| Basic Information | |
|---|---|
| Family ID | F089286 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLALRYLLIAGGLGMILVAVSILGYDLYRELLYRRALATPG |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.08 % |
| % of genes from short scaffolds (< 2000 bps) | 87.16 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.413 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.596 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.688 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.633 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.62% β-sheet: 0.00% Coil/Unstructured: 46.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF03734 | YkuD | 49.54 |
| PF10009 | DUF2252 | 10.09 |
| PF12838 | Fer4_7 | 5.50 |
| PF13430 | DUF4112 | 0.92 |
| PF00078 | RVT_1 | 0.92 |
| PF02274 | ADI | 0.92 |
| PF06662 | C5-epim_C | 0.92 |
| PF02685 | Glucokinase | 0.92 |
| PF03576 | Peptidase_S58 | 0.92 |
| PF00144 | Beta-lactamase | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 49.54 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 49.54 |
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 1.83 |
| COG0837 | Glucokinase | Carbohydrate transport and metabolism [G] | 0.92 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.92 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 0.92 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 0.92 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.92 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.41 % |
| Unclassified | root | N/A | 4.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10020134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4144 | Open in IMG/M |
| 3300000650|AP72_2010_repI_A1DRAFT_1017344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300001661|JGI12053J15887_10130064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1339 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10337707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300004479|Ga0062595_101366035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300005436|Ga0070713_100022667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4856 | Open in IMG/M |
| 3300005532|Ga0070739_10139183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1305 | Open in IMG/M |
| 3300005541|Ga0070733_10216887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1254 | Open in IMG/M |
| 3300005541|Ga0070733_10337593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 998 | Open in IMG/M |
| 3300005541|Ga0070733_11004640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300005560|Ga0066670_11026974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300005563|Ga0068855_100552275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1246 | Open in IMG/M |
| 3300005566|Ga0066693_10026578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1798 | Open in IMG/M |
| 3300005712|Ga0070764_10013882 | All Organisms → cellular organisms → Bacteria | 3976 | Open in IMG/M |
| 3300005889|Ga0075290_1023139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 772 | Open in IMG/M |
| 3300005944|Ga0066788_10004520 | All Organisms → cellular organisms → Bacteria | 2781 | Open in IMG/M |
| 3300006174|Ga0075014_100976511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300006794|Ga0066658_10468866 | Not Available | 685 | Open in IMG/M |
| 3300006904|Ga0075424_100976380 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300009522|Ga0116218_1041271 | All Organisms → cellular organisms → Bacteria | 2087 | Open in IMG/M |
| 3300009523|Ga0116221_1098090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300009645|Ga0116106_1147988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300010379|Ga0136449_100477219 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
