| Basic Information | |
|---|---|
| Family ID | F089349 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GVVTLSNEEHHVEEALQKVLAEADRILGPTLVSHAVDLL |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.349 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.440 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.624 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF02033 | RBFA | 73.39 |
| PF01509 | TruB_N | 10.09 |
| PF16198 | TruB_C_2 | 8.26 |
| PF00263 | Secretin | 2.75 |
| PF13517 | FG-GAP_3 | 2.75 |
| PF17195 | DUF5132 | 0.92 |
| PF01757 | Acyl_transf_3 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0858 | Ribosome-binding factor RbfA | Translation, ribosomal structure and biogenesis [J] | 73.39 |
| COG0130 | tRNA U55 pseudouridine synthase TruB, may also work on U342 of tmRNA | Translation, ribosomal structure and biogenesis [J] | 10.09 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.92% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000731 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026868 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 32 (SPAdes) | Environmental | Open in IMG/M |
| 3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027095 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF020 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_01353680 | 2199352024 | Soil | GVVTLSNDEGHVEESLQHVLAEADSMLGPLLVSHAVEII |
| JGI12381J11899_10142732 | 3300000731 | Tropical Forest Soil | SNEDRHVEESLQKVLAEADRILGPLIVSHSVDLL* |
| JGI12269J14319_101685813 | 3300001356 | Peatlands Soil | GVVTLSNEEQHVEEVLQKVLAEADRILGPLVVGHAVEIL* |
| Ga0062386_1000975414 | 3300004152 | Bog Forest Soil | GVVTLANEEHHVEESLQKVLTEADKILGPVLTGYTVDLL* |
| Ga0062386_1017617092 | 3300004152 | Bog Forest Soil | GVVTLANEEHHVEESLQKVLAEADRLLGPLLTGHSVDLL* |
| Ga0066869_100263481 | 3300005165 | Soil | EDTWQRSVIGVVTLANEEQLVEESLQNVLAEADCELGPVLIGHSVDLL* |
| Ga0066673_104589663 | 3300005175 | Soil | STVGIVTLSNAEQHVEESLQHVLAEAQRILGRTLVDHSVDFL* |
| Ga0070709_111196982 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GVVTLANEEHHVEESLQKVLAEADRILGPLLTGHSVDLL* |
| Ga0070707_1012360081 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | IGIVTLSNAEQHVEESLQHVLREAERILGPILVDHSVDFL* |
| Ga0070730_100909313 | 3300005537 | Surface Soil | DVWQSSTIGIVTLSNAEQHVEESLQSVLREAQRILGPILVDHSVDIL* |
| Ga0070733_109203382 | 3300005541 | Surface Soil | IGVVTLSNEEHHVEEALQKVLAEADNILGPMVVSHAVEIL* |
