| Basic Information | |
|---|---|
| Family ID | F089362 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 46 residues |
| Representative Sequence | FGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.08 % |
| % of genes from short scaffolds (< 2000 bps) | 91.74 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.330 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.936 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.018 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.128 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.33% β-sheet: 0.00% Coil/Unstructured: 78.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF01906 | YbjQ_1 | 96.33 |
| PF00557 | Peptidase_M24 | 1.83 |
| PF13622 | 4HBT_3 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 96.33 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.25 % |
| Unclassified | root | N/A | 2.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101409095 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300003296|Ga0006840J48914_120940 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300004620|Ga0068957_1007770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1009 | Open in IMG/M |
| 3300004629|Ga0008092_11324596 | Not Available | 865 | Open in IMG/M |
| 3300005338|Ga0068868_101880743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300005364|Ga0070673_101773207 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005444|Ga0070694_100395609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1081 | Open in IMG/M |
| 3300005529|Ga0070741_11247264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
| 3300005566|Ga0066693_10145310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 888 | Open in IMG/M |
| 3300005574|Ga0066694_10616466 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005586|Ga0066691_10215307 | All Organisms → Viruses → Predicted Viral | 1122 | Open in IMG/M |
| 3300006052|Ga0075029_100261484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1095 | Open in IMG/M |
| 3300006172|Ga0075018_10718522 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006579|Ga0074054_12176915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 912 | Open in IMG/M |
| 3300006606|Ga0074062_12965587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1013 | Open in IMG/M |
| 3300006860|Ga0063829_1484514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2132 | Open in IMG/M |
| 3300006904|Ga0075424_100929909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 927 | Open in IMG/M |
| 3300006904|Ga0075424_102099683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
| 3300009090|Ga0099827_11349480 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300009137|Ga0066709_104275873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 521 | Open in IMG/M |
| 3300009683|Ga0116224_10104511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae | 1372 | Open in IMG/M |
| 3300010047|Ga0126382_11254988 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300010358|Ga0126370_11740684 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300010359|Ga0126376_12722267 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300010361|Ga0126378_11698977 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300010861|Ga0126349_1042656 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300010937|Ga0137776_1156190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1489 | Open in IMG/M |
| 3300011060|Ga0138583_1110029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 995 | Open in IMG/M |
| 3300011067|Ga0138594_1019216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1016 | Open in IMG/M |
| 3300011073|Ga0138584_1057802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2011 | Open in IMG/M |
| 3300011076|Ga0138574_1106241 | All Organisms → cellular organisms → Bacteria | 3148 | Open in IMG/M |
| 3300011119|Ga0105246_10707962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 883 | Open in IMG/M |
