| Basic Information | |
|---|---|
| Family ID | F089331 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSELRMLSLAAAIAALVAYYSIQFYRFAVEPARAHTTERAR |
| Number of Associated Samples | 58 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.40 % |
| % of genes near scaffold ends (potentially truncated) | 23.85 % |
| % of genes from short scaffolds (< 2000 bps) | 91.74 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.881 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (35.780 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.725 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (80.734 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 90.24% β-sheet: 0.00% Coil/Unstructured: 9.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 3.67 |
| PF04392 | ABC_sub_bind | 2.75 |
| PF00891 | Methyltransf_2 | 0.92 |
| PF01555 | N6_N4_Mtase | 0.92 |
| PF11494 | Ta0938 | 0.92 |
| PF13767 | DUF4168 | 0.92 |
| PF03733 | YccF | 0.92 |
| PF00848 | Ring_hydroxyl_A | 0.92 |
| PF00816 | Histone_HNS | 0.92 |
| PF07366 | SnoaL | 0.92 |
| PF12161 | HsdM_N | 0.92 |
| PF03734 | YkuD | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.75 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.83 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.92 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.92 |
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.92 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG3304 | Uncharacterized membrane protein YccF, DUF307 family | Function unknown [S] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.88 % |
| All Organisms | root | All Organisms | 43.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17321191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2341 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1035138 | Not Available | 781 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1029441 | Not Available | 1016 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10043119 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10084461 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300000956|JGI10216J12902_109972975 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300004268|Ga0066398_10004109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Aliiroseovarius → unclassified Aliiroseovarius → Aliiroseovarius sp. S1123 | 1721 | Open in IMG/M |
| 3300005332|Ga0066388_100176298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2742 | Open in IMG/M |
| 3300005332|Ga0066388_100444150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium meliloti | 1939 | Open in IMG/M |
| 3300005332|Ga0066388_100968474 | Not Available | 1419 | Open in IMG/M |
| 3300005332|Ga0066388_101096608 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1347 | Open in IMG/M |
| 3300005332|Ga0066388_101666287 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300005332|Ga0066388_101704021 | Not Available | 1115 | Open in IMG/M |
| 3300005332|Ga0066388_102294152 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300005332|Ga0066388_102935219 | Not Available | 871 | Open in IMG/M |
| 3300005332|Ga0066388_103822423 | Not Available | 768 | Open in IMG/M |
