| Basic Information | |
|---|---|
| Family ID | F089321 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MRLFIALDIDDVIRERIARFVEGVRNFAPDARWVKPE |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 50.93 % |
| % of genes near scaffold ends (potentially truncated) | 96.33 % |
| % of genes from short scaffolds (< 2000 bps) | 89.91 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.248 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (7.339 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.349 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.459 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.15% β-sheet: 0.00% Coil/Unstructured: 73.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF02464 | CinA | 87.16 |
| PF02163 | Peptidase_M50 | 0.92 |
| PF13662 | Toprim_4 | 0.92 |
| PF13458 | Peripla_BP_6 | 0.92 |
| PF13563 | 2_5_RNA_ligase2 | 0.92 |
| PF03631 | Virul_fac_BrkB | 0.92 |
| PF02834 | LigT_PEase | 0.92 |
| PF00682 | HMGL-like | 0.92 |
| PF02954 | HTH_8 | 0.92 |
| PF08450 | SGL | 0.92 |
| PF03884 | YacG | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 87.16 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.92 |
| COG1514 | RNA 2',3'-cyclic phosphodiesterase (2'-5' RNA ligase) | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG3024 | Endogenous inhibitor of DNA gyrase, YacG/DUF329 family | Replication, recombination and repair [L] | 0.92 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.92 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.25 % |
| Unclassified | root | N/A | 2.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005158|Ga0066816_1015621 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005184|Ga0066671_10199395 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300005435|Ga0070714_102017778 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005436|Ga0070713_102174494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300005518|Ga0070699_100633098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 976 | Open in IMG/M |
| 3300005530|Ga0070679_100347581 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300005540|Ga0066697_10425276 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005555|Ga0066692_10976972 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005557|Ga0066704_10149347 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300005569|Ga0066705_10077860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1929 | Open in IMG/M |
| 3300005764|Ga0066903_102887146 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300005892|Ga0075275_1042156 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005895|Ga0075277_1094336 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005903|Ga0075279_10028423 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300005994|Ga0066789_10047719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1879 | Open in IMG/M |
| 3300006086|Ga0075019_10950607 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006173|Ga0070716_101163474 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006354|Ga0075021_10202210 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300009137|Ga0066709_104016236 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300009522|Ga0116218_1573182 | Not Available | 500 | Open in IMG/M |
| 3300009545|Ga0105237_10097742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2927 | Open in IMG/M |
| 3300009639|Ga0116122_1035162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1735 | Open in IMG/M |