| Ga0066654_103778181 | 3300005587 | Soil | IGVVTLSTAEQHVEESLQLVLNEANRILGPVLVSHVVEMI* |
| Ga0066903_1080720281 | 3300005764 | Tropical Forest Soil | VTLANEGVHVEESLQHVLAEADRLLGPLLIGHQIEVM* |
| Ga0075023_1005677251 | 3300006041 | Watersheds | WQRSVVGVVTLSNEEHHVEEALQKVLAEADRILGPVLIAHAVDFL* |
| Ga0075024_1003423923 | 3300006047 | Watersheds | QDVWQRSIIGVVTLSTAEQHVEESLQSVLREADRLLGPVLVNHVVEMI* |
| Ga0075019_109999992 | 3300006086 | Watersheds | RSVVGIVTLSNEQQHVEESLQKVLAEADRILGPVLIGHAVEMI* |
| Ga0070716_1002591601 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SNAEQHVEESLQNVLAEAQRLLGPILTDHSVDFL* |
| Ga0066710_1010608873 | 3300009012 | Grasslands Soil | WQRSVVGIVTLSNEESHVEESLQHVLAEADRVLGPVLISHTVEIL |
| Ga0099830_116555151 | 3300009088 | Vadose Zone Soil | GVVTLSNEEHHVEEALQEVLAEADRILGPMGVGHSVELL* |
| Ga0066709_1046348242 | 3300009137 | Grasslands Soil | WQRSVVGIVTLSNEESHVEESLQHVLAEADRVLGPVLISHTVEIL* |
| Ga0126380_114417081 | 3300010043 | Tropical Forest Soil | SGASQHVEESLQHVLAEAQRILGPVLVDHSVDLL* |
| Ga0126379_127858481 | 3300010366 | Tropical Forest Soil | VVGVVTLSNEERHVEDSLQKVLAEADRILGPMLVSHAVDLL* |
| Ga0126381_1004971081 | 3300010376 | Tropical Forest Soil | EDTWQRSVVGVVTLSNEDHHVEEALQKILAEADRILGPLVVSHSVELL* |
| Ga0126381_1031163981 | 3300010376 | Tropical Forest Soil | WQRSVVGVVTLANEEHHVEEALQKVLAEADRILGPLLTGHSVDLL* |
| Ga0126345_11431172 | 3300010858 | Boreal Forest Soil | VTLSTAEQHVEESLQMVLKEADRLLGPVLVDHVVEMI* |
| Ga0124850_10673781 | 3300010863 | Tropical Forest Soil | SVVGVVTLANEEHHVEESLQKVLAEADRILGPLLTGHSVDLL* |
| Ga0137391_100810044 | 3300011270 | Vadose Zone Soil | STAEQHVEESLQLVLREADRLLGPILVNHVVEMI* |
| Ga0137391_101651954 | 3300011270 | Vadose Zone Soil | LEYQDVWQRSIIGVVTLSTAEQHVEESLQLVLREADRLLGPVLVSHVVEMI* |
| Ga0137362_102643201 | 3300012205 | Vadose Zone Soil | DVWQSSTIGIVTLSNAEQHVEESLQHVLREAERLLGPILVDHSVDFL* |
| Ga0137397_104088841 | 3300012685 | Vadose Zone Soil | MEYQDVWSRSIIGVVTLSTAEQHVEESLQSVLREADRLLGPVLVNHVVEMI* |
| Ga0137413_113023661 | 3300012924 | Vadose Zone Soil | SVIGVVTLANEEHHVEESLQKVLAEADIILGPMVVGHSVELL* |
| Ga0137416_121021902 | 3300012927 | Vadose Zone Soil | IIGVVTLSTAEQHVEESLQLVLREADRLLGPVLVNHVVEMI* |
| Ga0137404_100791371 | 3300012929 | Vadose Zone Soil | VVTLSNEEHHVEEALQKVLAEADRILGPMVVSHAVEIL* |
| Ga0137404_103658421 | 3300012929 | Vadose Zone Soil | IVTLSNAEQHVEESLQHVLAEAHRILGPVLIDHSVDFL* |
