| Basic Information | |
|---|---|
| Family ID | F089395 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MYRYRFPLFLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVKDKK |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.17 % |
| % of genes near scaffold ends (potentially truncated) | 98.17 % |
| % of genes from short scaffolds (< 2000 bps) | 91.74 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.083 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere (10.092 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.128 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (67.890 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.26% β-sheet: 0.00% Coil/Unstructured: 44.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF14060 | DUF4252 | 21.10 |
| PF08281 | Sigma70_r4_2 | 4.59 |
| PF02954 | HTH_8 | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.08 % |
| Unclassified | root | N/A | 0.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000953|JGI11615J12901_10746813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300001904|JGI24736J21556_1038095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300003319|soilL2_10019069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6685 | Open in IMG/M |
| 3300003319|soilL2_10139420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2004 | Open in IMG/M |
| 3300004114|Ga0062593_102640278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300004156|Ga0062589_102865348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300004480|Ga0062592_100549280 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300004643|Ga0062591_102596146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300005093|Ga0062594_102630054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300005328|Ga0070676_10654554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300005332|Ga0066388_106443544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300005334|Ga0068869_100355697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1195 | Open in IMG/M |
| 3300005343|Ga0070687_101299044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300005345|Ga0070692_11028349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300005438|Ga0070701_10851506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300005438|Ga0070701_10904013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300005444|Ga0070694_100618881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300005445|Ga0070708_102133267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300005458|Ga0070681_10523534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1099 | Open in IMG/M |
| 3300005543|Ga0070672_102127578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300005545|Ga0070695_101737279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300005546|Ga0070696_101550883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300005547|Ga0070693_101479520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300005563|Ga0068855_100956328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300005577|Ga0068857_100193953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1850 | Open in IMG/M |
| 3300005578|Ga0068854_100167489 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300005618|Ga0068864_101243459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300005841|Ga0068863_100355274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1428 | Open in IMG/M |
| 3300005841|Ga0068863_100546279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1144 | Open in IMG/M |
| 3300005841|Ga0068863_100628680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300005841|Ga0068863_101792509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300005842|Ga0068858_101936502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300005844|Ga0068862_102633637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300006058|Ga0075432_10070502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1255 | Open in IMG/M |
