Metagenome / Metatranscriptome Family F089331

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F089331
Family Type	Metagenome / Metatranscriptome
Number of Sequences	109
Average Sequence Length	41 residues
Representative Sequence	MSELRMLSLAAAIAALVAYYSIQFYRFAVEPARAHTTERAR
Number of Associated Samples	58
Number of Associated Scaffolds	109

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	84.40 %
% of genes near scaffold ends (potentially truncated)	23.85 %
% of genes from short scaffolds (< 2000 bps)	91.74 %
Associated GOLD sequencing projects	58
AlphaFold2 3D model prediction	No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (56.881 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (35.780 % of family members)
Environment Ontology (ENVO)	Unclassified (69.725 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (80.734 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 90.24% β-sheet: 0.00% Coil/Unstructured: 9.76%
Feature Viewer

Powered by Feature Viewer

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 109 Family Scaffolds
PF00072	Response_reg	3.67
PF04392	ABC_sub_bind	2.75
PF00891	Methyltransf_2	0.92
PF01555	N6_N4_Mtase	0.92
PF11494	Ta0938	0.92
PF13767	DUF4168	0.92
PF03733	YccF	0.92
PF00848	Ring_hydroxyl_A	0.92
PF00816	Histone_HNS	0.92
PF07366	SnoaL	0.92
PF12161	HsdM_N	0.92
PF03734	YkuD	0.92

COG ID	Name	Functional Category	% Frequency in 109 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	2.75
COG4638	Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit	Inorganic ion transport and metabolism [P]	1.83
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.92
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.92
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.92
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.92
COG2916	DNA-binding protein H-NS	Transcription [K]	0.92
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.92
COG3304	Uncharacterized membrane protein YccF, DUF307 family	Function unknown [S]	0.92

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.88 %
All Organisms	root	All Organisms	43.12 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.88 %
cellular organisms	root	All Organisms → cellular organisms	43.12 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.88 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	43.12 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.88 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	15.60 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.92 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.88 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	14.68 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.92 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.88 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	5.50 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	1.83 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1.83 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	0.92 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.88 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.59 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	1.83 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.92 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.92 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.92 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.92 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.88 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.59 %