| Ga0137404_105670823 | 3300012929 | Vadose Zone Soil | SSTIGIVTLSNAEQHVEESLQHVLREAERILGPILVDHSVDFL* |
| Ga0137410_110800322 | 3300012944 | Vadose Zone Soil | VVTLSNAEQHVEESLQHVLREAERILGPILVDHSVDFL* |
| Ga0137403_101733805 | 3300015264 | Vadose Zone Soil | IVTLSNAERHVEESLQHVLREAERILGPILVDHSVDFL* |
| Ga0182036_111059621 | 3300016270 | Soil | VVGVVTLANEEHHVEESLQKVLEEADKILGPLLTGHSVDLL |
| Ga0182033_100206391 | 3300016319 | Soil | VVTLSNEERHVEEMLQKILAEADRILGPALISHAVDLL |
| Ga0182034_119394522 | 3300016371 | Soil | SVVGVVTLSNEDRHVEESLQKVLAEADRILGPLLVSQSVDLL |
| Ga0182040_119626671 | 3300016387 | Soil | TWKSSVIGVVTLANEDHHVEETLQRVLAEADNLLGPLVVSHSVELL |
| Ga0187819_106875201 | 3300017943 | Freshwater Sediment | RSVGGVVTLSNEEQHVEEALQKVLAEADRILGPVLISHAVDLL |
| Ga0187817_107044192 | 3300017955 | Freshwater Sediment | GVVTLSNEEQHVEEVLQKVLAEADRQLGPLVVGHSVDIL |
| Ga0187886_10807191 | 3300018018 | Peatland | VVGVVTVSNEEQHVEEALQKVLAEADRILGPLVVGHAVEIL |
| Ga0187874_100231364 | 3300018019 | Peatland | VVTLSNEESHVEESLQHILAEADRLLGPVLIGHQFEIL |
| Ga0187867_106384802 | 3300018033 | Peatland | VGVVTLSNEEQHVEEVLQKVLAEADRQLGPLVVGHEVEIL |
| Ga0187784_103715621 | 3300018062 | Tropical Peatland | TWQRSVVGVVTLSNEEKHVEEALQKVLAEADRMLGPLVVGHALEIL |
| Ga0187772_107071173 | 3300018085 | Tropical Peatland | TLSNEERHVEEVLQKVLAEADRQLGPLVVSHSVEIL |
| Ga0066669_103240361 | 3300018482 | Grasslands Soil | IGVVTLSTAEQHVEESLQLVLNEANRILGPVLVSHVVEMI |
| Ga0179590_10169623 | 3300020140 | Vadose Zone Soil | VWQSSTIGIVTLSNAEQHVEESLQHVLREAERILGPILIDHSTDFL |
| Ga0210407_109605491 | 3300020579 | Soil | QDVWSRSIIGVVTLSTAEQHVEESLQSVLREADRLLGPVLVNHVVEMI |
| Ga0210399_102127013 | 3300020581 | Soil | DTWQRSVVGVVTLSNEERHVEEALQKVLAEADRILGPMVVSHAVEIL |
| Ga0215015_101230501 | 3300021046 | Soil | RDRVTLSTAEQHVEESLQLVLREADRLLGPVLVSHVVEMI |
| Ga0210384_116203482 | 3300021432 | Soil | YQDVWQRSIIGVVTLSTAEQHVEESLQLVLREADRLLGPVLVNHVVEMI |
| Ga0210409_100124737 | 3300021559 | Soil | EDTWQRSVVGVVTLSNEEHQVQESLQHVLAEADNILGPLLVSHGVEII |
| Ga0247679_10333703 | 3300024251 | Soil | VVTLSNEERHVKEVLQKVLAEADGLLGSMVVGNAVEII |
| Ga0208562_10140521 | 3300025460 | Peatland | VTVSNEEQHVEEALQKVLAEADRILGPLVVGHAVEIL |
| Ga0207646_114495092 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IGIVTLSNAEQHVEESLQHVLREAERILGPILVDHSVDFL |
| Ga0257160_10077823 | 3300026489 | Soil | VTLSNAEQHVEESLQHVLREAERLLGPILIDHSVDFL |