| 3300011120|Ga0150983_11438970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1003 | Open in IMG/M |
| 3300011120|Ga0150983_12007866 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300012285|Ga0137370_10864885 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012357|Ga0137384_10098476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2440 | Open in IMG/M |
| 3300012357|Ga0137384_10876981 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012361|Ga0137360_11388850 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012362|Ga0137361_11709091 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012489|Ga0157349_1006260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 857 | Open in IMG/M |
| 3300012493|Ga0157355_1001551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila | 1198 | Open in IMG/M |
| 3300012957|Ga0164303_10170652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1174 | Open in IMG/M |
| 3300013104|Ga0157370_12119413 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300015373|Ga0132257_104228053 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300017937|Ga0187809_10417716 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300017966|Ga0187776_11240966 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300018029|Ga0187787_10318250 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300018058|Ga0187766_11029617 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300018062|Ga0187784_10648598 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300020004|Ga0193755_1097180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 934 | Open in IMG/M |
| 3300020078|Ga0206352_10199668 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300020170|Ga0179594_10359663 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300020582|Ga0210395_11296071 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300021361|Ga0213872_10360691 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300021432|Ga0210384_10466083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1137 | Open in IMG/M |
| 3300021433|Ga0210391_10612985 | Not Available | 854 | Open in IMG/M |
| 3300021445|Ga0182009_10681892 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300021478|Ga0210402_10294569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila | 1501 | Open in IMG/M |
| 3300021478|Ga0210402_10990258 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300021479|Ga0210410_11269868 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300022525|Ga0242656_1033789 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300022533|Ga0242662_10191233 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300022709|Ga0222756_1056614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. DvalAA-14 | 598 | Open in IMG/M |
| 3300024279|Ga0247692_1021576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 982 | Open in IMG/M |
| 3300024290|Ga0247667_1025058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1145 | Open in IMG/M |
| 3300024325|Ga0247678_1049107 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300025527|Ga0208714_1062080 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300025907|Ga0207645_10289345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1089 | Open in IMG/M |
| 3300025910|Ga0207684_10051250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila | 3502 | Open in IMG/M |
| 3300025913|Ga0207695_11434975 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300027090|Ga0208604_1000957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2862 | Open in IMG/M |
| 3300027307|Ga0209327_1008146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila | 1268 | Open in IMG/M |
| 3300027401|Ga0208637_1003463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1363 | Open in IMG/M |
| 3300027692|Ga0209530_1034521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila | 1503 | Open in IMG/M |