| 3300006169|Ga0082029_1001188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300006791|Ga0066653_10703913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300006846|Ga0075430_101612632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300006904|Ga0075424_101410300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300006904|Ga0075424_101906277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300006918|Ga0079216_10357848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300009011|Ga0105251_10278232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300009147|Ga0114129_10196207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2737 | Open in IMG/M |
| 3300009148|Ga0105243_10752609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
| 3300009148|Ga0105243_11221394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300009156|Ga0111538_11617835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
| 3300009162|Ga0075423_10121892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2734 | Open in IMG/M |
| 3300009174|Ga0105241_10942470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
| 3300009177|Ga0105248_10144384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2685 | Open in IMG/M |
| 3300009789|Ga0126307_10589685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
| 3300009789|Ga0126307_11492430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300010038|Ga0126315_11109991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300010047|Ga0126382_10647745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300010358|Ga0126370_10957888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300010362|Ga0126377_13241821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300010362|Ga0126377_13350710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010400|Ga0134122_12948380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300010401|Ga0134121_10173869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1850 | Open in IMG/M |
| 3300010401|Ga0134121_10821584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300010403|Ga0134123_13551750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300010403|Ga0134123_13626758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300013100|Ga0157373_10751721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300013296|Ga0157374_11484529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300013297|Ga0157378_11382972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300013307|Ga0157372_11216178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300013307|Ga0157372_11255307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300013307|Ga0157372_12666713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300014325|Ga0163163_10225902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1921 | Open in IMG/M |
| 3300014325|Ga0163163_11312144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300014497|Ga0182008_10416371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300014968|Ga0157379_10096791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2649 | Open in IMG/M |
| 3300014969|Ga0157376_10007435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 7822 | Open in IMG/M |
| 3300015374|Ga0132255_100102687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3888 | Open in IMG/M |
| 3300021445|Ga0182009_10226947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300025735|Ga0207713_1066283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1352 | Open in IMG/M |
| 3300025904|Ga0207647_10622315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300025911|Ga0207654_10290984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