| 3300012683|Ga0137398_10973922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300012987|Ga0164307_11733244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300014165|Ga0181523_10131483 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300014169|Ga0181531_10047296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2511 | Open in IMG/M |
| 3300016270|Ga0182036_11243082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300016404|Ga0182037_10486352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300017936|Ga0187821_10148064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 885 | Open in IMG/M |
| 3300017942|Ga0187808_10591303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300017943|Ga0187819_10112789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1623 | Open in IMG/M |
| 3300017955|Ga0187817_10033847 | All Organisms → cellular organisms → Bacteria | 3107 | Open in IMG/M |
| 3300017959|Ga0187779_10020076 | All Organisms → cellular organisms → Bacteria | 3806 | Open in IMG/M |
| 3300017959|Ga0187779_11326620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300017972|Ga0187781_10387690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300017973|Ga0187780_10312513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
| 3300017973|Ga0187780_11120648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300018040|Ga0187862_10319387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300018088|Ga0187771_10278492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1399 | Open in IMG/M |
| 3300018431|Ga0066655_10164631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1333 | Open in IMG/M |
| 3300020582|Ga0210395_10236901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1371 | Open in IMG/M |
| 3300020583|Ga0210401_10217257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1770 | Open in IMG/M |
| 3300021181|Ga0210388_11784836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300021402|Ga0210385_10020621 | All Organisms → cellular organisms → Bacteria | 4170 | Open in IMG/M |
| 3300021405|Ga0210387_10313388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1382 | Open in IMG/M |
| 3300021406|Ga0210386_10360354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1251 | Open in IMG/M |
| 3300021406|Ga0210386_11316958 | Not Available | 608 | Open in IMG/M |
| 3300021420|Ga0210394_10475964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1099 | Open in IMG/M |
| 3300021432|Ga0210384_10434334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1183 | Open in IMG/M |
| 3300021433|Ga0210391_10255054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1377 | Open in IMG/M |
| 3300021478|Ga0210402_10174429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1968 | Open in IMG/M |
| 3300021559|Ga0210409_10394312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1239 | Open in IMG/M |
| 3300021560|Ga0126371_13115197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300022728|Ga0224566_107235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300024331|Ga0247668_1106055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300025576|Ga0208820_1120393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300025612|Ga0208691_1008029 | All Organisms → cellular organisms → Bacteria | 2804 | Open in IMG/M |
| 3300026011|Ga0208532_1014891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300026023|Ga0207677_10573461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 987 | Open in IMG/M |
| 3300026334|Ga0209377_1174432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300026467|Ga0257154_1006094 | Not Available | 1576 | Open in IMG/M |
| 3300027266|Ga0209215_1025956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300027565|Ga0209219_1110282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300027648|Ga0209420_1056554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1168 | Open in IMG/M |