| 3300005332|Ga0066388_105712888 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005332|Ga0066388_106538458 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005332|Ga0066388_108199427 | Not Available | 521 | Open in IMG/M |
| 3300005332|Ga0066388_108461863 | Not Available | 512 | Open in IMG/M |
| 3300005363|Ga0008090_10260994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1438 | Open in IMG/M |
| 3300005363|Ga0008090_15470914 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005363|Ga0008090_15882249 | Not Available | 634 | Open in IMG/M |
| 3300005366|Ga0070659_101532191 | Not Available | 594 | Open in IMG/M |
| 3300005435|Ga0070714_100873192 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300005436|Ga0070713_100307951 | Not Available | 1460 | Open in IMG/M |
| 3300005437|Ga0070710_10175718 | Not Available | 1337 | Open in IMG/M |
| 3300005445|Ga0070708_100786016 | Not Available | 895 | Open in IMG/M |
| 3300005713|Ga0066905_100494613 | Not Available | 1015 | Open in IMG/M |
| 3300005713|Ga0066905_100507161 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300005713|Ga0066905_100721912 | Not Available | 857 | Open in IMG/M |
| 3300005713|Ga0066905_101528948 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005713|Ga0066905_102170524 | Not Available | 517 | Open in IMG/M |
| 3300005764|Ga0066903_100016278 | All Organisms → cellular organisms → Bacteria | 7606 | Open in IMG/M |
| 3300005764|Ga0066903_100302297 | All Organisms → cellular organisms → Bacteria | 2533 | Open in IMG/M |
| 3300005764|Ga0066903_100450055 | Not Available | 2151 | Open in IMG/M |
| 3300005764|Ga0066903_101210201 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300005764|Ga0066903_101377775 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300005764|Ga0066903_102471843 | Not Available | 1005 | Open in IMG/M |
| 3300005764|Ga0066903_103143824 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300005764|Ga0066903_103143910 | Not Available | 893 | Open in IMG/M |
| 3300005764|Ga0066903_103515524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 844 | Open in IMG/M |
| 3300005764|Ga0066903_103582464 | Not Available | 836 | Open in IMG/M |
| 3300005764|Ga0066903_103911443 | Not Available | 800 | Open in IMG/M |
| 3300005764|Ga0066903_104344461 | Not Available | 757 | Open in IMG/M |
| 3300005764|Ga0066903_104682135 | Not Available | 728 | Open in IMG/M |
| 3300005764|Ga0066903_105133659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300005764|Ga0066903_105274557 | Not Available | 683 | Open in IMG/M |
| 3300005764|Ga0066903_107974757 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005764|Ga0066903_108605993 | Not Available | 519 | Open in IMG/M |
| 3300005764|Ga0066903_108746209 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005764|Ga0066903_108747392 | Not Available | 514 | Open in IMG/M |
| 3300005937|Ga0081455_10921206 | Not Available | 543 | Open in IMG/M |
| 3300006173|Ga0070716_100781220 | Not Available | 737 | Open in IMG/M |
| 3300006175|Ga0070712_101651667 | Not Available | 561 | Open in IMG/M |
| 3300006804|Ga0079221_11176647 | Not Available | 593 | Open in IMG/M |