| 3300025911|Ga0207654_11257766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300025912|Ga0207707_11114253 | Not Available | 643 | Open in IMG/M |
| 3300025913|Ga0207695_10630860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300025914|Ga0207671_11000034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300025918|Ga0207662_10844273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300025924|Ga0207694_10293922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1336 | Open in IMG/M |
| 3300025935|Ga0207709_11468968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300025935|Ga0207709_11794769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300025937|Ga0207669_11536881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300025941|Ga0207711_10016871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 6064 | Open in IMG/M |
| 3300025942|Ga0207689_10626039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
| 3300025949|Ga0207667_11080074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300025949|Ga0207667_12094711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300025960|Ga0207651_11831673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300025961|Ga0207712_11106249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300025981|Ga0207640_10355120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1179 | Open in IMG/M |
| 3300025981|Ga0207640_11969605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300025986|Ga0207658_11094749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300026075|Ga0207708_10654273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300026078|Ga0207702_11063278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300026078|Ga0207702_12432402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300026095|Ga0207676_10264662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1554 | Open in IMG/M |
| 3300027765|Ga0209073_10126912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300030510|Ga0268243_1133838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300031548|Ga0307408_100304697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1336 | Open in IMG/M |
| 3300031548|Ga0307408_101801580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300031716|Ga0310813_11154833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300031852|Ga0307410_10769621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
| 3300031995|Ga0307409_100771646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300032179|Ga0310889_10733999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300033412|Ga0310810_10340626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1584 | Open in IMG/M |
| 3300033412|Ga0310810_11378653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300033475|Ga0310811_11137307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 10.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.34% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.67% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.83% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Host-Associated | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_107468132 | 3300000953 | Soil | MYRYRFPLLLLFILGTFASLPVNGQEVEDTIKIKTRVVFLDALVK |
| JGI24736J21556_10380951 | 3300001904 | Corn Rhizosphere | MHRTLLLLVILAALASFPVRAQEVEDTIKIKTRVVFLDALVKDK |
| soilL2_100190692 | 3300003319 | Sugarcane Root And Bulk Soil | MYKYRFPLLLLFILATFASLPVNAQEVEDTIKIKTRVVFLDALVKDK |
| soilL2_101394206 | 3300003319 | Sugarcane Root And Bulk Soil | MNRYRFPLLILFILATFASLSIKAQEVEDTIKIKTRVVFLDA |
| Ga0062593_1026402781 | 3300004114 | Soil | MNRYRFPLLLLFILATFASLPAYAQEVEDTIKIKTRVVFLDALVKDK |
| Ga0062589_1028653482 | 3300004156 | Soil | MYRFRLNLLLLFILATFASLPAHAQEVEDTIKIKTRVVFLDALVKDK |