| 3300027652|Ga0209007_1067274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
| 3300027678|Ga0209011_1111067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300027701|Ga0209447_10060936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1037 | Open in IMG/M |
| 3300027825|Ga0209039_10188723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011 | 843 | Open in IMG/M |
| 3300027854|Ga0209517_10008805 | All Organisms → cellular organisms → Bacteria | 11730 | Open in IMG/M |
| 3300027875|Ga0209283_10082122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2089 | Open in IMG/M |
| 3300027884|Ga0209275_10241516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
| 3300027884|Ga0209275_10348394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300027895|Ga0209624_11050631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300027898|Ga0209067_10622285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300027898|Ga0209067_10668042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300027903|Ga0209488_11061578 | Not Available | 556 | Open in IMG/M |
| 3300027908|Ga0209006_10192876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1773 | Open in IMG/M |
| 3300027911|Ga0209698_10089971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2585 | Open in IMG/M |
| 3300028800|Ga0265338_10138965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1905 | Open in IMG/M |
| 3300028801|Ga0302226_10157783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
| 3300028863|Ga0302218_10078604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
| 3300028866|Ga0302278_10275264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300028906|Ga0308309_11212366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300028906|Ga0308309_11645140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300029883|Ga0311327_10500206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300029914|Ga0311359_10851255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300030007|Ga0311338_12000159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300030841|Ga0075384_11495213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300030879|Ga0265765_1050172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300031236|Ga0302324_101608831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300031524|Ga0302320_11510221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300031573|Ga0310915_11240392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300031715|Ga0307476_10502366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
| 3300031715|Ga0307476_10590992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300031720|Ga0307469_12412908 | Not Available | 513 | Open in IMG/M |
| 3300031754|Ga0307475_11021978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300031823|Ga0307478_10150044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1849 | Open in IMG/M |
| 3300031823|Ga0307478_10152111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1836 | Open in IMG/M |
| 3300031938|Ga0308175_101244286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300031946|Ga0310910_10234088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1433 | Open in IMG/M |
| 3300031962|Ga0307479_11072669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300031996|Ga0308176_12185451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300032160|Ga0311301_10947999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
| 3300032160|Ga0311301_11078063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