| 3300009698|Ga0116216_10367942 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300009792|Ga0126374_10790255 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300009839|Ga0116223_10268217 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300010048|Ga0126373_10270697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1681 | Open in IMG/M |
| 3300010048|Ga0126373_10810136 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300010358|Ga0126370_11070278 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300010360|Ga0126372_11066817 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300010366|Ga0126379_13684612 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010398|Ga0126383_12741095 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300011271|Ga0137393_11421753 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012361|Ga0137360_11196640 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300012977|Ga0134087_10269063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300012989|Ga0164305_11812368 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300014165|Ga0181523_10069789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2144 | Open in IMG/M |
| 3300016422|Ga0182039_11874176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300016445|Ga0182038_11836674 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300016750|Ga0181505_10237776 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300017823|Ga0187818_10046151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1871 | Open in IMG/M |
| 3300017961|Ga0187778_10937017 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300017966|Ga0187776_10541990 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300017973|Ga0187780_10281669 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300017994|Ga0187822_10263171 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300017995|Ga0187816_10040059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1931 | Open in IMG/M |
| 3300017995|Ga0187816_10233633 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300018012|Ga0187810_10178432 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300018032|Ga0187788_10313806 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300018034|Ga0187863_10008233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6987 | Open in IMG/M |
| 3300018058|Ga0187766_10049893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2458 | Open in IMG/M |
| 3300018064|Ga0187773_10618032 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300018090|Ga0187770_10553388 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300018433|Ga0066667_11009738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300020583|Ga0210401_10122523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2438 | Open in IMG/M |
| 3300020583|Ga0210401_10295871 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300021168|Ga0210406_10437694 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300021402|Ga0210385_11466370 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300021560|Ga0126371_13180905 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300022722|Ga0242657_1237910 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300024227|Ga0228598_1018615 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300025795|Ga0210114_1099139 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300025899|Ga0207642_10377017 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300025907|Ga0207645_10948286 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300026078|Ga0207702_11968140 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300026089|Ga0207648_11001799 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300026313|Ga0209761_1074345 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300026529|Ga0209806_1136127 