| 3300006904|Ga0075424_102688133 | Not Available | 520 | Open in IMG/M |
| 3300009137|Ga0066709_102437965 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300009792|Ga0126374_10727255 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300010043|Ga0126380_10078227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1904 | Open in IMG/M |
| 3300010043|Ga0126380_10648709 | Not Available | 840 | Open in IMG/M |
| 3300010043|Ga0126380_11957938 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300010043|Ga0126380_11982573 | Not Available | 532 | Open in IMG/M |
| 3300010046|Ga0126384_10969424 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300010047|Ga0126382_10545172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 943 | Open in IMG/M |
| 3300010047|Ga0126382_11305198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300010047|Ga0126382_12106373 | Not Available | 540 | Open in IMG/M |
| 3300010048|Ga0126373_12102500 | Not Available | 626 | Open in IMG/M |
| 3300010358|Ga0126370_10052637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2596 | Open in IMG/M |
| 3300010358|Ga0126370_10581153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 963 | Open in IMG/M |
| 3300010358|Ga0126370_11548817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300010359|Ga0126376_12192288 | Not Available | 597 | Open in IMG/M |
| 3300010361|Ga0126378_11293641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium WD3A24 | 824 | Open in IMG/M |
| 3300010362|Ga0126377_11682086 | Not Available | 709 | Open in IMG/M |
| 3300010366|Ga0126379_10145230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2201 | Open in IMG/M |
| 3300010366|Ga0126379_13074680 | Not Available | 558 | Open in IMG/M |
| 3300010376|Ga0126381_101742822 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300010398|Ga0126383_11134278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 871 | Open in IMG/M |
| 3300010398|Ga0126383_11611009 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300010398|Ga0126383_12989143 | Not Available | 552 | Open in IMG/M |
| 3300012361|Ga0137360_10701393 | Not Available | 869 | Open in IMG/M |
| 3300012948|Ga0126375_10634100 | Not Available | 822 | Open in IMG/M |
| 3300012957|Ga0164303_10637672 | Not Available | 708 | Open in IMG/M |
| 3300012971|Ga0126369_10990682 | Not Available | 928 | Open in IMG/M |
| 3300012971|Ga0126369_11260638 | Not Available | 829 | Open in IMG/M |
| 3300012986|Ga0164304_10321431 | Not Available | 1069 | Open in IMG/M |
| 3300013297|Ga0157378_12400496 | Not Available | 579 | Open in IMG/M |
| 3300013306|Ga0163162_10823599 | Not Available | 1044 | Open in IMG/M |
| 3300015374|Ga0132255_101116655 | Not Available | 1185 | Open in IMG/M |
| 3300016404|Ga0182037_12159062 | Not Available | 501 | Open in IMG/M |
| 3300017792|Ga0163161_11573636 | Not Available | 579 | Open in IMG/M |
| 3300021560|Ga0126371_10878219 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300021560|Ga0126371_11226975 | Not Available | 885 | Open in IMG/M |
| 3300021560|Ga0126371_13459688 | Not Available | 533 | Open in IMG/M |