| 3300032805|Ga0335078_11802097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300032828|Ga0335080_10810848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300033158|Ga0335077_10420116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1432 | Open in IMG/M |
| 3300033158|Ga0335077_10771401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 982 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.26% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.42% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.67% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.67% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.83% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.92% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000650 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022728 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026011 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030841 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100201347 | 3300000567 | Peatlands Soil | MLALRYLLIAGGLGMILVAVSILGYDLYRELLYRRALAXXGXGIDLAGVQHCG |
| AP72_2010_repI_A1DRAFT_10173443 | 3300000650 | Forest Soil | MLALKYLLMCGGFGMILVAVGILGYDWYAETLYRRALATPGAHVPPIPERR |
| JGI12053J15887_101300641 | 3300001661 | Forest Soil | MLALKYLLVVGGLGMILVAVSILAYDLYREMLYRRRLAVTGAGSVEP |
| JGIcombinedJ51221_103377071 | 3300003505 | Forest Soil | MLALKYLLITGGLGMILVAVGILGYDLYRELLYRRALATPGGSSLGGSLPAQP |
| Ga0062595_1013660351 | 3300004479 | Soil | MLALRNLLMYGGFGMILVALGILAFDLYRELLYRRALATPGITPIPR |
| Ga0070713_1000226671 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLALKYLLMFGGFGMILVAVGILGYDLYAEMLRRRALATPGADVPPI |
| Ga0070739_101391833 | 3300005532 | Surface Soil | MLFLKYILMAGGFGMILIAIAILGYDLYLNLQYKRALAIPGAT |
| Ga0070733_102168871 | 3300005541 | Surface Soil | MLALRYLLMCGGLGMILVAVGILGYDLYHELLYRRALATPGAEALPPL |
| Ga0070733_103375931 | 3300005541 | Surface Soil | MLALKYLLITCGVGMMIAAVCILTYDLYREMLYRRAL |
| Ga0070733_110046401 | 3300005541 | Surface Soil | MLALKYFLIAAGLGMILVAVSILGFDLYRELLYRRAV |
| Ga0066670_110269742 | 3300005560 | Soil | MLTLKYLLIAGGLGMILVAVSILGYDLYREFVYRRLLATPGASPLPPL |
| Ga0068855_1005522753 | 3300005563 | Corn Rhizosphere | MLVLRNLLMYGGFGMILVAMGILGYDLYLEVLYRKALATPGVTPI |
| Ga0066693_100265784 | 3300005566 | Soil | MLALRNLLMYGGFGMILAAMGILAYDLYREVAYRRALAMPGITLIP |
| Ga0070764_100138826 | 3300005712 | Soil | MLTLKVLLMAGGLGMILAAVCILGYDLYRELARRSAVA |
| Ga0075290_10231393 | 3300005889 | Rice Paddy Soil | MLVLRNLLMYGGFGMILVAVGILGYDLYLEVLYRK |
| Ga0066788_100045201 | 3300005944 | Soil | MTTLKYLLMAGGFGMMFAALGILIYDLYRERLYRN |
| Ga0075014_1009765112 | 3300006174 | Watersheds | MLTLKYLLMSGGFGMILVAMGILGYDLYEDVLYRRALATPGAALPAATK |
| Ga0066658_104688662 | 3300006794 | Soil | MLALKYLLITGGLGMMIAAVCILTYDLYREMLYRRTLETPGGTVTA |
| Ga0075424_1009763801 | 3300006904 | Populus Rhizosphere | MLALRYLLMCSGLGMILVAVGILGYDLYREWLYRSAL |
| Ga0116218_10412711 | 3300009522 | Peatlands Soil | MLALKYLLMAGGLGMILVAVSILGYDSYRELLYRRALAAPGAGTLPPLPQ |
| Ga0116221_10980903 | 3300009523 | Peatlands Soil | MLALRYLLIAGGLGMILVAVSILGYDLYRELLYRRALATPGASPVPPLP |
| Ga0116106_11479881 | 3300009645 | Peatland | MLALKYLLITGGLGMMFAALCMLTYDLHREMVYRRALETP |
| Ga0136449_1004772191 | 3300010379 | Peatlands Soil | MLALRYLLITCGVGMMIAAVCILTYDLYREMLYRRLLATP |
| Ga0137398_109739221 | 3300012683 | Vadose Zone Soil | MLALRNLLIAGGLGMILVAVSILLYDLYHEVLYRRAIAEP |
| Ga0164307_117332443 | 3300012987 | Soil | MLALRYLLMCGGLGMILVAVGILGDDLYREMLYRRALAMPG |
| Ga0181523_101314834 | 3300014165 | Bog | MLALKYLLITGGLGMMIAAVGILIYDLYRDLLYRRASMT |
| Ga0181531_100472964 | 3300014169 | Bog | MLALKYLLITGGLGMIFAAVCILTYDLYREMLYRRALE |
| Ga0182036_112430821 | 3300016270 | Soil | MLALRYLLMCGGLGMILVAVGILGYDLYRELLYRRAMATPGLTPIPAEP |
| Ga0182037_104863521 | 3300016404 | Soil | MLALKYLLMCGGLGMILAALSILGYDSYRELLYRKALATPGSTLPA |