| Ga0062592_1005492801 | 3300004480 | Soil | MYRYRFPLLLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVKDKKTNLPISNL |
| Ga0062591_1025961462 | 3300004643 | Soil | MYRHRFSFVLLAVIALLASVSVHAQEVEDTIRIKTRVVFLDALVKDKK |
| Ga0062594_1026300542 | 3300005093 | Soil | MYRYRFSLLLLFILATFASLSTQAQEVEDTIKIKTRVVFLDA |
| Ga0070676_106545542 | 3300005328 | Miscanthus Rhizosphere | MYRYRFPLFLLFILATFASLPIHAQEVEDTIKIKTRVVFL |
| Ga0066388_1064435441 | 3300005332 | Tropical Forest Soil | MSKYFLLLIVLLASFPAKAQEVEDTIKIKTRVVFLDALVKDKKTNLP |
| Ga0068869_1003556973 | 3300005334 | Miscanthus Rhizosphere | MHRYRFTLLLLFILATFVSLPATAQEVEDTIKIKTRVVFLDALVKDK |
| Ga0070687_1012990441 | 3300005343 | Switchgrass Rhizosphere | MHRILFLLVLLAALASFPVRAQQVEDTIRIKTRVVFLDAL |
| Ga0070692_110283491 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVKDKK |
| Ga0070701_108515062 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRLLILIVLAAVSFISIQAQEVEDTIKIKTRVVFLDALVKDKKT |
| Ga0070701_109040132 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MYRYRFPLFLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVKDK |
| Ga0070694_1006188811 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVKDKKTN |
| Ga0070708_1021332671 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRILFLLFVLAALASFPVRAQEVEDTIKIKTRVVFLDALVK |
| Ga0070681_105235341 | 3300005458 | Corn Rhizosphere | MRKYRFPLLLLFILATFASLPAHGQEVEDTIKIRTRVVFLDALVKDK |
| Ga0070672_1021275782 | 3300005543 | Miscanthus Rhizosphere | MHRILFLLVVLAALASFPVRAQEVEEVIKIKTRVVFLDA |
| Ga0070695_1017372792 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRYRFPLLILFILATFASLSVHAQEVEDTIKIKTRVVFLDALVKDKKT |
| Ga0070696_1015508831 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRFRFLALLIIATLSSFTAHAQEVEDTIKIKTRVVFLDALVKDK |
| Ga0070693_1014795201 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MYRLRWNILLLVVIAALASLPIHAQEVEDTIRIKTRAVFLDALVK |
| Ga0068855_1009563281 | 3300005563 | Corn Rhizosphere | MRRLLLLIVLAAISFVSIHAQEVEDTIKIKTRVVFLDALV |
| Ga0068857_1001939531 | 3300005577 | Corn Rhizosphere | MHRILFLLVVLAALASFPVRAQEVEDTIKIKTRVVFLDAL |
| Ga0068854_1001674891 | 3300005578 | Corn Rhizosphere | MYRYRFPLLLLFILATFASLPAHAQEVEDTIKIKTRVVF |
| Ga0068864_1012434591 | 3300005618 | Switchgrass Rhizosphere | MRRLLILIVLAAISFISVQAQEVEDTIKIKTRVVFLDALVKDKK |
| Ga0068863_1003552744 | 3300005841 | Switchgrass Rhizosphere | MYRHRFPLLLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVKDKK |
| Ga0068863_1005462791 | 3300005841 | Switchgrass Rhizosphere | MSKYRLSFLLLIVLFASFSINAQEVDDTIKIKTRVVFLDALVKDKKTNLPI |
| Ga0068863_1006286803 | 3300005841 | Switchgrass Rhizosphere | MYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVKDKKTNLPISNLTT |
| Ga0068863_1017925091 | 3300005841 | Switchgrass Rhizosphere | MHRILFLLVVLAALASFPVRAQEVEEVIKIKTRVVFLDALVKDKKTS |
| Ga0068858_1019365022 | 3300005842 | Switchgrass Rhizosphere | MHRILLLLVVLAALASFLVRAQEVEDTIKIKTRVVFLDALVKDKKT |
| Ga0068862_1026336372 | 3300005844 | Switchgrass Rhizosphere | MHRILFLLIVLAALASFPVRAQEVEDTIKIKTRVVFLDALVK |
| Ga0075432_100705023 | 3300006058 | Populus Rhizosphere | MRRLLLLIVLAAISFVSIHAQEVEDTIKIKTRVVFLDALVKDKKTSLPISNL |
| Ga0082029_10011882 | 3300006169 | Termite Nest | MRRLLLLIVLAAISFVSIHAQEVEDTIKIKTRVVFLDALVKDKKTNLPIS |
| Ga0066653_107039132 | 3300006791 | Soil | MHRIRWNVLLLVLIATLAATAIRAQEVEDTIRIKTRVVFLDALVKD |
| Ga0075430_1016126322 | 3300006846 | Populus Rhizosphere | MYRLLLLALIAALSFVSINAQEVEDTIKIKTRVVFLDALVKDKKTSLPIS |
| Ga0075424_1014103002 | 3300006904 | Populus Rhizosphere | MFRYRFSLLLLALIAVVAVSVRAQEVEDTIKIKTRVVFLDALVKDKKTNLP |
| Ga0075424_1019062771 | 3300006904 | Populus Rhizosphere | MYRYRLHLLLFVIIAALAPISIRAQEVEDTVRIKTRVVFLDAL |
| Ga0079216_103578483 | 3300006918 | Agricultural Soil | MYRYRLNLLLLVIIATLASVSIHAQVVEDTIRIKTRVVFLDALVKDKKTN |
| Ga0105251_102782323 | 3300009011 | Switchgrass Rhizosphere | MYRYRFLVLVIIATLTSFSARAQEVEDTIKIKTRVVFLDALV |