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300026530|Ga0209807_1337748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300026536|Ga0209058_1211480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300027684|Ga0209626_1167922 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300027803|Ga0209910_10032840 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300027842|Ga0209580_10091275 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300027867|Ga0209167_10665348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300027894|Ga0209068_10189172 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300027894|Ga0209068_10745149 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300027895|Ga0209624_10806410 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300027898|Ga0209067_10171000 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300028566|Ga0302147_10057372 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300028746|Ga0302233_10266317 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300028747|Ga0302219_10017380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2682 | Open in IMG/M |
| 3300028779|Ga0302266_10258936 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300028906|Ga0308309_10641849 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300029907|Ga0311329_11025365 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300029956|Ga0302150_10358964 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300030007|Ga0311338_10202530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2287 | Open in IMG/M |
| 3300030042|Ga0302300_1108745 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300030047|Ga0302286_10556310 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300030503|Ga0311370_10350472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1882 | Open in IMG/M |
| 3300031681|Ga0318572_10938393 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031718|Ga0307474_11111263 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300031754|Ga0307475_10994453 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300031771|Ga0318546_10126765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1701 | Open in IMG/M |
| 3300031823|Ga0307478_11548366 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031833|Ga0310917_10371023 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300031852|Ga0307410_11328374 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300031852|Ga0307410_11370768 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031954|Ga0306926_10767071 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300032174|Ga0307470_10227393 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300032180|Ga0307471_100613818 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300032180|Ga0307471_102121605 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300032515|Ga0348332_10841088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5442 | Open in IMG/M |
| 3300032770|Ga0335085_10107641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3587 | Open in IMG/M |
| 3300032783|Ga0335079_11053814 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300032783|Ga0335079_11730788 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300032783|Ga0335079_11847007 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300032805|Ga0335078_10926291 | Not Available | 1043 | Open in IMG/M |