| 3300021560|Ga0126371_13623449 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300025922|Ga0207646_11330993 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300026551|Ga0209648_10509345 | Not Available | 692 | Open in IMG/M |
| 3300027874|Ga0209465_10030325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2544 | Open in IMG/M |
| 3300031719|Ga0306917_10925559 | Not Available | 682 | Open in IMG/M |
| 3300031744|Ga0306918_11432258 | Not Available | 529 | Open in IMG/M |
| 3300031747|Ga0318502_10284959 | Not Available | 969 | Open in IMG/M |
| 3300031770|Ga0318521_10586328 | Not Available | 674 | Open in IMG/M |
| 3300031781|Ga0318547_10426416 | Not Available | 816 | Open in IMG/M |
| 3300031845|Ga0318511_10536923 | Not Available | 543 | Open in IMG/M |
| 3300031879|Ga0306919_10372908 | Not Available | 1092 | Open in IMG/M |
| 3300031912|Ga0306921_10046673 | All Organisms → cellular organisms → Bacteria | 4907 | Open in IMG/M |
| 3300031954|Ga0306926_11381539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 818 | Open in IMG/M |
| 3300032035|Ga0310911_10360054 | Not Available | 840 | Open in IMG/M |
| 3300032174|Ga0307470_10141213 | Not Available | 1457 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 35.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 26.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.67% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03595850 | 2088090014 | Soil | ELRMLSLAAAIAALVSYYSIQVYRVAVEPARAHTTERAR |
| AF_2010_repII_A01DRAFT_10351382 | 3300000580 | Forest Soil | MTELRMXSLAAVIAALVAYYSIQFYRFAVEPARAHTTERAR* |
| AF_2010_repII_A100DRAFT_10294412 | 3300000655 | Forest Soil | MTELRMFSLAAVIAALVAYYSIQFYRFAVEPARAHTTERAR* |
| AF_2010_repII_A001DRAFT_100431192 | 3300000793 | Forest Soil | MSKLRMLSLAAAIVALVAYYSIQFYPLAVEPARAHTTERAR* |
| AF_2010_repII_A001DRAFT_100844612 | 3300000793 | Forest Soil | RQAPSSRVHRGPAMSELRMLSLAGVIAALVAYYSIQFYRLAVEPAQAHTTERAR* |
| JGI10216J12902_1099729753 | 3300000956 | Soil | MSELRMLLLAAAIAALVSYYSVQFYRFAVEPARAHTVERVR* |
| Ga0066398_100041091 | 3300004268 | Tropical Forest Soil | MTKLRMLSLAAAIVALVSYYSVQFYRVAVEPTRVHTTEHAR* |
| Ga0066388_1001762985 | 3300005332 | Tropical Forest Soil | MTELRMLSLAAAIAALVGYYSIQFYRFAVEPARAHTTERTR* |
| Ga0066388_1004441503 | 3300005332 | Tropical Forest Soil | MTELRMLSLAAAIAALVAYYSIQVYRFVVEPARAHTTERAR* |
| Ga0066388_1009684743 | 3300005332 | Tropical Forest Soil | MSELRMLSLAAAIAALVSYYSIQVYRLAIEPARAHTAERVR* |
| Ga0066388_1010966084 | 3300005332 | Tropical Forest Soil | MSELRMLSLAAAIAALVSYYSIQAYRLAVEPARAHTAERVR* |
| Ga0066388_1016662872 | 3300005332 | Tropical Forest Soil | MSELRMLSLAAAIAALVSYYSIQFYRVAVEPARAHTTERAR* |
| Ga0066388_1017040212 | 3300005332 | Tropical Forest Soil | MSELRMLSLATAIAALVSYYSIQFYRLAVEPARAHTVERVR* |
| Ga0066388_1022941523 | 3300005332 | Tropical Forest Soil | MSELRMLSLAAAIAALVAYYSIQFSRFAVEPAQVHTTERGR* |
| Ga0066388_1029352191 | 3300005332 | Tropical Forest Soil | VYRRPTMSELRMLSLAATTAALVAYYSIQVYRFAVESARAHTTERAR* |
| Ga0066388_1038224232 | 3300005332 | Tropical Forest Soil | MSELRMLSLAAAIAALVSYYSIQVYRFAVEPAGAHTMERAR* |
| Ga0066388_1057128882 | 3300005332 | Tropical Forest Soil | MSELRMLSLAAAIAALVAYYSIQFYHLAVEPARAHTTERAR* |
| Ga0066388_1065384582 | 3300005332 | Tropical Forest Soil | MTELWMLSLAAAIVALVSYYSVQFYRVAVEPTRAHTTERAR* |