Aliiroseovarius	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Aliiroseovarius	0.92 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.92 %
Sinorhizobium/Ensifer group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group	0.92 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.92 %
unclassified Rhodobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae	0.92 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.92 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.88 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.59 %
unclassified Aliiroseovarius	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Aliiroseovarius → unclassified Aliiroseovarius	0.92 %
Rhodobacteraceae bacterium WD3A24	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium WD3A24	0.92 %
unclassified Mesorhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium	0.92 %
Sinorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium	0.92 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.92 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.92 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.88 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.59 %
Aliiroseovarius sp. S1123	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Aliiroseovarius → unclassified Aliiroseovarius → Aliiroseovarius sp. S1123	0.92 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.92 %
Sinorhizobium meliloti	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium meliloti	0.92 %
Rhodobacteraceae bacterium WD3A24	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium WD3A24	0.92 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.92 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.92 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.92 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090014\|GPIPI_17321191	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2341	Open in IMG/M
3300000580\|AF_2010_repII_A01DRAFT_1035138	Not Available	781	Open in IMG/M
3300000655\|AF_2010_repII_A100DRAFT_1029441	Not Available	1016	Open in IMG/M
3300000793\|AF_2010_repII_A001DRAFT_10043119	All Organisms → cellular organisms → Bacteria	1025	Open in IMG/M
3300000793\|AF_2010_repII_A001DRAFT_10084461	All Organisms → cellular organisms → Bacteria	676	Open in IMG/M
3300000956\|JGI10216J12902_109972975	All Organisms → cellular organisms → Bacteria	900	Open in IMG/M
3300004268\|Ga0066398_10004109	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Aliiroseovarius → unclassified Aliiroseovarius → Aliiroseovarius sp. S1123	1721	Open in IMG/M
3300005332\|Ga0066388_100176298	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2742	Open in IMG/M
3300005332\|Ga0066388_100444150	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium meliloti	1939	Open in IMG/M
3300005332\|Ga0066388_100968474	Not Available	1419	Open in IMG/M
3300005332\|Ga0066388_101096608	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1347	Open in IMG/M
3300005332\|Ga0066388_101666287	All Organisms → cellular organisms → Bacteria	1126	Open in IMG/M
3300005332\|Ga0066388_101704021	Not Available	1115	Open in IMG/M
3300005332\|Ga0066388_102294152	All Organisms → cellular organisms → Bacteria	976	Open in IMG/M
3300005332\|Ga0066388_102935219	Not Available	871	Open in IMG/M
3300005332\|Ga0066388_103822423	Not Available	768	Open in IMG/M