| 3300032954|Ga0335083_10311177 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300033402|Ga0326728_10093588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3702 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.34% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.42% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.59% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.59% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.59% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.75% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.83% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.92% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.92% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.92% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.92% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005158 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005892 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027803 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3S | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066816_10156211 | 3300005158 | Soil | MRLFIALDIDDQIRQRIGRFLEGVSGFSPDARWVPLESLHITL |
| Ga0066671_101993952 | 3300005184 | Soil | MRLFVALDIADEIRQRIARFMEGVREFAPEPGWVREESLH |
| Ga0070714_1020177781 | 3300005435 | Agricultural Soil | MRLFVALDIDERIARFMEGVRNFASDAGWAKEESLHVTLKF |
| Ga0070713_1021744941 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLFVALDIDDPIRERIARFVVGLRNFAPDARWAKRNRCT* |
| Ga0070699_1006330982 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LTMRIFIAVDIDDVIRERLRLFMEGVRGFAVDARWVRSE* |
| Ga0070679_1003475812 | 3300005530 | Corn Rhizosphere | MRLFVALDIDDPIRERIARFVEGVRNFAPDGRWAKEESLHV |
| Ga0066697_104252761 | 3300005540 | Soil | MRIFVALDLDDDIRQRIQTFMDGVQNFSPDARWVNAASLHVT |
| Ga0066692_109769722 | 3300005555 | Soil | MRIFIALDIDDAIRERIARFVEGVSSFAPDARWAKPE |
| Ga0066704_101493472 | 3300005557 | Soil | MRLFVALDIADEIRQRIARFMEGVREFAPEPRWVREESLHV |
| Ga0066705_100778601 | 3300005569 | Soil | MRVFVALDVDNAIREQLQLFMDGVSGFAPDARWIRPESMHVTL |
| Ga0066903_1028871461 | 3300005764 | Tropical Forest Soil | MRLFVALDIDQSIRERIVRFVDGLHNFAPDARWMKPESMHV |
| Ga0075275_10421561 | 3300005892 | Rice Paddy Soil | MRLFVAFDIDPDIRERLARFLDGVREFAPDARWVRAESL |
| Ga0075277_10943361 | 3300005895 | Rice Paddy Soil | MRLFVALDIADEVRERIGRYVEGVQNFAPEARWVKE |
| Ga0075279_100284232 | 3300005903 | Rice Paddy Soil | MRLFIALDIDDAIRERLAKFVEGVRGFAPDVRFVGVESLHIT |
| Ga0066789_100477191 | 3300005994 | Soil | MRLFIALDIDDAIRDRITRFVEGVTGFAPDARWAKPE |
| Ga0075019_109506071 | 3300006086 | Watersheds | MRLFLALDIDEAIRQRIERFLEGVHPFAPDARWAKPE |
| Ga0070716_1011634742 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLFIALEIDGAIRERVARFIEGVGPFAPDARWVTSESLHI |
| Ga0075021_102022101 | 3300006354 | Watersheds | MRLFIALDIDGAIRERIVRFVDGVREFAPDARWVPP |
| Ga0066709_1040162362 | 3300009137 | Grasslands Soil | MRIFIALDIDDSIRERIKRFMEGVRGFDPEARWVRH |
| Ga0116218_15731821 | 3300009522 | Peatlands Soil | MRLFIALDIADAVRERLARFTEGVQAFAPDARWAK |
| Ga0105237_100977423 | 3300009545 | Corn Rhizosphere | MRLFVALDIEETIRERIASFVKEVCPLAPGVRWVASEPCT* |
| Ga0116122_10351621 | 3300009639 | Peatland | MRLFIALDIDDAIRERIARFIEGVQGFAPEARWVKP |
| Ga0116216_103679422 | 3300009698 | Peatlands Soil | MRLFIALDIDDAIRERIARFVEGVSGFAPDARWAKPE |
| Ga0126374_107902552 | 3300009792 | Tropical Forest Soil | MAAFMRLFIALDIDDGIRERISRFVESVRSFSPDARW |
| Ga0116223_102682172 | 3300009839 | Peatlands Soil | MRLFIAVDIDDAIRERIARFIEGVQGFAPDARWVK |
| Ga0126373_102706971 | 3300010048 | Tropical Forest Soil | MRLFIALEIDEAIRQRIARFTEGVRGFAPDARWVKEESLH |
| Ga0126373_108101362 | 3300010048 | Tropical Forest Soil | MRIFIGLDLENSIRERIRRFMDGVRGFAPDARWTRPESL |
| Ga0126370_110702782 | 3300010358 | Tropical Forest Soil | MRIFVALDIDEDIRRRIVGFVDDLRPYARDARWVKPES |
| Ga0126372_110668172 | 3300010360 | Tropical Forest Soil | MRLFVALDIDDLIRERIARFVEGVCNFAPEARWVKPESLH |
| Ga0126379_136846121 | 3300010366 | Tropical Forest Soil | MRIFIALDLDDAIRERIDRFIEGVRGFAPGARWVLPES |