| 3300027725|Ga0209178_1233869 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300027826|Ga0209060_10019101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3645 | Open in IMG/M |
| 3300027853|Ga0209274_10438838 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300027882|Ga0209590_10364220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 932 | Open in IMG/M |
| 3300027911|Ga0209698_11437420 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300028146|Ga0247682_1025373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1045 | Open in IMG/M |
| 3300028787|Ga0307323_10019199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2327 | Open in IMG/M |
| 3300028787|Ga0307323_10127894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 915 | Open in IMG/M |
| 3300028789|Ga0302232_10151410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1169 | Open in IMG/M |
| 3300028801|Ga0302226_10462735 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300028807|Ga0307305_10093440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila | 1389 | Open in IMG/M |
| 3300028881|Ga0307277_10526927 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300028906|Ga0308309_11773317 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300029636|Ga0222749_10394464 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300029951|Ga0311371_12385753 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300030007|Ga0311338_10885129 | Not Available | 879 | Open in IMG/M |
| 3300030503|Ga0311370_10892547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1008 | Open in IMG/M |
| 3300030529|Ga0210284_1067268 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300030602|Ga0210254_10644648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 988 | Open in IMG/M |
| 3300030617|Ga0311356_10691897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 977 | Open in IMG/M |
| 3300030904|Ga0308198_1006338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila | 1312 | Open in IMG/M |
| 3300031040|Ga0265754_1008641 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300031474|Ga0170818_114818581 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300031572|Ga0318515_10608761 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300031640|Ga0318555_10385414 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300031796|Ga0318576_10431526 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031799|Ga0318565_10545568 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031846|Ga0318512_10700554 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031894|Ga0318522_10047956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila | 1502 | Open in IMG/M |
| 3300032008|Ga0318562_10450589 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300032008|Ga0318562_10641228 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300032054|Ga0318570_10017135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2683 | Open in IMG/M |
| 3300032805|Ga0335078_12443173 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300032828|Ga0335080_11265586 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300032955|Ga0335076_10252753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila | 1656 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.34% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.34% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.83% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.92% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.92% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.92% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003296 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300004620 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006860 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011060 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011067 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011076 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030529 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030602 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1014090952 | 3300002245 | Forest Soil | RFERGEFGVASAEARISMPGTPGHQRYRPGVRGLRDRVARLLDAVSGPTDS* |