3300005332\|Ga0066388_105712888	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300005332\|Ga0066388_106538458	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300005332\|Ga0066388_108199427	Not Available	521	Open in IMG/M
3300005332\|Ga0066388_108461863	Not Available	512	Open in IMG/M
3300005363\|Ga0008090_10260994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1438	Open in IMG/M
3300005363\|Ga0008090_15470914	All Organisms → cellular organisms → Bacteria	534	Open in IMG/M
3300005363\|Ga0008090_15882249	Not Available	634	Open in IMG/M
3300005366\|Ga0070659_101532191	Not Available	594	Open in IMG/M
3300005435\|Ga0070714_100873192	All Organisms → cellular organisms → Bacteria	873	Open in IMG/M
3300005436\|Ga0070713_100307951	Not Available	1460	Open in IMG/M
3300005437\|Ga0070710_10175718	Not Available	1337	Open in IMG/M
3300005445\|Ga0070708_100786016	Not Available	895	Open in IMG/M
3300005713\|Ga0066905_100494613	Not Available	1015	Open in IMG/M
3300005713\|Ga0066905_100507161	All Organisms → cellular organisms → Bacteria	1004	Open in IMG/M
3300005713\|Ga0066905_100721912	Not Available	857	Open in IMG/M
3300005713\|Ga0066905_101528948	All Organisms → cellular organisms → Bacteria	608	Open in IMG/M
3300005713\|Ga0066905_102170524	Not Available	517	Open in IMG/M
3300005764\|Ga0066903_100016278	All Organisms → cellular organisms → Bacteria	7606	Open in IMG/M
3300005764\|Ga0066903_100302297	All Organisms → cellular organisms → Bacteria	2533	Open in IMG/M
3300005764\|Ga0066903_100450055	Not Available	2151	Open in IMG/M
3300005764\|Ga0066903_101210201	All Organisms → cellular organisms → Bacteria	1403	Open in IMG/M
3300005764\|Ga0066903_101377775	All Organisms → cellular organisms → Bacteria	1323	Open in IMG/M
3300005764\|Ga0066903_102471843	Not Available	1005	Open in IMG/M
3300005764\|Ga0066903_103143824	All Organisms → cellular organisms → Bacteria	893	Open in IMG/M
3300005764\|Ga0066903_103143910	Not Available	893	Open in IMG/M
3300005764\|Ga0066903_103515524	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	844	Open in IMG/M
3300005764\|Ga0066903_103582464	Not Available	836	Open in IMG/M
3300005764\|Ga0066903_103911443	Not Available	800	Open in IMG/M
3300005764\|Ga0066903_104344461	Not Available	757	Open in IMG/M
3300005764\|Ga0066903_104682135	Not Available	728	Open in IMG/M
3300005764\|Ga0066903_105133659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	693	Open in IMG/M
3300005764\|Ga0066903_105274557	Not Available	683	Open in IMG/M
3300005764\|Ga0066903_107974757	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300005764\|Ga0066903_108605993	Not Available	519	Open in IMG/M
3300005764\|Ga0066903_108746209	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300005764\|Ga0066903_108747392	Not Available	514	Open in IMG/M
3300005937\|Ga0081455_10921206	Not Available	543	Open in IMG/M
3300006173\|Ga0070716_100781220	Not Available	737	Open in IMG/M
3300006175\|Ga0070712_101651667	Not Available	561	Open in IMG/M
3300006804\|Ga0079221_11176647	Not Available	593	Open in IMG/M
3300006904\|Ga0075424_102688133	Not Available	520	Open in IMG/M
3300009137\|Ga0066709_102437965	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300009792\|Ga0126374_10727255	All Organisms → cellular organisms → Bacteria	749	Open in IMG/M
3300010043\|Ga0126380_10078227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1904	Open in IMG/M