| Ga0126383_127410952 | 3300010398 | Tropical Forest Soil | MRVFIALDIDQSIRERITRFLDGVREFAPDARWVRTE |
| Ga0137393_114217532 | 3300011271 | Vadose Zone Soil | MRIFIALDIDDAIRDRISRFMDGVREFAPDARWVRP |
| Ga0137360_111966402 | 3300012361 | Vadose Zone Soil | MRLFIALDIDDPIRERITRFADEVRNFSPDARWVKL |
| Ga0134087_102690632 | 3300012977 | Grasslands Soil | MRIFVALDLDDGIRQRIQRFMDGVQNFAPDARWVNAAS |
| Ga0164305_118123681 | 3300012989 | Soil | LLNVRLFIALDIDEEIRQRIGRFLDGVSGFAADARWV |
| Ga0181523_100697891 | 3300014165 | Bog | MRLFVALDIDGAIRGRIAQFMDGMRGFAPDARWVSAES |
| Ga0182039_118741762 | 3300016422 | Soil | MRLFVALDIDDAIRERIVRFVEVVHPFAPDARWVKPESMHVTL |
| Ga0182038_118366742 | 3300016445 | Soil | MRLFLALDIDDAIRDRLTRFLEGVRNFAPDARWVKPESL |
| Ga0181505_102377761 | 3300016750 | Peatland | MRLFIALDIDDAIRERIARFLEGVSGFVPDARWAKPES |
| Ga0187818_100461513 | 3300017823 | Freshwater Sediment | MRLFVALDIDSAIRAKIAQFMEGVREFAPDARRISAESL |
| Ga0187778_109370172 | 3300017961 | Tropical Peatland | MRLFIALDIDDAIRECIARFVEGVQGFAPDARWVKPES |
| Ga0187776_105419901 | 3300017966 | Tropical Peatland | MRLFVALEIDPEIRARIAQFMDGVREFAPDARWVSAES |
| Ga0187780_102816691 | 3300017973 | Tropical Peatland | MRLFVALDIDAEIRARIAQFMDGVCAFAPDARWVSAESLHLTLK |
| Ga0187822_102631711 | 3300017994 | Freshwater Sediment | MRLFIALDIDDVIRERIARFVEGVRNFAPDARWVKPE |
| Ga0187816_100400591 | 3300017995 | Freshwater Sediment | MRLFIALDLDPSIRHRIAQFMDGVRGFAPDARWVSAE |
| Ga0187816_102336331 | 3300017995 | Freshwater Sediment | MRLFVALDIDDGIRERITRFVDGVRNFAPDARWMKPESL |
| Ga0187810_101784322 | 3300018012 | Freshwater Sediment | MRLFIALDLDDAIRERIARFVEGVSNFAPDARWVKPESLH |
| Ga0187788_103138062 | 3300018032 | Tropical Peatland | MRLFLALDIDPEIRSRIAEFMDGVRGFAPDARWVS |
| Ga0187863_100082338 | 3300018034 | Peatland | MRLFLALDIDDAIRERITRFVDGVRNFSPDARWMQPE |
| Ga0187766_100498931 | 3300018058 | Tropical Peatland | MRLFVALDLHEEIRQRIARFVEGVGEFAPQPRWVSPQSLH |
| Ga0187773_106180321 | 3300018064 | Tropical Peatland | MRLFVALDIDPPIRRRIAQFMDGVREFAPDARWVSAESL |
| Ga0187770_105533881 | 3300018090 | Tropical Peatland | MRIFIALDIDDAIRERIARFMDGVREFAPDARWVKPE |
| Ga0066667_110097381 | 3300018433 | Grasslands Soil | MFAMRLFVALDIDEAIRERITRFLDAVEDLAPDARW |
| Ga0210401_101225233 | 3300020583 | Soil | MRLFVAFDIDDNIRDRIVRFLDGVRGFAPDARWARPESL |
| Ga0210401_102958711 | 3300020583 | Soil | MRLFIALDIDDAIRGRIARFVEGVSGFALDARWAKPESMHV |
| Ga0210406_104376942 | 3300021168 | Soil | MRLFIALDIDDGIRAQIAQFIEAVQAFAPEARWMKPESLLV |
| Ga0210385_114663702 | 3300021402 | Soil | MRLFIALDIDEAVRERIARFVEGVTGFAADARWMRPE |
| Ga0126371_131809052 | 3300021560 | Tropical Forest Soil | MRLFIALDIDHSIRERIARFMEGVRNFAPDARWMKEE |
| Ga0242657_12379101 | 3300022722 | Soil | MRIFVALDIDAAIRQRIQRFMEGVSGFAPDARWVR |
| Ga0228598_10186151 | 3300024227 | Rhizosphere | MRLFIALDIDDEIRERIARFAEGVSGFAPDARWARPDSL |
| Ga0210114_10991392 | 3300025795 | Natural And Restored Wetlands | MRLFVGIDIEPAIRERISKFVEGVRNFAPDVRWVNAETFH |
| Ga0207642_103770171 | 3300025899 | Miscanthus Rhizosphere | MRLFVALDIDDAIRERIALFQDGVGGFAPDAKWVRAESLHITL |
| Ga0207645_109482861 | 3300025907 | Miscanthus Rhizosphere | MRLFVALDLADPIRERIQQFMEGVRGFAPDVRWVTPESL |
| Ga0207702_119681401 | 3300026078 | Corn Rhizosphere | MRLFIALDIDEEIRRRIERFVEGVRGFAPDVRFVGPQSFHVTLK |
| Ga0207648_110017991 | 3300026089 | Miscanthus Rhizosphere | MRIFVALDIDDAIRSRIQRFMEGVQEFAPDVRWVRP |
| Ga0209761_10743453 | 3300026313 | Grasslands Soil | MRIFIALDIDDSIRERIKRFMEGVRGFDPEARWVRHESLHIT |
| Ga0209806_11361272 | 3300026529 | Soil | MRIFIALDVEDSIRQRIARFMEGVRGFAPDVRWVR |
| Ga0209807_13377481 | 3300026530 | Soil | MRVFVALDVDNAIREQLQLFMDGVSGFAPDARWIRP |