| Ga0114129_101962076 | 3300009147 | Populus Rhizosphere | MHKHYLRFFLLLVVLVLTVSSVNAQEVEDTIKIKTRVVFLDALVKDKKTN |
| Ga0105243_107526091 | 3300009148 | Miscanthus Rhizosphere | MHRILLLLVVLAALASFLVRAQEVEDTIKIKTRVVFLDALVKDKKTNLPISDLTTANFEV |
| Ga0105243_112213943 | 3300009148 | Miscanthus Rhizosphere | MHKHRFSFLLLFILATFASLSINAQEVEDTIKIKTRVVFLDALV |
| Ga0111538_116178351 | 3300009156 | Populus Rhizosphere | MYRYRFLVLLIIATLTSFSARAQEVEDTIKIKTRVVF |
| Ga0075423_101218921 | 3300009162 | Populus Rhizosphere | MHRILFLLVVLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKKTNLPISELT |
| Ga0105241_109424703 | 3300009174 | Corn Rhizosphere | MRRNILLVVLFANLASFSVNAQEVEDTIKIKTRVVFLDALV |
| Ga0105248_101443845 | 3300009177 | Switchgrass Rhizosphere | MYRIPFLLFVLAALASFPVRAQEVEDTIMIKTRVVFLDALVKDKKTSLPISDLTSA |
| Ga0126307_105896853 | 3300009789 | Serpentine Soil | MYRYRLSLLLLFIFTTLASLSAHAQEVEDTIKIKTRVVFLDA |
| Ga0126307_114924302 | 3300009789 | Serpentine Soil | MYRYRFLLLILFATLACFSTHAQEVEDTIKIKTRVVFLDALV |
| Ga0126315_111099911 | 3300010038 | Serpentine Soil | MHRILFLLVVLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKKTNLPIS |
| Ga0126382_106477451 | 3300010047 | Tropical Forest Soil | MSKSHLSFLLLIVLFASFAINAQEVEDTIKIKTRVVFLDALVKDK |
| Ga0126370_109578881 | 3300010358 | Tropical Forest Soil | MSKYFLLLIVLLSSFPAKAQEVEDTIKIKTRVVFLDALVKDRKTNLQISNLTSENFA |
| Ga0126377_132418211 | 3300010362 | Tropical Forest Soil | MHRILFLLVVLAALASFPVRAQEVEDTIKIKTRVVFL |
| Ga0126377_133507101 | 3300010362 | Tropical Forest Soil | MHRYRFPLLLLFILATFASLPIQAQEVEDTIKIKTRVVFLDALVKDKKTNLPISNLAT |
| Ga0134122_129483802 | 3300010400 | Terrestrial Soil | MNRYRFPLTILFILATFASLSVHAQEVEDTIKIKTRVVFLDALVKDKKTS |
| Ga0134121_101738691 | 3300010401 | Terrestrial Soil | MYKYRFPLFLLFILGTFASLPASISVCAQEVEDTIKIKTRVVFLDALVKDKKTNLPISNL |
| Ga0134121_108215841 | 3300010401 | Terrestrial Soil | MSKYFLLLIVLLASFSAQAQEVEDTIKIKTRVVFLDALVKDKKTS |
| Ga0134123_135517502 | 3300010403 | Terrestrial Soil | MHRILFLLVVLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKKTSLP |
| Ga0134123_136267582 | 3300010403 | Terrestrial Soil | MYRYRFPLFLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVKDKK |
| Ga0157373_107517212 | 3300013100 | Corn Rhizosphere | MYRYRFSLLLLFILASLSVNAQEVEDTIKIKTRVVFLDALVKDKK |
| Ga0157374_114845292 | 3300013296 | Miscanthus Rhizosphere | MFRYRFSLLLLVIVALASVSIRAQEVEDTVRIKTRVVFLDALV |
| Ga0157378_113829722 | 3300013297 | Miscanthus Rhizosphere | MHRILFPLVVLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKKTSLPIS |
| Ga0157372_112161783 | 3300013307 | Corn Rhizosphere | MYRYRLHLSLLAIIAALASVSIRAQEVEDTIRIKTRVVFLDALVKDKK |
| Ga0157372_112553071 | 3300013307 | Corn Rhizosphere | MYRYRFPLFLLFILATFASLPIHAQEVEDTIKIKTRVVF |
| Ga0157372_126667132 | 3300013307 | Corn Rhizosphere | MFRYRFSLLLLALIAIAAISVRAQEVEDTIKIKTRVVFLDALVKDKKT |
| Ga0163163_102259025 | 3300014325 | Switchgrass Rhizosphere | MRRNILLVVLFATLASFSVNAQEVEDTIKIKTRVVFLDALV |
| Ga0163163_113121442 | 3300014325 | Switchgrass Rhizosphere | MYRIVFLLIVLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKKSSLPISDLTS |
| Ga0182008_104163711 | 3300014497 | Rhizosphere | MSNYVLLLIVILASFPAKAQEVEETIKIKTRVVFLDALVKDKKTNL |
| Ga0157379_100967911 | 3300014968 | Switchgrass Rhizosphere | MYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVKD |
| Ga0157376_100074351 | 3300014969 | Miscanthus Rhizosphere | LRLRLNTLLAVIAVALLCVSATAQEVDDTIRIKTRVVFLDA |
| Ga0132255_1001026871 | 3300015374 | Arabidopsis Rhizosphere | MSLLRSLGFIVLVIVVAALSSVTVVAQEVEDTIRIKTRVVFLDALVKDKKTS |
| Ga0182009_102269473 | 3300021445 | Soil | MYKLRWKILLLAVIATLASLPIHAQEVEDTIRIKTRVVFLDALVKDKKTNL |
| Ga0207713_10662834 | 3300025735 | Switchgrass Rhizosphere | MHRYRFNFLLLFILATFASLSAPVCIQAQEVEDTIKIKTRVVFLDAL |