3300010043\|Ga0126380_10648709	Not Available	840	Open in IMG/M
3300010043\|Ga0126380_11957938	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300010043\|Ga0126380_11982573	Not Available	532	Open in IMG/M
3300010046\|Ga0126384_10969424	All Organisms → cellular organisms → Bacteria	772	Open in IMG/M
3300010047\|Ga0126382_10545172	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	943	Open in IMG/M
3300010047\|Ga0126382_11305198	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	656	Open in IMG/M
3300010047\|Ga0126382_12106373	Not Available	540	Open in IMG/M
3300010048\|Ga0126373_12102500	Not Available	626	Open in IMG/M
3300010358\|Ga0126370_10052637	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2596	Open in IMG/M
3300010358\|Ga0126370_10581153	All Organisms → cellular organisms → Bacteria → Proteobacteria	963	Open in IMG/M
3300010358\|Ga0126370_11548817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	632	Open in IMG/M
3300010359\|Ga0126376_12192288	Not Available	597	Open in IMG/M
3300010361\|Ga0126378_11293641	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium WD3A24	824	Open in IMG/M
3300010362\|Ga0126377_11682086	Not Available	709	Open in IMG/M
3300010366\|Ga0126379_10145230	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2201	Open in IMG/M
3300010366\|Ga0126379_13074680	Not Available	558	Open in IMG/M
3300010376\|Ga0126381_101742822	All Organisms → cellular organisms → Bacteria	900	Open in IMG/M
3300010398\|Ga0126383_11134278	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	871	Open in IMG/M
3300010398\|Ga0126383_11611009	All Organisms → cellular organisms → Bacteria	738	Open in IMG/M
3300010398\|Ga0126383_12989143	Not Available	552	Open in IMG/M
3300012361\|Ga0137360_10701393	Not Available	869	Open in IMG/M
3300012948\|Ga0126375_10634100	Not Available	822	Open in IMG/M
3300012957\|Ga0164303_10637672	Not Available	708	Open in IMG/M
3300012971\|Ga0126369_10990682	Not Available	928	Open in IMG/M
3300012971\|Ga0126369_11260638	Not Available	829	Open in IMG/M
3300012986\|Ga0164304_10321431	Not Available	1069	Open in IMG/M
3300013297\|Ga0157378_12400496	Not Available	579	Open in IMG/M
3300013306\|Ga0163162_10823599	Not Available	1044	Open in IMG/M
3300015374\|Ga0132255_101116655	Not Available	1185	Open in IMG/M
3300016404\|Ga0182037_12159062	Not Available	501	Open in IMG/M
3300017792\|Ga0163161_11573636	Not Available	579	Open in IMG/M
3300021560\|Ga0126371_10878219	All Organisms → cellular organisms → Bacteria	1041	Open in IMG/M
3300021560\|Ga0126371_11226975	Not Available	885	Open in IMG/M
3300021560\|Ga0126371_13459688	Not Available	533	Open in IMG/M
3300021560\|Ga0126371_13623449	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
3300025922\|Ga0207646_11330993	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300026551\|Ga0209648_10509345	Not Available	692	Open in IMG/M
3300027874\|Ga0209465_10030325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2544	Open in IMG/M
3300031719\|Ga0306917_10925559	Not Available	682	Open in IMG/M
3300031744\|Ga0306918_11432258	Not Available	529	Open in IMG/M
3300031747\|Ga0318502_10284959	Not Available	969	Open in IMG/M
3300031770\|Ga0318521_10586328	Not Available	674	Open in IMG/M
3300031781\|Ga0318547_10426416	Not Available	816	Open in IMG/M
3300031845\|Ga0318511_10536923	Not Available	543	Open in IMG/M
3300031879\|Ga0306919_10372908	Not Available	1092	Open in IMG/M