| Ga0066388_1081994271 | 3300005332 | Tropical Forest Soil | MSELRMLSLAAAIAALVSYYSIQVYRLAVEPARAHTAERVR* |
| Ga0066388_1084618633 | 3300005332 | Tropical Forest Soil | MSQLRMFSLAGVIAALVAYYSIQFYRLAVEPAQAHTTERAR* |
| Ga0008090_102609943 | 3300005363 | Tropical Rainforest Soil | MTELRMLSLAAVIAALVAYYSIQFYRFAVEPARAHTTERAR* |
| Ga0008090_154709141 | 3300005363 | Tropical Rainforest Soil | MSKLRMLSLAAAIVALVAYYSIQFYHLAVEPARAHTTERAR* |
| Ga0008090_158822492 | 3300005363 | Tropical Rainforest Soil | MSELRMLSLAAAIVALVAYYSIQFYRLAVEPARVHITERAR* |
| Ga0070659_1015321912 | 3300005366 | Corn Rhizosphere | MSELRMLSLAAAIAALVSYYSIQVYRVAVEPARADTTERAR* |
| Ga0070714_1008731921 | 3300005435 | Agricultural Soil | SRVHRRPAMSELRMLSLAAAIAALVSYYSIQVYHVAVEPARAHTTERAR* |
| Ga0070713_1003079513 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSELRMLSLAAAIAALVSYYSIQVYRVAVEPARAHTTERAR* |
| Ga0070710_101757182 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSELRMLSLAAAIAALVSYYSIQVYHVAVEPARAHTTERAR* |
| Ga0070708_1007860163 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSELRMLSLAAAIAALVAYYSIQVYRFAVEPAQTHTTQRAP* |
| Ga0066905_1004946133 | 3300005713 | Tropical Forest Soil | MSELQMLSLAAAIAALVAYYSIQFYRFAVEPVQAHATERAR* |
| Ga0066905_1005071613 | 3300005713 | Tropical Forest Soil | MSELRMLSLAAAIAALVAYYSIQVYHFAVEPARAHTTERAR* |
| Ga0066905_1007219123 | 3300005713 | Tropical Forest Soil | MTKLRMLSLAAAIVALVSYYSVQFYRVAVEPTRAHTTERAR* |
| Ga0066905_1015289482 | 3300005713 | Tropical Forest Soil | MSELRMLSLAAAIAALVAYYSIQFYRFAVEPAQAHTTERAR* |
| Ga0066905_1021705243 | 3300005713 | Tropical Forest Soil | PAMSELRMLSLAAAIAALVAYYSIQFYRFAVKPAQVHTTERAQ* |
| Ga0066903_1000162785 | 3300005764 | Tropical Forest Soil | MSELRMLSLAAAIVVLVAYYSIQFYHLAVEPARAHTTESAR* |
| Ga0066903_1003022973 | 3300005764 | Tropical Forest Soil | MTELRMLSLAAVIAALVGYYSIQFYRFAVEPARAHTTERTR* |
| Ga0066903_1004500553 | 3300005764 | Tropical Forest Soil | MSELRMLSLAGVIAALIAYYSIQFYRLAVEPAQAHTTERAR* |
| Ga0066903_1012102011 | 3300005764 | Tropical Forest Soil | SRVHRRPAMTELRMLSLAAVIAALVAYYSIQFYRFAVEPARAHTTERAR* |
| Ga0066903_1013777753 | 3300005764 | Tropical Forest Soil | MSDLRMLWLAAVIVALVSYYSIQVYRLAVEPARAHTTEGAG* |
| Ga0066903_1024718433 | 3300005764 | Tropical Forest Soil | MSELRMLSLAAAIASLVAYYSIQFYRFAVEPVQTHTT |
| Ga0066903_1031438243 | 3300005764 | Tropical Forest Soil | MTELRMLSLAAVIAALVAYYSIQFYRFAVEPARAHTTERTR* |
| Ga0066903_1031439102 | 3300005764 | Tropical Forest Soil | MHELRMLSLAAAIAALVAYYSIQFYRFAVEPARAHTTERAR* |
| Ga0066903_1035155241 | 3300005764 | Tropical Forest Soil | MSELRMLSLAAVIAALVGYYSIQFYRFAVEPARAHTTERAQ* |
| Ga0066903_1035824643 | 3300005764 | Tropical Forest Soil | MTELRMLSLAAAIVALVAYYSIQFYHLAVEPARAHTTERGR* |
| Ga0066903_1039114432 | 3300005764 | Tropical Forest Soil | MTELRMLSLAAAIAALVAYYSIQFYRFAVEPARAHTTERAR* |
| Ga0066903_1043444612 | 3300005764 | Tropical Forest Soil | MSELRMLSLAAAIAALVSYYSIQVYRLAVEPARAHAAERVR* |
| Ga0066903_1046821351 | 3300005764 | Tropical Forest Soil | MSELRMLSLAAAIAALFAYYSIQVYRFAVEPAQTHTTERAR* |
| Ga0066903_1051336591 | 3300005764 | Tropical Forest Soil | MSELRMLSLAAAIAALVAYYSIQFYRFAVEPARAHTTERTR* |