| Ga0006840J48914_1209402 | 3300003296 | Peatlands Soil | FGVASADARIPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS* |
| Ga0068957_10077701 | 3300004620 | Peatlands Soil | ERFERGEFGVASADARIPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS* |
| Ga0008092_113245961 | 3300004629 | Tropical Rainforest Soil | VASDQARVPQPGTVGYQRYRPGVRGLKDRVARLLDAVTGPTG* |
| Ga0068868_1018807432 | 3300005338 | Miscanthus Rhizosphere | GEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP* |
| Ga0070673_1017732072 | 3300005364 | Switchgrass Rhizosphere | GEIGAAERFERGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0070694_1003956091 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ERFERGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP* |
| Ga0070741_112472641 | 3300005529 | Surface Soil | GAAENPGGGEFGVASAAGRTPPVEIPAYQRYRSGVRGLRDRVARLLDAVSGPNP* |
| Ga0066693_101453101 | 3300005566 | Soil | PQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPAG* |
| Ga0066694_106164662 | 3300005574 | Soil | DTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG* |
| Ga0066691_102153071 | 3300005586 | Soil | RGEFGVVSADRRMAQSGVAEYPRYRPGVRGLRDRVARLLDVVSGPTP* |
| Ga0075029_1002614842 | 3300006052 | Watersheds | EIGAAERFERGEFGVASADARIPQPGTAGYQRYRPGMRGLRDRVARLLDVVSGPTGS* |
| Ga0075018_107185222 | 3300006172 | Watersheds | IPIPGTPGYQRYRPGVRGLRDRVARLLDAVSGPTDS* |
| Ga0074054_121769152 | 3300006579 | Soil | VPQPGTAGYQRYRPGMRGLRDRVARLLDAVSGPTGLGP* |
| Ga0074062_129655871 | 3300006606 | Soil | AAWIVPQPGTAGYQRYRPGMRGLRDRVARLLDAVSGPTGLGP* |
| Ga0063829_14845144 | 3300006860 | Peatlands Soil | FERGEFGVASADARIPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS* |
| Ga0075424_1009299091 | 3300006904 | Populus Rhizosphere | VASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP* |
| Ga0075424_1020996831 | 3300006904 | Populus Rhizosphere | FGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP* |
| Ga0099827_113494802 | 3300009090 | Vadose Zone Soil | AGYQRYRPGVRGLRDRVARLLDVVSGPTGLGPRQP* |
| Ga0066709_1042758732 | 3300009137 | Grasslands Soil | GAAERFERGERGEFGVASADTRVPQPGMVGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0116224_101045111 | 3300009683 | Peatlands Soil | AERFERGEFGVASADARIPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS* |
| Ga0126382_112549882 | 3300010047 | Tropical Forest Soil | RGEFGVASEQPREPQPGMVGYQRYRPGVRGLRDRVARLLDAVSGPTGLGPP* |
| Ga0126370_117406842 | 3300010358 | Tropical Forest Soil | FERGEFGVAGADARVLQPGMAGYQRYRPGVRGLRDRVARLLDVVSGPTGLGP* |
| Ga0126376_127222672 | 3300010359 | Tropical Forest Soil | SSVGEIGAAERFERGEFGVASADARAPQPGTAGSQRYRPGVRGLRDRVARLLDAVSGPAG |
| Ga0126378_116989772 | 3300010361 | Tropical Forest Soil | VASADARVPQPGTAGSQRYRPGVRGLRDRVARLLDAVSGPTG* |
| Ga0126349_10426562 | 3300010861 | Boreal Forest Soil | GAAERFERGEFGVASADTRVPQPGTAGYQRYRPGMRGLRDRVARLLDAVSGPTGLGP* |
| Ga0137776_11561903 | 3300010937 | Sediment | EFGVASADARVPQPGMAGYQRHRTGMRGLRDRVARLLDAVSGPTG* |
| Ga0138583_11100291 | 3300011060 | Peatlands Soil | IPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS* |
| Ga0138594_10192161 | 3300011067 | Peatlands Soil | RFERGEFGVASADARIPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS* |
| Ga0138584_10578023 | 3300011073 | Peatlands Soil | VGEIGAAERFERGEFGVASADARIPQPGMTGYQRYRPGMRGLRDRVARLLDAVSGPTGS* |
| Ga0138574_11062411 | 3300011076 | Peatlands Soil | GEFGVASADARIPQPGMTRYQRYRPGMRGLRDRVARLLDAVSGPTGS* |
| Ga0105246_107079621 | 3300011119 | Miscanthus Rhizosphere | QPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP* |
| Ga0150983_114389702 | 3300011120 | Forest Soil | DGEFGLASAVGRGPQPGVTGYQRNRRPGVRGLRERVARLLDAVSGPTG* |