3300031912\|Ga0306921_10046673	All Organisms → cellular organisms → Bacteria	4907	Open in IMG/M
3300031954\|Ga0306926_11381539	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	818	Open in IMG/M
3300032035\|Ga0310911_10360054	Not Available	840	Open in IMG/M
3300032174\|Ga0307470_10141213	Not Available	1457	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	93.58%
Host-Associated	Host-Associated	6.42%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	93.58%
Plants	Host-Associated → Plants	6.42%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	93.58%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.67%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.75%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	51.38%
Loam	Environmental → Terrestrial → Soil → Loam	42.20%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.92%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.92%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	35.78%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	29.36%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	14.68%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.42%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.67%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	2.75%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.83%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.92%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	35.78%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	26.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.50%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.59%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	3.67%
Tropical Rainforest Soil	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil	2.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.83%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.83%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.92%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.92%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.92%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.92%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.92%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.92%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.92%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.92%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000580	Forest soil microbial communities from Amazon forest - 2010 replicate II A01	Environmental	Open in IMG/M
3300000655	Forest soil microbial communities from Amazon forest - 2010 replicate II A100	Environmental	Open in IMG/M
3300000793	Forest soil microbial communities from Amazon forest - 2010 replicate II A001	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300004268	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005363	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031747	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22	Environmental	Open in IMG/M
3300031770	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17	Environmental	Open in IMG/M
3300031781	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20	Environmental	Open in IMG/M
3300031845	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPIPI_03595850	2088090014	Soil	ELRMLSLAAAIAALVSYYSIQVYRVAVEPARAHTTERAR
AF_2010_repII_A01DRAFT_10351382	3300000580	Forest Soil	MTELRMXSLAAVIAALVAYYSIQFYRFAVEPARAHTTERAR*
