164633300031995RhizosphereMRKFLLLVVLAALASFSINAQEVEDTIKIKTRVVFLDAL
Ga0310889_1073399913300032179SoilMRRILLLIIIATLASFSINAQEVEETIKIKTRVVFLDALVKDKRTNLP
Ga0310810_1034062643300033412SoilMYRYRLHLLLLVMIVAVAPVSIRAQEVEDTIRIKTRVVFLDALVKDKK
Ga0310810_1137865313300033412SoilMSKYVLLLIVILASFPAKAQEVEETIKIKTRVVFLDALVKDKKTN
Ga0310811_1113730713300033475SoilMSKYRLSFLLLIVLFASFAAKAQEVEDTIKIKTRVVFLDALVKDR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.