| Ga0207818_10247022 | 3300026868 | Tropical Forest Soil | SVIGVVTLSNEDRHVEESLQKVLAEADRILGPLIVSHSVDLL |
| Ga0207758_10023831 | 3300026895 | Tropical Forest Soil | TLSNEEHHVEEALQKVLAEADRILGPTLVNHAVDLL |
| Ga0208860_10331881 | 3300027076 | Forest Soil | VTLSNEEHQVQESLQHVLAEADNILGPLLVSHGVEII |
| Ga0208606_1050271 | 3300027095 | Forest Soil | SVVGVVTLSNEERHVEEALQKVLAEADRILGPMVVSHAVEIL |
| Ga0207777_10353543 | 3300027330 | Tropical Forest Soil | GVATLANEEQLVEESLQNVLAEAVRELGPVLIGHSVDLL |
| Ga0209331_10112551 | 3300027603 | Forest Soil | VTLSTAEQHVEESLQLVLKEADRLLGPVLVNHVVEMI |
| Ga0208981_10597693 | 3300027669 | Forest Soil | MEYQDVWSRSIIGVVTLSTAEQHVEESLQSVLREADRLLGPVLVNHVVEMI |
| Ga0209248_102412641 | 3300027729 | Bog Forest Soil | SVVGVVTLSNAEQHVEESLQLVLAEAYKILGPLLVSHDVELL |
| Ga0209166_102755083 | 3300027857 | Surface Soil | DVWQSSTIGIVTLSNAEQHVEESLQSVLREAQRILGPILVDHSVDIL |
| Ga0209579_103656882 | 3300027869 | Surface Soil | HDVWQSSTIGVVTLSNAEQHVEESLQHVLAEAQRILGPVLVDHSVDLL |
| Ga0247684_10510932 | 3300028138 | Soil | LSNEERHVKEVLQKVLAEADGLLGSMVVGNAVEII |
| Ga0137415_105702523 | 3300028536 | Vadose Zone Soil | SVVGVVTLSNEEQHVEESLQKILAEAERILGPVLISHAVEMI |
| Ga0137415_114061842 | 3300028536 | Vadose Zone Soil | IIGVVTLSTAEQHVEESLQLVLREADRLLGPVLVNHVVEMI |
| Ga0075405_111675171 | 3300030847 | Soil | DFEDTWQRSVVGVVTLANEEDHVEESLQKVLAEADKILGPLLTGHSVDLL |
| Ga0170834_1137449621 | 3300031057 | Forest Soil | TWQRSVVGVVTLANEEHHVEESLQKVLAEADKILGPLLTRHSVDLL |
| Ga0170823_132631991 | 3300031128 | Forest Soil | STIGVVTLSNAEQHVEESLQHVLREAERILGPILIDHSTDFL |
| Ga0170824_1143046363 | 3300031231 | Forest Soil | LSNEEHQVQESLQHVLAEADNILGPLLVSHGVEII |
| Ga0170820_130845822 | 3300031446 | Forest Soil | VGVVTLSNEEHQVQESLQHVLAEADNILGPLLVSHGVEIM |
| Ga0311364_116409961 | 3300031521 | Fen | SVVGVVTLANEEQLVEESLQKVLAEADRELGPVLIAHSVDLL |
| Ga0307483_10285401 | 3300031590 | Hardwood Forest Soil | GVVTLSTAEQHVEESLQLVLREADRLLGPVLVNHVVEMI |
| Ga0318574_102507822 | 3300031680 | Soil | VWQSATVGVVTLSAASQHVEESLQHVLAEAQRILGPVLVDHSVDLL |
| Ga0318560_101569693 | 3300031682 | Soil | ATVGVVTLSAASQHVEESLQHVLAEAQRILGPVLVDHSVDLL |
| Ga0318560_104328342 | 3300031682 | Soil | LWQRSVVGVVTLSNEEQHVEEALQKVLAEADRILGPTLVSHAVDLL |
| Ga0310686_1067015343 | 3300031708 | Soil | WKSSVVGVVTLSNAEQHLEQSLQLVLAEAYKILGPLLVSHDVEFL |
| Ga0306918_111039492 | 3300031744 | Soil | QSSVVGVVTLSNAEQHVEQSLQLVLAEAYKILGPLLVSHDVELL |