AF_2010_repII_A100DRAFT_10294412	3300000655	Forest Soil	MTELRMFSLAAVIAALVAYYSIQFYRFAVEPARAHTTERAR*
AF_2010_repII_A001DRAFT_100431192	3300000793	Forest Soil	MSKLRMLSLAAAIVALVAYYSIQFYPLAVEPARAHTTERAR*
AF_2010_repII_A001DRAFT_100844612	3300000793	Forest Soil	RQAPSSRVHRGPAMSELRMLSLAGVIAALVAYYSIQFYRLAVEPAQAHTTERAR*
JGI10216J12902_1099729753	3300000956	Soil	MSELRMLLLAAAIAALVSYYSVQFYRFAVEPARAHTVERVR*
Ga0066398_100041091	3300004268	Tropical Forest Soil	MTKLRMLSLAAAIVALVSYYSVQFYRVAVEPTRVHTTEHAR*
Ga0066388_1001762985	3300005332	Tropical Forest Soil	MTELRMLSLAAAIAALVGYYSIQFYRFAVEPARAHTTERTR*
Ga0066388_1004441503	3300005332	Tropical Forest Soil	MTELRMLSLAAAIAALVAYYSIQVYRFVVEPARAHTTERAR*
Ga0066388_1009684743	3300005332	Tropical Forest Soil	MSELRMLSLAAAIAALVSYYSIQVYRLAIEPARAHTAERVR*
Ga0066388_1010966084	3300005332	Tropical Forest Soil	MSELRMLSLAAAIAALVSYYSIQAYRLAVEPARAHTAERVR*
Ga0066388_1016662872	3300005332	Tropical Forest Soil	MSELRMLSLAAAIAALVSYYSIQFYRVAVEPARAHTTERAR*
Ga0066388_1017040212	3300005332	Tropical Forest Soil	MSELRMLSLATAIAALVSYYSIQFYRLAVEPARAHTVERVR*
Ga0066388_1022941523	3300005332	Tropical Forest Soil	MSELRMLSLAAAIAALVAYYSIQFSRFAVEPAQVHTTERGR*
Ga0066388_1029352191	3300005332	Tropical Forest Soil	VYRRPTMSELRMLSLAATTAALVAYYSIQVYRFAVESARAHTTERAR*
Ga0066388_1038224232	3300005332	Tropical Forest Soil	MSELRMLSLAAAIAALVSYYSIQVYRFAVEPAGAHTMERAR*
Ga0066388_1057128882	3300005332	Tropical Forest Soil	MSELRMLSLAAAIAALVAYYSIQFYHLAVEPARAHTTERAR*
Ga0066388_1065384582	3300005332	Tropical Forest Soil	MTELWMLSLAAAIVALVSYYSVQFYRVAVEPTRAHTTERAR*
Ga0066388_1081994271	3300005332	Tropical Forest Soil	MSELRMLSLAAAIAALVSYYSIQVYRLAVEPARAHTAERVR*
Ga0066388_1084618633	3300005332	Tropical Forest Soil	MSQLRMFSLAGVIAALVAYYSIQFYRLAVEPAQAHTTERAR*
Ga0008090_102609943	3300005363	Tropical Rainforest Soil	MTELRMLSLAAVIAALVAYYSIQFYRFAVEPARAHTTERAR*
Ga0008090_154709141	3300005363	Tropical Rainforest Soil	MSKLRMLSLAAAIVALVAYYSIQFYHLAVEPARAHTTERAR*
Ga0008090_158822492	3300005363	Tropical Rainforest Soil	MSELRMLSLAAAIVALVAYYSIQFYRLAVEPARVHITERAR*
Ga0070659_1015321912	3300005366	Corn Rhizosphere	MSELRMLSLAAAIAALVSYYSIQVYRVAVEPARADTTERAR*
Ga0070714_1008731921	3300005435	Agricultural Soil	SRVHRRPAMSELRMLSLAAAIAALVSYYSIQVYHVAVEPARAHTTERAR*
Ga0070713_1003079513	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MSELRMLSLAAAIAALVSYYSIQVYRVAVEPARAHTTERAR*
Ga0070710_101757182	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	MSELRMLSLAAAIAALVSYYSIQVYHVAVEPARAHTTERAR*
Ga0070708_1007860163	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MSELRMLSLAAAIAALVAYYSIQVYRFAVEPAQTHTTQRAP*
Ga0066905_1004946133	3300005713	Tropical Forest Soil	MSELQMLSLAAAIAALVAYYSIQFYRFAVEPVQAHATERAR*
Ga0066905_1005071613	3300005713	Tropical Forest Soil	MSELRMLSLAAAIAALVAYYSIQVYHFAVEPARAHTTERAR*
Ga0066905_1007219123	3300005713	Tropical Forest Soil	MTKLRMLSLAAAIVALVSYYSVQFYRVAVEPTRAHTTERAR*
Ga0066905_1015289482	3300005713	Tropical Forest Soil	MSELRMLSLAAAIAALVAYYSIQFYRFAVEPAQAHTTERAR*
Ga0066905_1021705243	3300005713	Tropical Forest Soil	PAMSELRMLSLAAAIAALVAYYSIQFYRFAVKPAQVHTTERAQ*
Ga0066903_1000162785	3300005764	Tropical Forest Soil	MSELRMLSLAAAIVVLVAYYSIQFYHLAVEPARAHTTESAR*
Ga0066903_1003022973	3300005764	Tropical Forest Soil	MTELRMLSLAAVIAALVGYYSIQFYRFAVEPARAHTTERTR*
Ga0066903_1004500553	3300005764	Tropical Forest Soil	MSELRMLSLAGVIAALIAYYSIQFYRLAVEPAQAHTTERAR*
Ga0066903_1012102011	3300005764	Tropical Forest Soil	SRVHRRPAMTELRMLSLAAVIAALVAYYSIQFYRFAVEPARAHTTERAR*