| Ga0066903_1052745572 | 3300005764 | Tropical Forest Soil | MSELRMLSLVAAIAALVAYYSIQFYRFAIDPAPAHATERAP* |
| Ga0066903_1079747571 | 3300005764 | Tropical Forest Soil | MSELRMLSLAAAIAALVSYYSIQFYRLAVEPVRVHTTERAR* |
| Ga0066903_1086059931 | 3300005764 | Tropical Forest Soil | MSELRMFSLAAMIAALVGYYSIQFYRFAVEPARAHTTERTR* |
| Ga0066903_1087462092 | 3300005764 | Tropical Forest Soil | MSMLSLAAAIVALVAYYSIQFYHLAVEPARAHTMERAR* |
| Ga0066903_1087473922 | 3300005764 | Tropical Forest Soil | MSELRMLSLAAVIAALVGYYSIQFYRCAVEPARAHTTERAR* |
| Ga0081455_109212063 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSELRMLSLAAAIAALVAYYSIQFYRFAVEPARAHTTERAR* |
| Ga0070716_1007812202 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSELRMLSLAAAIAALVAYYSIQVYRVAVEPARAHTTERAR* |
| Ga0070712_1016516672 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSELRMLSLAAAIAALVSYYSIQFYRVAVEPTRAHTTERAR* |
| Ga0079221_111766472 | 3300006804 | Agricultural Soil | MTELRMLLLAAAIAALVGYYSIQFYRFAVEPARAHTTERTR* |
| Ga0075424_1026881332 | 3300006904 | Populus Rhizosphere | MSELRMLSLAAAIAALVSYYSIQGYRVAVEPARAHTT |
| Ga0066709_1024379652 | 3300009137 | Grasslands Soil | MSELRMLSLAAAIAALVSYYSIQVYRFAVEPARAHTTERAR* |
| Ga0126374_107272552 | 3300009792 | Tropical Forest Soil | MSMLSLAAAIVALVAYYSIQFYHLAVEPARAHTTERAR* |
| Ga0126380_100782273 | 3300010043 | Tropical Forest Soil | MSELRMLSLAAAIAALVAYYSIQFYHLAVEPARAHATEHGR* |
| Ga0126380_106487092 | 3300010043 | Tropical Forest Soil | MSELRILSLAAAIAALVSYYSIQVYRFAVEPARAHTTERAR* |
| Ga0126380_119579382 | 3300010043 | Tropical Forest Soil | MSELRMLSLAAAIAALVSYYSIQVYRFAVEPAGAHTTERGR* |
| Ga0126380_119825731 | 3300010043 | Tropical Forest Soil | MSELRMLSLAAVIAALVAYYSIQFYRFAVEPARAQTTERAR* |
| Ga0126384_109694242 | 3300010046 | Tropical Forest Soil | MSELRMLSLAAAIAALVAYYSIHFYRFAVEPVQAHATERGR* |
| Ga0126382_105451723 | 3300010047 | Tropical Forest Soil | MTELWMLSLAAAIVALVSYYSVQFYRVTVEPTRAHTTERAR* |
| Ga0126382_113051982 | 3300010047 | Tropical Forest Soil | MSELRMLSLAAAIAALVAYYSIQFYRLAVEPAQAHTTERAR* |
| Ga0126382_121063732 | 3300010047 | Tropical Forest Soil | AMSKLRMLSLAAAIVALVAYYSIQFYHLAVEPARAHTTERAR* |
| Ga0126373_121025001 | 3300010048 | Tropical Forest Soil | MSELRMLSLAAAIAALVAYYSIQFYRFAVEPAQVHTTERAR* |
| Ga0126370_100526371 | 3300010358 | Tropical Forest Soil | MSELRMLSLAAAIAALVAYYRFAVEPAQVHTTERAQ* |
| Ga0126370_105811532 | 3300010358 | Tropical Forest Soil | MTELRMLSLAAVIAALVAYYSIQLYRFAVEPAWAHTTERAR* |
| Ga0126370_115488171 | 3300010358 | Tropical Forest Soil | LRMLSLAAAIAALVGYYSIQFYRFAVEPARAHTTERTR* |
| Ga0126376_121922883 | 3300010359 | Tropical Forest Soil | MTELRMLSLAAAIAALVAYYSIQFYHLAVEPARAHATEHGR* |
| Ga0126378_112936412 | 3300010361 | Tropical Forest Soil | HRRPAMTELRMLSLAAAIAALVAYYSIQVYRFVVEPARAHTTERAR* |
| Ga0126377_116820862 | 3300010362 | Tropical Forest Soil | MSELRMLATAIAALVSYYSIQVYRFAVELAGAHTMERAR* |
| Ga0126379_101452304 | 3300010366 | Tropical Forest Soil | MTELRMLSLAAAIVALVSYYSVQFYRVAVEPTRAHTTERAR* |
| Ga0126379_130746801 | 3300010366 | Tropical Forest Soil | AMSELRMLSLAAAIAALVAYYSIQFYRFAVEPAQVHTTERAR* |
| Ga0126381_1017428222 | 3300010376 | Tropical Forest Soil | RPAMTELRMLSLAAVIAALVGYYSIQFYRFAVEPARAHTTERTR* |