| Ga0307477_100845121 | 3300031753 | Hardwood Forest Soil | MEYQDVWQRSIIGVVTLSTAEQHVEESLQLVLREADRLLGPVLINHVVEMI |
| Ga0307475_100329211 | 3300031754 | Hardwood Forest Soil | IVTLSNAEQHVEESLQHVLREAERLLGPILVDHSVDFL |
| Ga0307475_106730831 | 3300031754 | Hardwood Forest Soil | LSTAEQHVEESLQLVLKEADRLLGPVLVNHVVEMI |
| Ga0307475_113949682 | 3300031754 | Hardwood Forest Soil | LSTAEQHVEESLQLVLREADRLLGPVLINHVVEMI |
| Ga0318526_104074511 | 3300031769 | Soil | LSNEEHHVEEALQKVLAEADRILGPTLVSHAVDLL |
| Ga0318543_100983473 | 3300031777 | Soil | DFQDVWQSATVGVVTLSAASQHVEESLQHVLAEAQRILGPVLVDHSVDLL |
| Ga0318543_102107633 | 3300031777 | Soil | SVVGVVTLSNEEHHVEEALQKVLAEADRILGPTLVSHAVDLL |
| Ga0318523_100567251 | 3300031798 | Soil | VGVVTLSNEEHHVEEALQKVLAEADRILGPTLVSHAVDLL |
| Ga0310917_106045922 | 3300031833 | Soil | QRSVVGVVTLSNEEHHVEEALQKVLAEADRILGPTLVSHAVDLL |
| Ga0306919_100246555 | 3300031879 | Soil | DVWQRSVVGVVTLSNEEHHVEEALQKVLAEADRILGPTLVSHAVDLL |
| Ga0306925_100170408 | 3300031890 | Soil | SVVGVVTLSNEERHVEDSLQKVLAEADRILGPMLVSHAVDLL |
| Ga0318551_109220001 | 3300031896 | Soil | QEVWSRAIIGVVTLSTAEQHVEESLQLVLEDASRQLGRMLVGHVVEMI |
| Ga0306921_113800203 | 3300031912 | Soil | AELEYQEVWSRAIIGVVTLSTAEQHVEESLQLVLEDASRQLGRMLVGHVVEMI |
| Ga0306921_127759012 | 3300031912 | Soil | TLANEDRHVEETLQRVLAEADNLLGPLVVNHSVELL |
| Ga0306926_100339531 | 3300031954 | Soil | GVVTLSNAEQHVEQSLQLVLAEAYKILGPLLVSHDVELL |
| Ga0306926_110205133 | 3300031954 | Soil | RSVVGVVTLSNEEHHVEEALQKVLAEADRILGPTLVSHAVDLL |
| Ga0307479_107472211 | 3300031962 | Hardwood Forest Soil | TLSTAEQHVEESLESVLREADRLLGPVLVNHVVEMI |
| Ga0318559_105033951 | 3300032039 | Soil | RSVVGVVTLSNEERHVEDSLQKVLAEADRILGPMLVSHAVDLL |
| Ga0318545_102404242 | 3300032042 | Soil | VVGIVTLSNEEHHVEEALQKVLAEADRILGPTLVNHAVDLL |
| Ga0311301_109009773 | 3300032160 | Peatlands Soil | VVTLSNEEQHVEESLQKVLAEADKILGPLLISHEVDFL |
| Ga0307470_100188291 | 3300032174 | Hardwood Forest Soil | SVVGVVTLSNEEHHVEEALQKVLAEADRILGPMVVSHAVEIL |
| Ga0307470_108961451 | 3300032174 | Hardwood Forest Soil | WKSSTVGIGPISNAEQHVEESLQHVLAEAQRILGPVLVDHSVDFL |
| Ga0307472_1025407262 | 3300032205 | Hardwood Forest Soil | TLSNAEQHVEESLQHVLAEAQRILGPVLVDHSVDFL |
| Ga0335079_122745311 | 3300032783 | Soil | VTLANEEHHVEESLQKVLAEADKILGPLLTGHSVDLL |
| Ga0310914_103024421 | 3300033289 | Soil | GVVTLSNEEHHVEEALQKVLAEADRILGPTLVSHAVDLL |
| ⦗Top⦘ |