| Ga0150983_120078662 | 3300011120 | Forest Soil | ASADSRVPQPGRGGYQRYRPGMRGLRDRVARLLDAVSGPTGLGP* |
| Ga0137370_108648852 | 3300012285 | Vadose Zone Soil | ERFERGEFGVASTDTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG* |
| Ga0137384_100984765 | 3300012357 | Vadose Zone Soil | AAERFERGEFGVASTDTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG* |
| Ga0137384_108769812 | 3300012357 | Vadose Zone Soil | GVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLDP* |
| Ga0137360_113888501 | 3300012361 | Vadose Zone Soil | TDTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG* |
| Ga0137361_117090912 | 3300012362 | Vadose Zone Soil | RVPQPGMVGYPRYRPGVRGLRDRVARLLDVVSGPNG* |
| Ga0157349_10062601 | 3300012489 | Unplanted Soil | ARVPQPGMPGDQRHRTGVRGLRDRVARLLDAVSGPTGLGP* |
| Ga0157355_10015511 | 3300012493 | Unplanted Soil | ERFERGEFGVASADTRMPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPIGLGP* |
| Ga0164303_101706521 | 3300012957 | Soil | VGEIGAAERFERGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDVVSGPTG* |
| Ga0157370_121194132 | 3300013104 | Corn Rhizosphere | PQPGMVGHQRYRPGVRGLRDRVARLLDAVSGPTGLGS* |
| Ga0132257_1042280532 | 3300015373 | Arabidopsis Rhizosphere | VPQPGMPGDQRHRTGVRGLRDRVARLLDAVSGPTGLGP* |
| Ga0187809_104177161 | 3300017937 | Freshwater Sediment | VGEIGAAERFERGEFGVASADARILQPGMIGYQRYRPGVRGLRDRVARLLDVVSGPTGS |
| Ga0187776_112409662 | 3300017966 | Tropical Peatland | RFERGEFGVASADARMPQPGMVGQQRYRPGMRGLRDRVARLLDAVSGPTGSGP |
| Ga0187787_103182502 | 3300018029 | Tropical Peatland | GEFGVASDQARVPQPGLVGYQRYRPGVRGLKDRVARLLDVVSGPTA |
| Ga0187766_110296171 | 3300018058 | Tropical Peatland | ARGPQPGMPGQQRYRPGVRGLRDRVARLLDAVSGPTG |
| Ga0187784_106485981 | 3300018062 | Tropical Peatland | GRDAEFGVASADSRARRPGTSGYRRYRPGVRGLKDRVARLLDVVSGPNS |
| Ga0193755_10971801 | 3300020004 | Soil | GVASADTRVPQPGTAGYQRYRPGMRGLRDRVARLLDAVSGPTGLGP |
| Ga0206352_101996681 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | RGEFGVASTDARVPQPGMAGYQRYRPGMRGLRDRVARLLDVVSGPAG |
| Ga0179594_103596631 | 3300020170 | Vadose Zone Soil | VASADTRVPQPGMVGYQRYRPGVRGLRDRVARLLDAVSGPTGLGL |
| Ga0210395_112960712 | 3300020582 | Soil | RFERGEFGVASAEARISMPGTPGHQRYRPGVRGLRDRVARLLDAVSGPTDS |
| Ga0213872_103606911 | 3300021361 | Rhizosphere | ASADARAARAGTTGHRRYRPGVRGLRDRLARLLDTVSGPAGQG |
| Ga0210384_104660831 | 3300021432 | Soil | FGVASADTRVPQPGTVGYQRYRPGVRGLRDRVARLLDVVSGPAG |
| Ga0210391_106129852 | 3300021433 | Soil | RGEFGVASAARQAATGTPAYQRYRPGVRGLRDRVARLLDVVSGPVP |
| Ga0182009_106818921 | 3300021445 | Soil | AETRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0210402_102945693 | 3300021478 | Soil | GEFGVASAEARISMPGTPGYQRYRPGVRGLRDRVARLLDAVSGPTDS |
| Ga0210402_109902582 | 3300021478 | Soil | TRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG |
| Ga0210410_112698682 | 3300021479 | Soil | GEIGAAERFERGEFGVASTDTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG |
| Ga0242656_10337892 | 3300022525 | Soil | EFGVASADSRVPQPGRVGYQRYRPGMRGLRDRVARLLDAVSGPAA |
| Ga0242662_101912332 | 3300022533 | Soil | DTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG |
| Ga0222756_10566142 | 3300022709 | Soil | GVASTDTRVPQPGMVGYQRYRPGMRGLRDRVARLLDVVSGPNG |
| Ga0247692_10215761 | 3300024279 | Soil | AAERFERGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDVVSGPTGLGP |
| Ga0247667_10250581 | 3300024290 | Soil | RGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0247678_10491072 | 3300024325 | Soil | PQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0208714_10620802 | 3300025527 | Arctic Peat Soil | EFGVASADARTPHPRVAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0207645_102893451 | 3300025907 | Miscanthus Rhizosphere | EIGAAERFERGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0207684_100512501 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RYERREFGVASADTRVPQPGTVGYQRYRPGVRGLRDRVARLLDVVSGPTG |