| Ga0187821_101480641 | 3300017936 | Freshwater Sediment | MLVLRNLLMYGGFGMILVALGILAFDLYRELLYRRALATPG |
| Ga0187808_105913033 | 3300017942 | Freshwater Sediment | MLALKYLLMTGGLGMILVAVGILGYDSYRELLYRRALATPGG |
| Ga0187819_101127893 | 3300017943 | Freshwater Sediment | MLALKYLLITGGLGMILVAVSILGYDLYRELMYRRALAA |
| Ga0187817_100338475 | 3300017955 | Freshwater Sediment | MLALRYLLILGGLGMILAAVSILGYALYRERLFLW |
| Ga0187779_100200767 | 3300017959 | Tropical Peatland | MLALKYLLVAGGLGMILAAVSILGYDLYRELLYRRA |
| Ga0187779_113266203 | 3300017959 | Tropical Peatland | MLALKYLLLTVGLGMILAAVSILSYDLYLYLLYRGSLATPGDGTRL |
| Ga0187781_103876901 | 3300017972 | Tropical Peatland | MLALKYLLISVGLGMILVAVSILAYDLYRELLYRRA |
| Ga0187780_103125131 | 3300017973 | Tropical Peatland | MLALKYLLISGGLGMILAAVSILGYDLYRELLYRRALA |
| Ga0187780_111206481 | 3300017973 | Tropical Peatland | MLALKYLLVAGGLGMILAAVSILGYDLYRELLYRRAQATPG |
| Ga0187862_103193871 | 3300018040 | Peatland | MLALKYLLIMGGLGMMLAAVCILTYDLYREMLYRRA |
| Ga0187771_102784923 | 3300018088 | Tropical Peatland | MLALKYLLISGGLGMILVAVGILGYDLFRELQYRRALATPGAGALPPV |
| Ga0066655_101646311 | 3300018431 | Grasslands Soil | MLALKYLLISGGLGMILAALSILSYDLYRELMYRRS |
| Ga0210395_102369011 | 3300020582 | Soil | MLTLKYLLMCGGFGMILVAVGILGYDLYLEMLYRRVLAA |
| Ga0210401_102172573 | 3300020583 | Soil | MLALRYLLITCGVGMMIAAVCILTYDIYREMLYRRLLQTPG |
| Ga0210388_117848361 | 3300021181 | Soil | MLALKYLLIAGGLGMIFVALAILLYDVYREVLYRRALAAPEGTVVVPPHPEMR |
| Ga0210385_100206216 | 3300021402 | Soil | MLALRYLLITCGVGMMIAAVCILTYDLYRELLYRRLVATPGGA |
| Ga0210387_103133883 | 3300021405 | Soil | MLALRNLLMAGGLGMILVAVSILLYDLYHEVMYRRA |
| Ga0210386_103603544 | 3300021406 | Soil | MLTLKYLLMCGGFGMILVAVGILGYDLYLEMLYRRALAAPGAALPPAAKWR |
| Ga0210386_113169582 | 3300021406 | Soil | MLALRYLLITCGVGMMIAAVCILTYHLYREMLYRRLLATPGRAVS |
| Ga0210394_104759641 | 3300021420 | Soil | MLALKYLLITGGLGMILVAMSILAYDLYRELMYRRAL |
| Ga0210384_104343343 | 3300021432 | Soil | MLALKYLLVTCGLGMILAALSILAYDLYLEMLYRRALAA |
| Ga0210391_102550543 | 3300021433 | Soil | MLALRDLLIAGGLGMILVAVSILLYDLYQEVLYRRALTAPIGEG |
| Ga0210402_101744294 | 3300021478 | Soil | MLTLKQWLIAGGLGMILTAASILSYDLYRAVLYRRALSTPGARSAAPLP |
| Ga0210409_103943121 | 3300021559 | Soil | MLTLKYLLMCGGFGMILVAVGILGYDLYLEMLYRRVLAAPGA |
| Ga0126371_131151971 | 3300021560 | Tropical Forest Soil | MLALRYLLMCGGLGMILVAMGILGYDLYRELLYRRAMATPGVTPIPAEPEWR |
| Ga0224566_1072353 | 3300022728 | Plant Litter | MLALKYLLIMCGLGMIFGAVCILTYDLYRELLYRRALETPGGAVSARP |
| Ga0247668_11060551 | 3300024331 | Soil | MLALRYLLMCGGLGMILVAVGILGYDLYREWLYRSALATPG |
| Ga0208820_11203933 | 3300025576 | Peatland | MLALRYLLITGGLGMILAAVSILGYDLYRELMYRRALATPGEGPL |
| Ga0208691_10080291 | 3300025612 | Peatland | MLALKYLLIMCGLGMIFGAVCILTYDLYREMLYRRALE |
| Ga0208532_10148913 | 3300026011 | Rice Paddy Soil | MLVLRNLLMYGGFGMILVAVGILGYDLYLEVLYRKALATPGV |
| Ga0207677_105734613 | 3300026023 | Miscanthus Rhizosphere | MLVLRNLLMYGGFGMILMAMGILGYDLYLEVLYRKALATPGVTPIAT |
| Ga0209377_11744323 | 3300026334 | Soil | MLALRYLLMCGGFGMILVAVGILGFDLYEEALYRRALATPGAALPHVTKCR |
| Ga0257154_10060943 | 3300026467 | Soil | MLVLKYLLMSGGVGMMIVAVGILAYDLYREVLYRRALATT |
| Ga0209215_10259561 | 3300027266 | Forest Soil | MLALKYLLMTGGLGLMLAALGILGYDLYREILYRRALSTPGATV |
| Ga0209219_11102822 | 3300027565 | Forest Soil | MLALKYLLITGGLGMILAALGILGYDLYRELLYRRALATPGTGTVLAPP |
| Ga0209420_10565541 | 3300027648 | Forest Soil | MLALKYLLITCGVGMMIAAVCMLTYDLYREMLYRR |
| Ga0209007_10672743 | 3300027652 | Forest Soil | MLALRYLLITCGLGMIFAAVCILTYDLYREMAYRRALETPGEAA |
| Ga0209011_11110671 | 3300027678 | Forest Soil | MLALKYLLVVGGLGMILVAVSILAYDLYREMLYRRTLAVTG |
| Ga0209447_100609361 | 3300027701 | Bog Forest Soil | MLALRYLLITCGVGMMIAAVCILTYDLYREMLYRRLLATPGGA |
| Ga0209039_101887231 | 3300027825 | Bog Forest Soil | MLALKYLLITGGLGMILLAVCILTYDLYREMLYRRALEAP |