Ga0066903_1013777753	3300005764	Tropical Forest Soil	MSDLRMLWLAAVIVALVSYYSIQVYRLAVEPARAHTTEGAG*
Ga0066903_1024718433	3300005764	Tropical Forest Soil	MSELRMLSLAAAIASLVAYYSIQFYRFAVEPVQTHTT
Ga0066903_1031438243	3300005764	Tropical Forest Soil	MTELRMLSLAAVIAALVAYYSIQFYRFAVEPARAHTTERTR*
Ga0066903_1031439102	3300005764	Tropical Forest Soil	MHELRMLSLAAAIAALVAYYSIQFYRFAVEPARAHTTERAR*
Ga0066903_1035155241	3300005764	Tropical Forest Soil	MSELRMLSLAAVIAALVGYYSIQFYRFAVEPARAHTTERAQ*
Ga0066903_1035824643	3300005764	Tropical Forest Soil	MTELRMLSLAAAIVALVAYYSIQFYHLAVEPARAHTTERGR*
Ga0066903_1039114432	3300005764	Tropical Forest Soil	MTELRMLSLAAAIAALVAYYSIQFYRFAVEPARAHTTERAR*
Ga0066903_1043444612	3300005764	Tropical Forest Soil	MSELRMLSLAAAIAALVSYYSIQVYRLAVEPARAHAAERVR*
Ga0066903_1046821351	3300005764	Tropical Forest Soil	MSELRMLSLAAAIAALFAYYSIQVYRFAVEPAQTHTTERAR*
Ga0066903_1051336591	3300005764	Tropical Forest Soil	MSELRMLSLAAAIAALVAYYSIQFYRFAVEPARAHTTERTR*
Ga0066903_1052745572	3300005764	Tropical Forest Soil	MSELRMLSLVAAIAALVAYYSIQFYRFAIDPAPAHATERAP*
Ga0066903_1079747571	3300005764	Tropical Forest Soil	MSELRMLSLAAAIAALVSYYSIQFYRLAVEPVRVHTTERAR*
Ga0066903_1086059931	3300005764	Tropical Forest Soil	MSELRMFSLAAMIAALVGYYSIQFYRFAVEPARAHTTERTR*
Ga0066903_1087462092	3300005764	Tropical Forest Soil	MSMLSLAAAIVALVAYYSIQFYHLAVEPARAHTMERAR*
Ga0066903_1087473922	3300005764	Tropical Forest Soil	MSELRMLSLAAVIAALVGYYSIQFYRCAVEPARAHTTERAR*
Ga0081455_109212063	3300005937	Tabebuia Heterophylla Rhizosphere	MSELRMLSLAAAIAALVAYYSIQFYRFAVEPARAHTTERAR*
Ga0070716_1007812202	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MSELRMLSLAAAIAALVAYYSIQVYRVAVEPARAHTTERAR*
Ga0070712_1016516672	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MSELRMLSLAAAIAALVSYYSIQFYRVAVEPTRAHTTERAR*
Ga0079221_111766472	3300006804	Agricultural Soil	MTELRMLLLAAAIAALVGYYSIQFYRFAVEPARAHTTERTR*
Ga0075424_1026881332	3300006904	Populus Rhizosphere	MSELRMLSLAAAIAALVSYYSIQGYRVAVEPARAHTT
Ga0066709_1024379652	3300009137	Grasslands Soil	MSELRMLSLAAAIAALVSYYSIQVYRFAVEPARAHTTERAR*
Ga0126374_107272552	3300009792	Tropical Forest Soil	MSMLSLAAAIVALVAYYSIQFYHLAVEPARAHTTERAR*
Ga0126380_100782273	3300010043	Tropical Forest Soil	MSELRMLSLAAAIAALVAYYSIQFYHLAVEPARAHATEHGR*
Ga0126380_106487092	3300010043	Tropical Forest Soil	MSELRILSLAAAIAALVSYYSIQVYRFAVEPARAHTTERAR*
Ga0126380_119579382	3300010043	Tropical Forest Soil	MSELRMLSLAAAIAALVSYYSIQVYRFAVEPAGAHTTERGR*
Ga0126380_119825731	3300010043	Tropical Forest Soil	MSELRMLSLAAVIAALVAYYSIQFYRFAVEPARAQTTERAR*
Ga0126384_109694242	3300010046	Tropical Forest Soil	MSELRMLSLAAAIAALVAYYSIHFYRFAVEPVQAHATERGR*
Ga0126382_105451723	3300010047	Tropical Forest Soil	MTELWMLSLAAAIVALVSYYSVQFYRVTVEPTRAHTTERAR*
Ga0126382_113051982	3300010047	Tropical Forest Soil	MSELRMLSLAAAIAALVAYYSIQFYRLAVEPAQAHTTERAR*
Ga0126382_121063732	3300010047	Tropical Forest Soil	AMSKLRMLSLAAAIVALVAYYSIQFYHLAVEPARAHTTERAR*
Ga0126373_121025001	3300010048	Tropical Forest Soil	MSELRMLSLAAAIAALVAYYSIQFYRFAVEPAQVHTTERAR*
Ga0126370_100526371	3300010358	Tropical Forest Soil	MSELRMLSLAAAIAALVAYYRFAVEPAQVHTTERAQ*
Ga0126370_105811532	3300010358	Tropical Forest Soil	MTELRMLSLAAVIAALVAYYSIQLYRFAVEPAWAHTTERAR*
Ga0126370_115488171	3300010358	Tropical Forest Soil	LRMLSLAAAIAALVGYYSIQFYRFAVEPARAHTTERTR*
Ga0126376_121922883	3300010359	Tropical Forest Soil	MTELRMLSLAAAIAALVAYYSIQFYHLAVEPARAHATEHGR*