| Ga0209058_12114801 | 3300026536 | Soil | MRIFVALDLDDGIRQRIQRFMDGVQNFAPDARWVNA |
| Ga0209626_11679221 | 3300027684 | Forest Soil | MRLFVALDVDDAIRGRIAGFMDGVRGFAPDARWLE |
| Ga0209910_100328402 | 3300027803 | Thawing Permafrost | MRLFVALDIDDAIRSRIARFLDGVREFAPDARWARPESL |
| Ga0209580_100912752 | 3300027842 | Surface Soil | MRLFIALDIDDAIRERLTGFLEGVHNFAPDARWVKPESL |
| Ga0209167_106653481 | 3300027867 | Surface Soil | MRIFVALDIDDAIRQRILRFMEGVSGFAPDARWVRL |
| Ga0209068_101891722 | 3300027894 | Watersheds | MRLFIALDIDGAIRERIVRFVDGVREFAPDARWVPPE |
| Ga0209068_107451491 | 3300027894 | Watersheds | MRIFVALHIDEAIRERIQRFMDGVRGFAADAHWARPE |
| Ga0209624_108064102 | 3300027895 | Forest Soil | MRLFVALDINDDIRNRIARYLEGVRGFAPAVRWMRS |
| Ga0209067_101710002 | 3300027898 | Watersheds | MRLFLALDIDDAIRARISRFVEGVRNFAPDARWAKEE |
| Ga0302147_100573722 | 3300028566 | Bog | MRLFVALDIDDAIRSRIARFLDGVREFAPDARWAR |
| Ga0302233_102663172 | 3300028746 | Palsa | MRLFIALDITDAIRGRIARFVEGVTGFAPDARGAK |
| Ga0302219_100173803 | 3300028747 | Palsa | MRLFVALDIDDVIRSRIARFLDGVREFAPDARWARSESL |
| Ga0302266_102589361 | 3300028779 | Bog | MRLFVALDIDEAIRVRIARFLDGVRGFAPEARWVRIE |
| Ga0308309_106418491 | 3300028906 | Soil | MRLFVALDIDDGIRSRIARFLDGVRGFAPDVRWARPEAL |
| Ga0311329_110253651 | 3300029907 | Bog | MRLFIALDLDNEIRNRIARFLDGVCEFASDARWARP |
| Ga0302150_103589641 | 3300029956 | Bog | MRLFVALDIDDDIRGSIARFIDEFRDVAAQARWVKPESLH |
| Ga0311338_102025303 | 3300030007 | Palsa | MRLFVALDLDDNLRSRIVRFVEGVRGFAPEARWARPESL |
| Ga0302300_11087452 | 3300030042 | Palsa | MRLFVALDIDDVIRSRIARFLDGVREFAPDARWAR |
| Ga0302286_105563102 | 3300030047 | Fen | MRIFVALDIEDIISQRIARFMDGVREFAPDARWVR |
| Ga0311370_103504723 | 3300030503 | Palsa | MRLFIAVDLDDAIRERISLFMEGVRPFAPDARWLKPESL |
| Ga0318572_109383932 | 3300031681 | Soil | MRLFIALDIDDAIRERITRFVEGVRSFAPDGRWVKPES |
| Ga0307474_111112632 | 3300031718 | Hardwood Forest Soil | MRVFVALDVDDAIRSRIARFLDGVRGFAPDARWVKPES |
| Ga0307475_109944532 | 3300031754 | Hardwood Forest Soil | VRLFIALDIDDAIRERMTGFMDGLRGFAPDVRWVRTE |
| Ga0318546_101267651 | 3300031771 | Soil | MRIFIALDLDDPIRERIDHFIEGVRGFAPDARWVLPESLHI |
| Ga0307478_115483661 | 3300031823 | Hardwood Forest Soil | MRLFIALDIDEAVRERIARFVEGVSGFAADARWMRPES |
| Ga0310917_103710231 | 3300031833 | Soil | MRIFIALDLDDPIRERIDHFIEGVRGFAPDARWVLPESLH |
| Ga0307410_113283742 | 3300031852 | Rhizosphere | MRLFVGIDIEPAIRERISKFVDGVRNFAPDVRWVNPETFHV |
| Ga0307410_113707682 | 3300031852 | Rhizosphere | MRLFVGIDIEPAIRERISKFVEGVRNFAPDVRWVNVET |
| Ga0306926_107670711 | 3300031954 | Soil | MRLFLALDIDDAIRDRLTRFLEGVRNFAPDARWVKPE |
| Ga0307470_102273932 | 3300032174 | Hardwood Forest Soil | MRLFVALDIDDSIRSRITRFLDGLRGFAPDARWVRSES |
| Ga0307471_1006138181 | 3300032180 | Hardwood Forest Soil | MRIFVALDIDDAIRNRIQRFMDGVRGFAPDARWVR |
| Ga0307471_1021216051 | 3300032180 | Hardwood Forest Soil | MRIFIALDIEDVVRDRIRRFMDGVREFAPDARWVR |
| Ga0348332_108410887 | 3300032515 | Plant Litter | MRLFIALDIDDEIRERIARFAEGVSGFAPDARWARPDS |
| Ga0335085_101076411 | 3300032770 | Soil | MRLFVALDIDNAIRERIVRFVEGVNPFAPEARWLKPESMHVT |
| Ga0335079_110538141 | 3300032783 | Soil | MRLFIALDIVDAIRGRIGRFLEGVRNFAPDARWVRDESLHV |
| Ga0335079_117307882 | 3300032783 | Soil | MRLFLALDIDGAIRERIARFMDGVRGFAPDARWIQPESLH |
| Ga0335079_118470072 | 3300032783 | Soil | MRLFIALDIDDAIRERIVRFLDGVQGFAPDARWVK |
| Ga0335078_109262911 | 3300032805 | Soil | MARLPMRLFVALDIDPEIRNRIAQFMDGVRGFAPEARWVSVESLHLT |
| Ga0335075_105629482 | 3300032896 | Soil | MRLFVALDLDESVREKIARFMDGVCGLAPEARWIQPESLH |
| Ga0335083_103111771 | 3300032954 | Soil | MRLFVALDIPSEIRERITRFVEGLVRFSPDANWVKPA |
| Ga0326728_100935885 | 3300033402 | Peat Soil | MRLFVALDIDFAVRERIAGFMAEVQKLAPEARWVKPESFHIT |
| ⦗Top⦘ |