| Ga0209517_100088051 | 3300027854 | Peatlands Soil | MLALRYLLIAGGLGMILVAVSILGYDLYRELLYRRALATPG |
| Ga0209283_100821221 | 3300027875 | Vadose Zone Soil | MLALKYLLIVGGLGMILVAVSILAYDLYREMLYRR |
| Ga0209275_102415161 | 3300027884 | Soil | MLALKYLLITGGLGMILVAMSILAYDLYRELMYRRA |
| Ga0209275_103483941 | 3300027884 | Soil | MLALRYLLITCGLGMIFAAVCILTYDLYREMAYRRALET |
| Ga0209624_110506312 | 3300027895 | Forest Soil | MLALKNLLMAGGLGMILVALGILSYDLYQELLYRRALAAPARLAH |
| Ga0209067_106222853 | 3300027898 | Watersheds | MLALKYLLMAGGLGMILVAVSILGYDLYRELLYRRAVATSGTGTL |
| Ga0209067_106680421 | 3300027898 | Watersheds | MLALKYLLISGGLGMILVAVSILAYDLYREMLYRR |
| Ga0209488_110615783 | 3300027903 | Vadose Zone Soil | MLALKYLLITGGVGMMIVAVCILAFDLYREFLYRR |
| Ga0209006_101928761 | 3300027908 | Forest Soil | MLALKDLLFAGGLGMILVAVSILLYDLYREVLYRRALAAPVGEGAV |
| Ga0209698_100899711 | 3300027911 | Watersheds | MLALRYLLMSVGLGMILVAVSILAYDLFREWTYRRAL |
| Ga0265338_101389651 | 3300028800 | Rhizosphere | MLALKYLLIAGVLGMILVAVSILGYDLYRELLYRRALATPGAGT |
| Ga0302226_101577833 | 3300028801 | Palsa | MLALKYLLITGGLGMMIAAVCILTYDLYREMLYRRLLETP |
| Ga0302218_100786043 | 3300028863 | Palsa | MLALKYLLMMGGLGMIFAAVSILTYDLYREMLYRRALETPGG |
| Ga0302278_102752641 | 3300028866 | Bog | MLALKYLLMTGGLGMILAAVCILAYDLYREMLYRRAMEAPGGAPA |
| Ga0308309_112123661 | 3300028906 | Soil | MLALKYLLIAGGLGMILVAVSILGYDVYRELLYRRALASPG |
| Ga0308309_116451402 | 3300028906 | Soil | MLALKYLLITCGLGMIIAAVCILTYDLYRELLYRRALETPRGA |
| Ga0311327_105002063 | 3300029883 | Bog | MVALKYLLITGGLGMIFEAVCILTYDLYRELLYRRLLETPGGAET |
| Ga0311359_108512553 | 3300029914 | Bog | MVALKYLLITGGLGMIFEAVCILTYDLYRELLYRRLL |
| Ga0311338_120001591 | 3300030007 | Palsa | MLALKYLLITCGVGMMIAAVCILTYDLYREMLYRRT |
| Ga0075384_114952133 | 3300030841 | Soil | MLALKYLLIAGGLGMILVAVSILGYDLYRELMYRRA |
| Ga0265765_10501722 | 3300030879 | Soil | MLALKYLLITCGVAMMIAALCILTYDLYREMLYRRLLET |
| Ga0302324_1016088311 | 3300031236 | Palsa | MLALKYLLISCGLGMILAAVILLAYDFYRELLYRRA |
| Ga0302320_115102212 | 3300031524 | Bog | MLALKFLLMMGGLGMIFAAVGILTYDLYREMLYRRAQETPGGA |
| Ga0310915_112403921 | 3300031573 | Soil | MLALKYLLMIGGFGMILAAIGILGYDLYAETLYRRALATPGAAMPPE |
| Ga0307476_105023661 | 3300031715 | Hardwood Forest Soil | MLALKYLLVSVGVGMMVVAVGILGYDLYREMVYRK |
| Ga0307476_105909923 | 3300031715 | Hardwood Forest Soil | MLALRYLLITGGLGMILVAVGILGYDLYRELLYRRALATPGSTVPPLPQ |
| Ga0307469_124129081 | 3300031720 | Hardwood Forest Soil | MLALRTLLMMVGVGMIAAAVFILTYDLYREIVYRRALAEPEG |
| Ga0307475_110219781 | 3300031754 | Hardwood Forest Soil | MLALKYLLMTGGVAMMVAAVGILTYDLYREMSYRRTME |
| Ga0307478_101500441 | 3300031823 | Hardwood Forest Soil | MLALKYLLMAGGFGMIIVAVCILAYDLYREVLYRRAS |
| Ga0307478_101521111 | 3300031823 | Hardwood Forest Soil | MLALKYLLMCGGFGMILVAVGILGYDLYLEMLYRRALAAPGAALP |
| Ga0308175_1012442863 | 3300031938 | Soil | MLVLRNLLMYGGFGMILVAVGILGYDLYLEVLYRKAL |
| Ga0310910_102340883 | 3300031946 | Soil | MLALKYLLMCGGLGMILAALSILGYDSYRELLYRK |
| Ga0307479_110726691 | 3300031962 | Hardwood Forest Soil | MLALKYLLITGGLGMILVAMSILGYDLYRELMYRRPLAAPGAGPVPAL |
| Ga0308176_121854511 | 3300031996 | Soil | MLVLRNLLMYGGFGMILVAVGILGYDLYLEVLYRKALATPGVT |
| Ga0311301_109479993 | 3300032160 | Peatlands Soil | MLALKYLLMAGGLGMILVAVSILGYDSYRELLYRRALAAPGG |
| Ga0311301_110780633 | 3300032160 | Peatlands Soil | MLALRYLLIAGGLGMILVAVGILGYDLYRELLYRRALATPGADA |
| Ga0335078_118020972 | 3300032805 | Soil | MLALRYLLISVGLGMILVAVSILGYDLYRELRHRRALAAPGAGPVPPLP |
| Ga0335080_108108483 | 3300032828 | Soil | MLALRYLLMCGGLGMILVAVGILTIDGYREILYRKA |
| Ga0335077_104201163 | 3300033158 | Soil | MLALKYLLIAGGLGMILVAVCILLYDLYREVLCRRALAAPAGEVVV |
| Ga0335077_107714013 | 3300033158 | Soil | MLFVKHMLMMGGIGMILVAVGILTYDGILEMHYRR |
| ⦗Top⦘ |