| Ga0126383_111342783 | 3300010398 | Tropical Forest Soil | MSELRMLSLAAAIAALVSYYSIQVYRFAVEPARSHTTERAR* |
| Ga0126383_116110092 | 3300010398 | Tropical Forest Soil | MSELRMLLLAAAIVALVAYYSIQFYRLAVEPARVHTTERAR* |
| Ga0126383_129891432 | 3300010398 | Tropical Forest Soil | MSELRMLSLAAVIAALVGYYSIQFYRFAVEPARAHTTERTR* |
| Ga0137360_107013932 | 3300012361 | Vadose Zone Soil | MSELRMLSLAAAIAALVSYYSIQVYRVAVEPARAHTTERPR* |
| Ga0126375_106341001 | 3300012948 | Tropical Forest Soil | SELRMLSLAAAIAALFSYYSIQVYRLAVEPARAHTTERAR* |
| Ga0164303_106376721 | 3300012957 | Soil | KAREAPSSRVHRKPAMSELRMLSLAAAIAALVSYYSIQVYSVAVEPARAHTTERAR* |
| Ga0126369_109906823 | 3300012971 | Tropical Forest Soil | MSELRMLSLAGVIAAFVAYYSIQFYRLAVEPAQAHTTERA |
| Ga0126369_112606382 | 3300012971 | Tropical Forest Soil | MSELRMLWLAAAIAALVAYYSIQVYRLAVEPARAHTTER |
| Ga0164304_103214313 | 3300012986 | Soil | MSELRMLSLAAAIAALVSYYSIQVYHVAVEPARAHTTERPR* |
| Ga0157378_124004962 | 3300013297 | Miscanthus Rhizosphere | MSELRMLSLAAAIAALVSYYSIQVYRVDVEPARADTTERAR* |
| Ga0163162_108235992 | 3300013306 | Switchgrass Rhizosphere | MSELRMLSLAAAIVALVAYYSIQVYRVAVEPARAHTTERAR* |
| Ga0132255_1011166554 | 3300015374 | Arabidopsis Rhizosphere | MSELRMLSLATAIAALVSYYSIQVYRLAVEAARAHTTERAR* |
| Ga0182037_121590622 | 3300016404 | Soil | MSELRMLSLAAAIAALVAYYSIQFYRFAVEPARAH |
| Ga0163161_115736361 | 3300017792 | Switchgrass Rhizosphere | MSELRMLSLAAAIAALVSYYSIQVYRVAVEPARAHTTERAR |
| Ga0126371_108782192 | 3300021560 | Tropical Forest Soil | MSDLRMLWLAAVIVALVSYYSIQVYRLAVEPARAHTTGGAG |
| Ga0126371_112269753 | 3300021560 | Tropical Forest Soil | MTELRMLSLAAAIVALVSYYSVQFYRVAVEPTRAHTTERGT |
| Ga0126371_134596882 | 3300021560 | Tropical Forest Soil | MSELRMLSLAAAIAALVSYYSIQVYRLAVEPARAHTAERVR |
| Ga0126371_136234492 | 3300021560 | Tropical Forest Soil | MTELRMLSLAAAIVALVAYYSIQFYHLAVEPARAHTTERAR |
| Ga0207646_113309932 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSELRMLSLAAAIAALVSYYSIQVYRFAVEPARAHTTERAR |
| Ga0209648_105093452 | 3300026551 | Grasslands Soil | MSELRMLSLAAAIAALVAYYSIQFYRFAVEPVQAHATGRAR |
| Ga0209465_100303252 | 3300027874 | Tropical Forest Soil | MTELRMLSLAAAIAALVAYYSIQFYRFAVEPARAHTTERAR |
| Ga0306917_109255591 | 3300031719 | Soil | MSELRMLSLAAAFAALVAYYSIHFYRFAVEPVQTHTTERAR |
| Ga0306918_114322583 | 3300031744 | Soil | MSELRMLSLAAAIAALVAYYSIQFYCFAVEPARAHTTERAR |
| Ga0318502_102849593 | 3300031747 | Soil | MSELRMLSLAGVIAALVAYYSIQFYRLAVEPAQAHTTERA |
| Ga0318521_105863282 | 3300031770 | Soil | MSELRMLSLAAAIAALVSYYSIQVYRFAVEPARAHTTE |
| Ga0318547_104264161 | 3300031781 | Soil | AMSKLRMLSLAGVIAALVAYYSIQFYRLAVEPAQAHTTERAR |
| Ga0318511_105369232 | 3300031845 | Soil | MSKLRMLSLAGVIAALVAYYSIQFYRLAVEPAQAHTTERAR |
| Ga0306919_103729081 | 3300031879 | Soil | MIELRMLSLAAAIVALVSYYSIQVYRLAVEPAQAHTTERAQ |
| Ga0306921_100466738 | 3300031912 | Soil | MSELRMLSLAGVIAALVAYYSIQFYRLAVEPAQAHTTERAR |
| Ga0306926_113815392 | 3300031954 | Soil | MSELRMLSLAAAIAALVAYYSIHFYRFAVEPVQTHTTERAR |
| Ga0310911_103600541 | 3300032035 | Soil | LRMLSLAAAIAALVSYYSIQVYRFAVEPARAHTTERAR |
| Ga0307470_101412134 | 3300032174 | Hardwood Forest Soil | MSELRMLSLAAAIAALVSYYSIQVYRVAVEPARAHTTERPR |
| ⦗Top⦘ |