| Ga0207647_106223151 | 3300025904 | Corn Rhizosphere | MHRILFLLVLLAALASFPVRAQQVEDTIRIKTRVVFLDALVKDKKTSLPISDLTSANFE |
| Ga0207654_102909844 | 3300025911 | Corn Rhizosphere | MYRYRFPLFLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVK |
| Ga0207654_112577661 | 3300025911 | Corn Rhizosphere | MHRILFLLIVLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKK |
| Ga0207707_111142533 | 3300025912 | Corn Rhizosphere | MYRYCFRLLLLIVVALASVSIRAQEVEDTIRIKTRVVFLDALVKDKKTN |
| Ga0207695_106308601 | 3300025913 | Corn Rhizosphere | MSKYLLLLIVLLAAFPARAQEIEDTIKIKTRVVFL |
| Ga0207671_110000342 | 3300025914 | Corn Rhizosphere | MYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVKDKKTNLPISNLTPE |
| Ga0207662_108442731 | 3300025918 | Switchgrass Rhizosphere | MHRILFLLVLLAALASFPVRAQEVEDTIKIKTRVVFLDALVKDKKTSLPISDLTSANFEV |
| Ga0207694_102939221 | 3300025924 | Corn Rhizosphere | MHRILLLLVVLAACASFPVRAQEVEDTIKIKTRVVFLDALVKDKKT |
| Ga0207709_114689681 | 3300025935 | Miscanthus Rhizosphere | MYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVKDKKTNLPISNLT |
| Ga0207709_117947691 | 3300025935 | Miscanthus Rhizosphere | MRRLLLLIVLAAISFVSIHAQEVEDTIKIKTRVVFLDALVKDKKTSLPISNLTTE |
| Ga0207669_115368811 | 3300025937 | Miscanthus Rhizosphere | MYRHRFPLFLLFIVATFASLPVPLSTEAQEVEDTIKIQTRVVFLD |
| Ga0207711_100168711 | 3300025941 | Switchgrass Rhizosphere | MYRFRLNLLLLVAIATLASISIHAQEVEDTIRIKTRVVFLDALVKDKRT |
| Ga0207689_106260393 | 3300025942 | Miscanthus Rhizosphere | MHRYRFTLLLLFILATFVSLPATAQEVEDTIKIKTRVVFLDALVKDRKTSLPISNL |
| Ga0207667_110800741 | 3300025949 | Corn Rhizosphere | MRRLLLLIVLAAISFVSIHAQEVEDTIKIKTRVVFLDALVKD |
| Ga0207667_120947112 | 3300025949 | Corn Rhizosphere | MYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALV |
| Ga0207651_118316731 | 3300025960 | Switchgrass Rhizosphere | MNRYRFPLLLLFILATFASLPAYAQEVEDTIKIKTRVVFLDALVKDKKTNLPIS |
| Ga0207712_111062492 | 3300025961 | Switchgrass Rhizosphere | MHRYRLRLLLLFILATFASLSTPLSTKAQEVEDTIKIKTRVVFLDALVKDKKTSLPI |
| Ga0207640_103551201 | 3300025981 | Corn Rhizosphere | MYKYRLTLLFILATFASLSIHAQEVEDTIKIKTRVVFLDALVK |
| Ga0207640_119696051 | 3300025981 | Corn Rhizosphere | MYRHRFPLLLLFILATFASLPIHAQEVEDTIKIKTRVVFLDALVKDKKTNLP |
| Ga0207658_110947491 | 3300025986 | Switchgrass Rhizosphere | MYRYRFSLLLLFILATFASLSTQAQEVEDTIKIKTRVVFLDALVK |
| Ga0207708_106542733 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MHKFRLHLLLLFILALSSLSAHAQEVEDTIKIKTRVVFLDA |
| Ga0207702_110632781 | 3300026078 | Corn Rhizosphere | MNRYRFPLLLLFILATFASLSTPLSTKAQEVEDTIKIKTRVVFLDALVKDRR |
| Ga0207702_124324021 | 3300026078 | Corn Rhizosphere | MKRLLLLIIIAVLACVSIHAQEVEDTIKIKTRVVFLDALVKDKKTN |
| Ga0207676_102646624 | 3300026095 | Switchgrass Rhizosphere | MYKYRFPLLLLFILGTLASLPASISVCAQEVEDTIKIKTRVVFLDALVKDKKTNLPISN |
| Ga0209073_101269123 | 3300027765 | Agricultural Soil | MSKYFLLLVMLFASFPATAQEAEDTIKIKTRVVFLDALVKDRKTN |
| Ga0268243_11338381 | 3300030510 | Soil | MRRKFLLLVIFATLATFSINAQEVDDTIKIKTRVVFLDALVKDKK |
| Ga0307408_1003046973 | 3300031548 | Rhizosphere | MYRYRLPFLLSLIIASLASVSIHAQEVDETIRIKTRVVFL |
| Ga0307408_1018015802 | 3300031548 | Rhizosphere | MCNRMHRRRLSFLVLIVIATFVSVRAQEVEETIRIKTRVVFL |
| Ga0310813_111548332 | 3300031716 | Soil | MSKYRLSFLLLIILLASFAATAQEVDDTIKIKTRVVFL |
| Ga0307410_107696211 | 3300031852 | Rhizosphere | MSKYRLSFLLLIVLLASFSINAQEVEDTIKIKTRVVFLD |
| Ga0307409_1007716463 | 3300031995 | Rhizosphere | MRKFLLLVVLAALASFSINAQEVEDTIKIKTRVVFLDAL |
| Ga0310889_107339991 | 3300032179 | Soil | MRRILLLIIIATLASFSINAQEVEETIKIKTRVVFLDALVKDKRTNLP |
| Ga0310810_103406264 | 3300033412 | Soil | MYRYRLHLLLLVMIVAVAPVSIRAQEVEDTIRIKTRVVFLDALVKDKK |
| Ga0310810_113786531 | 3300033412 | Soil | MSKYVLLLIVILASFPAKAQEVEETIKIKTRVVFLDALVKDKKTN |
| Ga0310811_111373071 | 3300033475 | Soil | MSKYRLSFLLLIVLFASFAAKAQEVEDTIKIKTRVVFLDALVKDR |
| ⦗Top⦘ |