| Ga0207695_114349751 | 3300025913 | Corn Rhizosphere | TRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0208604_10009575 | 3300027090 | Forest Soil | GGERRGAEEEFGVASPDSRVERPGTPGYQRYRPGVRGLRDRVAHLLDVVSGPNP |
| Ga0209327_10081463 | 3300027307 | Forest Soil | QPGTPGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0208637_10034633 | 3300027401 | Soil | GAAERFERGEFGVASADTRVPQPGTAGYQRYRPGMRGLRDRVARLLDAVSGPTGLGP |
| Ga0209530_10345213 | 3300027692 | Forest Soil | DRPEGFGNAEFGVASAYGRTPPPGSQGYQRYRPGVRGLRDRVARLLDTVSGPNP |
| Ga0209178_12338691 | 3300027725 | Agricultural Soil | VASTDARVPQPGMVGYQRYRPGVRGLRDRVARLLDAVSGPNG |
| Ga0209060_100191011 | 3300027826 | Surface Soil | DGPRRDQEFGVAAGRVPPPADYQRHRTGVRSLRDRVARLLDAVSGPSA |
| Ga0209274_104388382 | 3300027853 | Soil | LDRNEEFGVASGDGRVERLGTTGYQRYRPGVRGLRDRVAHLLDVVSGPPS |
| Ga0209590_103642201 | 3300027882 | Vadose Zone Soil | AGYQRYRPGVRGLRDRVARLLDVVSGPTGLGPRQP |
| Ga0209698_114374202 | 3300027911 | Watersheds | VPQPGMAGYQRYRPGVRGLRDRVARLLDAVSGPTGLDP |
| Ga0247682_10253732 | 3300028146 | Soil | VGEIGAAERFERGEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLG |
| Ga0307323_100191994 | 3300028787 | Soil | GEFGVASADTRVPQPGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0307323_101278942 | 3300028787 | Soil | VASADTRVPQPGMVGHQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0302232_101514101 | 3300028789 | Palsa | SGDSVSRHQGMPGYQRYRPGVRGLRDRVARLLDAVSGPTA |
| Ga0302226_104627352 | 3300028801 | Palsa | GPQPGVPGYQRYRRPGVRGLRERVARLLDAVSGPTG |
| Ga0307305_100934401 | 3300028807 | Soil | PGTAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0307277_105269271 | 3300028881 | Soil | FERGEFGVASADTRVPQPGMVGHQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0308309_117733172 | 3300028906 | Soil | LGRDGEFGVASADGRAGRERTQPGTPGYQRYRPGVRGLKDRVAHLLDVVSGPSA |
| Ga0222749_103944642 | 3300029636 | Soil | FERGEFGVASADSRVPQPGRVGYQRYRPGMRGLRDRVARLLDAVSGPTGLAP |
| Ga0311371_123857532 | 3300029951 | Palsa | ASGDGVIRHPGMPGYQRYRPGVRGLRDRVARLLDAVSGPTA |
| Ga0311338_108851292 | 3300030007 | Palsa | DGVIRHPGMPGYQRYRPGVRGLRDRVARLLDAVSGPTA |
| Ga0311370_108925472 | 3300030503 | Palsa | EFGVASGDGVIRHQGMPGYQRYRPGVRGLRDRVARLLDAVSGPTA |
| Ga0210284_10672682 | 3300030529 | Soil | FERGEFGVASADARVPQPGRAGYQRYRPGVRGLRDRVARLLDAVSGPTGLDP |
| Ga0210254_106446481 | 3300030602 | Soil | GEFGLASAVGRGPQPGVTGYQRNRRPGVRGLRERVARLLDAVSGPSG |
| Ga0311356_106918971 | 3300030617 | Palsa | GVASGDSVSRHQGMPGYQRYRPGVRGLRDRVARLLDAVSGPTA |
| Ga0308198_10063381 | 3300030904 | Soil | PGMVGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0265754_10086411 | 3300031040 | Soil | RVPQPGMAGYQRYRPGVRGLRDRVARLLDAVSGPTGLGP |
| Ga0170818_1148185811 | 3300031474 | Forest Soil | ERGDFGVASTDARVPQPGMVGYHRYRPGVRGLRDRVARLLDVVSGPTGLGP |
| Ga0318515_106087611 | 3300031572 | Soil | TDARVPQPGTAGYPRNRTGVRGLRDRVARLLDAVSGPAG |
| Ga0318555_103854141 | 3300031640 | Soil | ASTDARMPQPGTAGSPHNRTGVRGLRDRVARLLDAVSGPAG |
| Ga0318576_104315261 | 3300031796 | Soil | FERGEFGVASADARVPQPGTTGYQRRRTGVRGLRDRVARLLDAVSGPAGLGS |
| Ga0318565_105455682 | 3300031799 | Soil | ELGEFGVASADARAAQPGTPGHQRYRPGVRGLRDRVARLLDVVSGPTGSLPGPEDLRS |
| Ga0318512_107005541 | 3300031846 | Soil | ASADARVPQPGAAGYQRYRSGVRGLRDRVARLLDAVSGPAG |
| Ga0318522_100479561 | 3300031894 | Soil | ASADARVPQPGTAGYQRHRSGMRGLRDRVARLLDAVSGPAGLGS |
| Ga0318562_104505892 | 3300032008 | Soil | ARVPQPGTTGYQRRRTGVRGLRDRVARLLDAVSGPAGLGS |
| Ga0318562_106412282 | 3300032008 | Soil | VASADARVPQPGAVGYQRYRSGVRGLRDRVARLLDAVSGPAG |
| Ga0318570_100171355 | 3300032054 | Soil | FERGEFGVASADARVPQPGAAGSQRYRPGVRGLRDRVARLLDAVSGPTG |
| Ga0335078_124431732 | 3300032805 | Soil | LGEFGVASPDARAPQTGTPGYQRYRPGVRGLRDRVARLLDAVSGPTGS |
| Ga0335080_112655862 | 3300032828 | Soil | GEFGVASADTRVPQPGTVGYQRYRTGVRGLRDRVARLLDAVSGPAG |
| Ga0335076_102527533 | 3300032955 | Soil | ARVPQPGMPGDQRHRTGVRGLRDRVARLLDAVSGPAGLGP |
| ⦗Top⦘ |