Ga0126378_112936412	3300010361	Tropical Forest Soil	HRRPAMTELRMLSLAAAIAALVAYYSIQVYRFVVEPARAHTTERAR*
Ga0126377_116820862	3300010362	Tropical Forest Soil	MSELRMLATAIAALVSYYSIQVYRFAVELAGAHTMERAR*
Ga0126379_101452304	3300010366	Tropical Forest Soil	MTELRMLSLAAAIVALVSYYSVQFYRVAVEPTRAHTTERAR*
Ga0126379_130746801	3300010366	Tropical Forest Soil	AMSELRMLSLAAAIAALVAYYSIQFYRFAVEPAQVHTTERAR*
Ga0126381_1017428222	3300010376	Tropical Forest Soil	RPAMTELRMLSLAAVIAALVGYYSIQFYRFAVEPARAHTTERTR*
Ga0126383_111342783	3300010398	Tropical Forest Soil	MSELRMLSLAAAIAALVSYYSIQVYRFAVEPARSHTTERAR*
Ga0126383_116110092	3300010398	Tropical Forest Soil	MSELRMLLLAAAIVALVAYYSIQFYRLAVEPARVHTTERAR*
Ga0126383_129891432	3300010398	Tropical Forest Soil	MSELRMLSLAAVIAALVGYYSIQFYRFAVEPARAHTTERTR*
Ga0137360_107013932	3300012361	Vadose Zone Soil	MSELRMLSLAAAIAALVSYYSIQVYRVAVEPARAHTTERPR*
Ga0126375_106341001	3300012948	Tropical Forest Soil	SELRMLSLAAAIAALFSYYSIQVYRLAVEPARAHTTERAR*
Ga0164303_106376721	3300012957	Soil	KAREAPSSRVHRKPAMSELRMLSLAAAIAALVSYYSIQVYSVAVEPARAHTTERAR*
Ga0126369_109906823	3300012971	Tropical Forest Soil	MSELRMLSLAGVIAAFVAYYSIQFYRLAVEPAQAHTTERA
Ga0126369_112606382	3300012971	Tropical Forest Soil	MSELRMLWLAAAIAALVAYYSIQVYRLAVEPARAHTTER
Ga0164304_103214313	3300012986	Soil	MSELRMLSLAAAIAALVSYYSIQVYHVAVEPARAHTTERPR*
Ga0157378_124004962	3300013297	Miscanthus Rhizosphere	MSELRMLSLAAAIAALVSYYSIQVYRVDVEPARADTTERAR*
Ga0163162_108235992	3300013306	Switchgrass Rhizosphere	MSELRMLSLAAAIVALVAYYSIQVYRVAVEPARAHTTERAR*
Ga0132255_1011166554	3300015374	Arabidopsis Rhizosphere	MSELRMLSLATAIAALVSYYSIQVYRLAVEAARAHTTERAR*
Ga0182037_121590622	3300016404	Soil	MSELRMLSLAAAIAALVAYYSIQFYRFAVEPARAH
Ga0163161_115736361	3300017792	Switchgrass Rhizosphere	MSELRMLSLAAAIAALVSYYSIQVYRVAVEPARAHTTERAR
Ga0126371_108782192	3300021560	Tropical Forest Soil	MSDLRMLWLAAVIVALVSYYSIQVYRLAVEPARAHTTGGAG
Ga0126371_112269753	3300021560	Tropical Forest Soil	MTELRMLSLAAAIVALVSYYSVQFYRVAVEPTRAHTTERGT
Ga0126371_134596882	3300021560	Tropical Forest Soil	MSELRMLSLAAAIAALVSYYSIQVYRLAVEPARAHTAERVR
Ga0126371_136234492	3300021560	Tropical Forest Soil	MTELRMLSLAAAIVALVAYYSIQFYHLAVEPARAHTTERAR
Ga0207646_113309932	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MSELRMLSLAAAIAALVSYYSIQVYRFAVEPARAHTTERAR
Ga0209648_105093452	3300026551	Grasslands Soil	MSELRMLSLAAAIAALVAYYSIQFYRFAVEPVQAHATGRAR
Ga0209465_100303252	3300027874	Tropical Forest Soil	MTELRMLSLAAAIAALVAYYSIQFYRFAVEPARAHTTERAR
Ga0306917_109255591	3300031719	Soil	MSELRMLSLAAAFAALVAYYSIHFYRFAVEPVQTHTTERAR
Ga0306918_114322583	3300031744	Soil	MSELRMLSLAAAIAALVAYYSIQFYCFAVEPARAHTTERAR
Ga0318502_102849593	3300031747	Soil	MSELRMLSLAGVIAALVAYYSIQFYRLAVEPAQAHTTERA
Ga0318521_105863282	3300031770	Soil	MSELRMLSLAAAIAALVSYYSIQVYRFAVEPARAHTTE
Ga0318547_104264161	3300031781	Soil	AMSKLRMLSLAGVIAALVAYYSIQFYRLAVEPAQAHTTERAR
Ga0318511_105369232	3300031845	Soil	MSKLRMLSLAGVIAALVAYYSIQFYRLAVEPAQAHTTERAR
Ga0306919_103729081	3300031879	Soil	MIELRMLSLAAAIVALVSYYSIQVYRLAVEPAQAHTTERAQ
Ga0306921_100466738	3300031912	Soil	MSELRMLSLAGVIAALVAYYSIQFYRLAVEPAQAHTTERAR
Ga0306926_113815392	3300031954	Soil	MSELRMLSLAAAIAALVAYYSIHFYRFAVEPVQTHTTERAR
Ga0310911_103600541	3300032035	Soil	LRMLSLAAAIAALVSYYSIQVYRFAVEPARAHTTERAR
Ga0307470_101412134	3300032174	Hardwood Forest Soil	MSELRMLSLAAAIAALVSYYSIQVYRVAVEPARAHTTERPR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F089331

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences