| Basic Information | |
|---|---|
| Family ID | F089281 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 43 residues |
| Representative Sequence | TFGKMLMDHRAHFQRTLKRPPAEFAALWDWAEKHGVVQQAQ |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.83 % |
| % of genes near scaffold ends (potentially truncated) | 95.41 % |
| % of genes from short scaffolds (< 2000 bps) | 92.66 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.165 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (18.349 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.275 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.881 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF01554 | MatE | 8.26 |
| PF07969 | Amidohydro_3 | 4.59 |
| PF16277 | DUF4926 | 1.83 |
| PF13289 | SIR2_2 | 1.83 |
| PF08734 | GYD | 1.83 |
| PF14076 | DUF4258 | 1.83 |
| PF01936 | NYN | 1.83 |
| PF03372 | Exo_endo_phos | 0.92 |
| PF12872 | OST-HTH | 0.92 |
| PF01641 | SelR | 0.92 |
| PF01914 | MarC | 0.92 |
| PF12867 | DinB_2 | 0.92 |
| PF00144 | Beta-lactamase | 0.92 |
| PF00266 | Aminotran_5 | 0.92 |
| PF02433 | FixO | 0.92 |
| PF14667 | Polysacc_synt_C | 0.92 |
| PF00023 | Ank | 0.92 |
| PF01790 | LGT | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 1.83 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.83 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.92 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
| COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.92 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.92 |
| COG2993 | Cbb3-type cytochrome oxidase, cytochrome c subunit FixO | Energy production and conversion [C] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.17 % |
| Unclassified | root | N/A | 1.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16963498 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
| 2124908006|FWIROz_GJ87FRN02GPMY7 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 505 | Open in IMG/M |
| 2189573002|GZIGXIF01A911I | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 504 | Open in IMG/M |
| 3300000890|JGI11643J12802_11599096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1244 | Open in IMG/M |
| 3300005093|Ga0062594_101491054 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300005093|Ga0062594_102919800 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005181|Ga0066678_10187276 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300005186|Ga0066676_10163570 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300005187|Ga0066675_11458717 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
| 3300005335|Ga0070666_11288462 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005337|Ga0070682_100643802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 843 | Open in IMG/M |
| 3300005471|Ga0070698_102154152 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005556|Ga0066707_10319374 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300005566|Ga0066693_10306046 | Not Available | 636 | Open in IMG/M |
| 3300005568|Ga0066703_10462806 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005576|Ga0066708_10485210 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005764|Ga0066903_102411252 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300005764|Ga0066903_105360471 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005844|Ga0068862_101709231 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300006046|Ga0066652_100122534 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
| 3300006046|Ga0066652_100304492 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300006046|Ga0066652_101044609 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 774 | Open in IMG/M |
| 3300006175|Ga0070712_100219101 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1505 | Open in IMG/M |
| 3300006175|Ga0070712_100795022 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300006176|Ga0070765_101018295 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 783 | Open in IMG/M |
| 3300006797|Ga0066659_10624920 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300006797|Ga0066659_11411260 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 582 | Open in IMG/M |
| 3300006954|Ga0079219_12282283 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300007076|Ga0075435_100662842 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300007255|Ga0099791_10470576 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300009012|Ga0066710_101139510 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300009012|Ga0066710_102404393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
| 3300009012|Ga0066710_102761138 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 697 | Open in IMG/M |
| 3300009012|Ga0066710_102791162 | Not Available | 691 | Open in IMG/M |
| 3300009038|Ga0099829_10628748 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 892 | Open in IMG/M |
| 3300009137|Ga0066709_100471560 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1761 | Open in IMG/M |
| 3300009545|Ga0105237_10873616 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 906 | Open in IMG/M |
| 3300009553|Ga0105249_10033144 | All Organisms → cellular organisms → Bacteria | 4676 | Open in IMG/M |
| 3300010043|Ga0126380_11590179 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300010043|Ga0126380_12135066 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010320|Ga0134109_10314775 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300010325|Ga0134064_10148117 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 809 | Open in IMG/M |
| 3300010335|Ga0134063_10509137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 603 | Open in IMG/M |
| 3300010358|Ga0126370_11102404 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300010359|Ga0126376_10632990 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1017 | Open in IMG/M |
| 3300010359|Ga0126376_12653864 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300010366|Ga0126379_11241608 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300010373|Ga0134128_10510075 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1341 | Open in IMG/M |
| 3300010396|Ga0134126_10409526 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1574 | Open in IMG/M |
| 3300010397|Ga0134124_10434805 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1256 | Open in IMG/M |
| 3300010397|Ga0134124_11751332 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300010398|Ga0126383_10980258 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 933 | Open in IMG/M |
| 3300011444|Ga0137463_1092666 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300012189|Ga0137388_11410720 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012198|Ga0137364_10175261 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300012201|Ga0137365_10301770 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300012201|Ga0137365_10414319 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 993 | Open in IMG/M |
| 3300012202|Ga0137363_10734463 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 836 | Open in IMG/M |
| 3300012202|Ga0137363_10815716 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300012211|Ga0137377_10607812 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300012211|Ga0137377_10943148 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300012349|Ga0137387_10278732 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1207 | Open in IMG/M |
| 3300012353|Ga0137367_11129666 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 528 | Open in IMG/M |
| 3300012359|Ga0137385_10248095 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300012359|Ga0137385_10997824 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300012362|Ga0137361_11617025 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
| 3300012532|Ga0137373_10684917 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 766 | Open in IMG/M |
| 3300012903|Ga0157289_10048581 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300012922|Ga0137394_10028181 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4547 | Open in IMG/M |
| 3300012924|Ga0137413_11384820 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012971|Ga0126369_12838040 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012971|Ga0126369_13272378 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012976|Ga0134076_10238234 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 773 | Open in IMG/M |
| 3300012977|Ga0134087_10077376 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300012987|Ga0164307_10517724 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 905 | Open in IMG/M |
| 3300013297|Ga0157378_12632169 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300014157|Ga0134078_10062413 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300015357|Ga0134072_10463233 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300015373|Ga0132257_104047007 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300017654|Ga0134069_1234232 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300018066|Ga0184617_1258898 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 522 | Open in IMG/M |
| 3300018076|Ga0184609_10523550 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 538 | Open in IMG/M |
| 3300018482|Ga0066669_11097488 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300020001|Ga0193731_1138567 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300020062|Ga0193724_1086948 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300021080|Ga0210382_10228998 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300025315|Ga0207697_10388454 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300025903|Ga0207680_11230572 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300025928|Ga0207700_10334306 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1315 | Open in IMG/M |
| 3300025944|Ga0207661_10937363 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300026309|Ga0209055_1018185 | All Organisms → cellular organisms → Bacteria | 3437 | Open in IMG/M |
| 3300026322|Ga0209687_1001879 | All Organisms → cellular organisms → Bacteria | 7092 | Open in IMG/M |
| 3300026326|Ga0209801_1120584 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300026523|Ga0209808_1224028 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 606 | Open in IMG/M |
| 3300026528|Ga0209378_1159466 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300026538|Ga0209056_10023166 | All Organisms → cellular organisms → Bacteria | 6015 | Open in IMG/M |
| 3300028146|Ga0247682_1115150 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300028536|Ga0137415_10040453 | All Organisms → cellular organisms → Bacteria | 4560 | Open in IMG/M |
| 3300028778|Ga0307288_10269462 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 671 | Open in IMG/M |
| 3300028790|Ga0307283_10008360 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300028792|Ga0307504_10374913 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300028906|Ga0308309_11488589 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 578 | Open in IMG/M |
| 3300030973|Ga0075395_11054004 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031122|Ga0170822_10112113 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300031231|Ga0170824_123712259 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300031446|Ga0170820_10516506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Hyalangium → unclassified Hyalangium → Hyalangium sp. H56D21 | 1040 | Open in IMG/M |
| 3300031474|Ga0170818_102050863 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031474|Ga0170818_109325044 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300031947|Ga0310909_11354194 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 571 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.59% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.92% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2124908006 | Soil microbial communities from sample at FACE Site Metagenome WIR_Oz2 | Environmental | Open in IMG/M |
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_00701200 | 2088090014 | Soil | LMDHRAHFQRTLKRPPVEFIVLWDWAEKHGIVQQAQ |
| FWIROz_09205390 | 2124908006 | Soil | MTFANMLMAHQVHFQKALKPPPSEFTALWDWAEKRGLVQRVH |
| FE1_06605770 | 2189573002 | Grass Soil | ADGMTLGKMLTEHRTHFGRTLKQAPAEFTALWDWAEKRGIVQQAR |
| JGI11643J12802_115990962 | 3300000890 | Soil | ADPNGDGTDGMTFGKMLTSHRSLFQRTHKSPPPQFVALWDWAEQHGIIKQIQ* |
| Ga0062594_1014910541 | 3300005093 | Soil | PSRAGADGMTFANMLMAHQVHFQKALKPPPSEFTALWDWAEKRGLVQRVH* |
| Ga0062594_1029198001 | 3300005093 | Soil | RAGADGMTFGKLLKDHRAHFEHKKQPAEFVALWNWAEQHGIIQQTP* |
| Ga0066678_101872764 | 3300005181 | Soil | FGKMLTDHRAHFGRTHKQPPAEFTALWDWVEKHGIVQQAR* |
| Ga0066676_101635705 | 3300005186 | Soil | NRAGADGMTFGNMLMAHRAHFQQTLKRPPTEFATLWDWAEKRGIVQQILTRNL* |
| Ga0066675_114587172 | 3300005187 | Soil | GMTLGNMLMTHQAHFQRTLKPPPAEFTALWDWAEKRGIVQKTQ* |
| Ga0070666_112884621 | 3300005335 | Switchgrass Rhizosphere | GTDGMTFGKMLMNHRAHFQRTHKSPPPQFVALWDWAEQHRIIQQIQ* |
| Ga0070682_1006438021 | 3300005337 | Corn Rhizosphere | GADPNRAGADGMTFGKLLKDHRAHFEHKKQPAEFVALWNWAEQHGIIQQTP* |
| Ga0070698_1021541521 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GMTFGKMLMNHRAHFQRTHKSPPPQFVALWDWAEQHRIIQQIQ* |
| Ga0066707_103193741 | 3300005556 | Soil | GKMLMDHRAHFQRTRKNPPVEFATLWDWAEKHGIVQQAWQIQR* |
| Ga0066693_103060462 | 3300005566 | Soil | KMLTEHRAHFGRTLKRPPAEFAALWDWAEKHGIIQPAK* |
| Ga0066703_104628061 | 3300005568 | Soil | ADGMTFEKMLKDHQAHFTGTLKRPPAEFAALWDWAAKRGTVQQAQ* |
| Ga0066708_104852103 | 3300005576 | Soil | GMTFGNMLMAHRAHFQQTLKPPPTEFATLWDWAEKRGIVQRIH* |
| Ga0066903_1024112521 | 3300005764 | Tropical Forest Soil | TFGKMLMDHRAHFQRTHKSPPPQFAALWDWAEQHGIIKQIQ* |
| Ga0066903_1053604711 | 3300005764 | Tropical Forest Soil | NRAGADGLKFSNMMRTHQVHFQQKLKGLPTEFAALWDWAEKRGIVQQTH* |
| Ga0068862_1017092311 | 3300005844 | Switchgrass Rhizosphere | TDGMTFGKMLTSHRSLFQRTDKSPPPQFVALWDWAEQHGIIKQIQ* |
| Ga0066652_1001225343 | 3300006046 | Soil | GMTFGNMLMAHRAHFQQTLKRPPTEFATLWDWAEKRGIVQQILTRNL* |
| Ga0066652_1003044923 | 3300006046 | Soil | ADGMTFGKMLTEHRAHFGRTLKHPPTEFAALWDWAEKHGIIQPAQ* |
| Ga0066652_1010446091 | 3300006046 | Soil | MTFGKMLTEHRAHFGRTLKHPPTEFAALWDWAEKHG |
| Ga0070712_1002191011 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GADGMTFGKMLTEHRAHFGRTHKQPPAEFAALWDWAEKHGIIQPAQ* |
| Ga0070712_1007950222 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GADGMTLGKMLKDHRAHFQRTHKSPPAEFTALWDWAEQHGIVQQTQ* |
| Ga0070765_1010182952 | 3300006176 | Soil | LTEHRAHFGRTHKRPPAEFTALGDWAEKHGIIQPAR* |
| Ga0066659_106249203 | 3300006797 | Soil | AGADGMTFGKMLTEHRAHFQRTHKPPPAEFTALLDWAEKHGIVQQAQ* |
| Ga0066659_114112602 | 3300006797 | Soil | LTDHRAHFGRTHKQPPAEFAALWDWAEKHGIIQQAR* |
| Ga0079219_122822831 | 3300006954 | Agricultural Soil | MTFGKMLMDHRAHFQRLRKSPPPQFIALWDWAEQHGIIQQIQ* |
| Ga0075435_1006628422 | 3300007076 | Populus Rhizosphere | MTFGKMLADHKGHFQRTHKSPPPQFVALWDWAEQHGIIQQIQ* |
| Ga0099791_104705762 | 3300007255 | Vadose Zone Soil | GMTFGKMLIEHRAHFQRTHKPPPPEFTALWDWAEKHGIVQ* |
| Ga0066710_1011395104 | 3300009012 | Grasslands Soil | GKMLMDHRAHFQRTRKNPPVEFATLWDWAEKHGIVQQAWQIQR |
| Ga0066710_1024043933 | 3300009012 | Grasslands Soil | LMAHRAHFQQTLKRPPTEFATLWDWAEKRGIVQQILTRNL |
| Ga0066710_1027611382 | 3300009012 | Grasslands Soil | GADGMTFGKMLTDHRAHFRRTHKQPPAEFAALWDWAEKHGIVQQAR |
| Ga0066710_1027911622 | 3300009012 | Grasslands Soil | GMTFAKMLMEHRAHFGRTLKQPPAEFAALWDWAEKHGIIQTAR |
| Ga0099829_106287483 | 3300009038 | Vadose Zone Soil | GMTFGKMLTEHRAHFGRLKPPPVEFAALWDWAEKHGMIQQAR* |
| Ga0066709_1004715604 | 3300009137 | Grasslands Soil | AGADGMTFGNMLMAHRAHFQQTLKRPPTEFATLWDWAEKRGIVQQILTRNL* |
| Ga0105237_108736161 | 3300009545 | Corn Rhizosphere | PEHRAHFGRTLKQPPTEFAALWDWAEKHGIVQQAQ* |
| Ga0105249_100331449 | 3300009553 | Switchgrass Rhizosphere | DGMTLAKLLTEHKAHFARTHKQPPAEFAALWDWAERHGVVH* |
| Ga0126380_115901791 | 3300010043 | Tropical Forest Soil | FGKMLNDHRAHFQRTHQSPPAEFVALWEWGEKHGVVQHG* |
| Ga0126380_121350661 | 3300010043 | Tropical Forest Soil | NILMAHRAHFQQTLKPPPTEFATLWDWAQKRGIVQQIH* |
| Ga0134109_103147751 | 3300010320 | Grasslands Soil | DGMTFGKMLMEHRAHFQRTHKPSPVEFTALWDWAEKHGIVQQAQ* |
| Ga0134064_101481172 | 3300010325 | Grasslands Soil | MTFGNLLTVHRAHFQQMLKPPPAEFATLWDWAEKRGIVQQIH* |
| Ga0134063_105091372 | 3300010335 | Grasslands Soil | PNRTGVDGMTFGKMLKDHQAHFQRTLKSPPEFKALWDWAEKRGIVQKTQ* |
| Ga0126370_111024041 | 3300010358 | Tropical Forest Soil | AGADGMTFGNILMAHRAHFQQTLKPPPTEFATLWDWAQKRGIVQQIH* |
| Ga0126376_106329903 | 3300010359 | Tropical Forest Soil | MLRDHRAQFQRTNKSPPVEFATLWDWADQHEIVQQTQ* |
| Ga0126376_126538641 | 3300010359 | Tropical Forest Soil | KMLMDHRAHFQRTHKSPPPEFVALWDWAEQHEIIHQIQ* |
| Ga0126379_112416081 | 3300010366 | Tropical Forest Soil | TDGMTFGKMLMDHRAHFQRTHKSPPPQFVALWDWAEQHGIIQQIQ* |
| Ga0134128_105100751 | 3300010373 | Terrestrial Soil | KMLTEHKAHFGRTHKQPPAEFAALWDWAEKHGIIQQAQ* |
| Ga0134126_104095263 | 3300010396 | Terrestrial Soil | LTEYKAHFGQTHKQPPAEFAALWDWAEKHRIIQQAQ* |
| Ga0134124_104348053 | 3300010397 | Terrestrial Soil | ADGMTLGKMLKDHRAHFQRTHKSPPAEFTALWDWAEQHGIVQQTQ* |
| Ga0134124_117513321 | 3300010397 | Terrestrial Soil | GMTFGKLLKDHRAHFEHKKQPVEFAALWNWAEQHGIVQQTP* |
| Ga0126383_109802583 | 3300010398 | Tropical Forest Soil | GKILADHRAHFQTTNKSAPTEFATLWDWAEKHGIVQHGQ* |
| Ga0137463_10926661 | 3300011444 | Soil | KMLMVHQVHFQKALKPPPPEFTALWNWAEKRGIVQQIH* |
| Ga0137388_114107202 | 3300012189 | Vadose Zone Soil | TLWNMLMAHRAHFQQTLKPPPAEFATLWDWAEKRGIVQQIH* |
| Ga0137364_101752611 | 3300012198 | Vadose Zone Soil | GADGMTFGNMLMAHRAHFQQTLKPPPTEFATLWDWAEKRGIVQRIH* |
| Ga0137365_103017701 | 3300012201 | Vadose Zone Soil | LMEHRAHFQRTHKPPPVEFTALWDWAEKHGIVQQAQ* |
| Ga0137365_104143192 | 3300012201 | Vadose Zone Soil | MLMDHRAHFQRTRKNPPVEFATLWDWAEKHGIVQQAQQIQR* |
| Ga0137363_107344632 | 3300012202 | Vadose Zone Soil | MAHRTHFQQTLKPPPAEFATLWDWAEKRGIVQQIH* |
| Ga0137363_108157163 | 3300012202 | Vadose Zone Soil | TFGKMLMDHRAHFQRTLKRPPAEFAALWDWAEKHGVVQQAQ* |
| Ga0137377_106078121 | 3300012211 | Vadose Zone Soil | GADGMTFGKMLMDHRAHFQGTHKPPPAEFTALWDWAEKHGIVQQAQ* |
| Ga0137377_109431481 | 3300012211 | Vadose Zone Soil | TFGKMLMDHRAHFQRTRKNPPVEFATLWDWAEKHGIVQQAQQIQR* |
| Ga0137387_102787322 | 3300012349 | Vadose Zone Soil | LMAHRAHFQQTLKRPPTEFATLWDWAEKRGIVQQILTRNL* |
| Ga0137367_111296661 | 3300012353 | Vadose Zone Soil | KMLTEHRAHFGRRLKPPPVEFAALWDWAEKHGIIR* |
| Ga0137385_102480954 | 3300012359 | Vadose Zone Soil | HFQRTRKNPPVEFATLWDWAEKHGIVQQAQQIQR* |
| Ga0137385_109978241 | 3300012359 | Vadose Zone Soil | RAGADGMTFGKMLMDHRAHFQRTLKRPPVEFVVLWDWAEKHGIVQQAQ* |
| Ga0137361_116170251 | 3300012362 | Vadose Zone Soil | EHRAHFGRRLKSPPAEFAALWDWAEKHGIIQQAKK* |
| Ga0137373_106849173 | 3300012532 | Vadose Zone Soil | GMTFGKMLMDHRAHFQRTHKSPPAQLIALWDWAEQHGIIQQIQ* |
| Ga0157289_100485813 | 3300012903 | Soil | MLTEHRAHFGQTHKQPPAEFTALWNWAEKHGIVQQAQ* |
| Ga0137394_100281811 | 3300012922 | Vadose Zone Soil | KMLIEHRAHFQRTHKPPPAEFTALWDWAEKHGMVQ* |
| Ga0137413_113848203 | 3300012924 | Vadose Zone Soil | DGMTLGSMLITHQAHFQRTLKPPPAEFMALWDWAEKRGIVQQIH* |
| Ga0126369_128380401 | 3300012971 | Tropical Forest Soil | DHRAHFQRTHKSPPPQFVALWDWAEQHGIIQQIQ* |
| Ga0126369_132723781 | 3300012971 | Tropical Forest Soil | KFSNMMRTHQVHFQQKLKGLPTEFAALWDWAEKRGIVQQTH* |
| Ga0134076_102382341 | 3300012976 | Grasslands Soil | TFGKMLTEHKSHFGRTHKQPPAEFTALWDWAEKHGIIQPAR* |
| Ga0134087_100773761 | 3300012977 | Grasslands Soil | MTFGKMLTEHRAHFGRTHKQPPAEFTALWDWAEKHGIVQQAR* |
| Ga0164307_105177241 | 3300012987 | Soil | PNRSGANGMTLGKMLKEHRAHFQKALKPPPPEFTALWDWAEQRGIVQQVH* |
| Ga0157378_126321691 | 3300013297 | Miscanthus Rhizosphere | AKMLNEHRQQFAKGKGAPPEFTALWDWAEKHGVVLGK* |
| Ga0134078_100624133 | 3300014157 | Grasslands Soil | GKMLTEHRAHFGKLKPTPVEFTALWDWAEKHGIIQQAR* |
| Ga0134072_104632331 | 3300015357 | Grasslands Soil | RAGADGMTFGNMLMAHRAHFQQTLKRPPTEFATLWDWAEKRGIVQQILTRNL* |
| Ga0132257_1040470072 | 3300015373 | Arabidopsis Rhizosphere | DPNRPATDGLTFGKMLTNHRAHFQQTNSSPPSEFVALWDWAEQHRIIQQIQ* |
| Ga0134069_12342321 | 3300017654 | Grasslands Soil | MDHRAHFQDTLKTPPAEFAALLGWAEKHGIVQQAQ |
| Ga0184617_12588982 | 3300018066 | Groundwater Sediment | DGMTFGKMLTDHRAARLSQRRPMPPEFTALWDWAEKHGIIQQAQ |
| Ga0184609_105235501 | 3300018076 | Groundwater Sediment | FGKMLMDQRAQFRQRRKPPPAQFGALWEWAEKHGIIQQAQ |
| Ga0066669_110974883 | 3300018482 | Grasslands Soil | AGADGMTFGNMLMAHRAHFQQTLKPPPTEFATLWDWAEKRGIVQRIH |
| Ga0193731_11385671 | 3300020001 | Soil | RAGADGMTLGSMLMAHKVHFQKALKPPPPEFTALWDWAEKRGIVQQIH |
| Ga0193724_10869481 | 3300020062 | Soil | MPHQVHFQKALKPPPSEFTALWDWAEKRGIVQQIH |
| Ga0210382_102289982 | 3300021080 | Groundwater Sediment | GKMLTDHRAHFQRTHKSPPAQLIALWDWAEQHGVIQQIQ |
| Ga0207697_103884541 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | SRAGADGMTFANMLMAHQVHFQKALKPPPSEFTALWDWAEKRGLVQQIH |
| Ga0207680_112305722 | 3300025903 | Switchgrass Rhizosphere | PNRAGTDGMTFGKMLMNHRAHFQRTHKSPPPQFVALWDWAEQHRIIQQIQ |
| Ga0207700_103343061 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | FGKMLTEHRAHFGRTQKQPPAEFAALWDWAEKHGIIQPAQ |
| Ga0207661_109373633 | 3300025944 | Corn Rhizosphere | QRGAEPNRAGADGMTFGKLLKDHRAHFEHKKQPAEFVALWNWAEQHGIIQQTP |
| Ga0209055_10181858 | 3300026309 | Soil | MTFGKMLTEHRAHFGRTLKQPPTEFAALWDWAEKHGIVQPAR |
| Ga0209687_10018791 | 3300026322 | Soil | GMTFGKMLTEHRAHFGRTLKQPPTEFAALWDWAEKHGIVQPAR |
| Ga0209801_11205844 | 3300026326 | Soil | ADGMTFEKMLTDHRAHFGRTHKQPPAEFTALWDWVEKHGIVQQAR |
| Ga0209808_12240282 | 3300026523 | Soil | RAGADGMTFGKMLTEHRAHFGKLKPTPVEFAALWDWAEKHGILQQAR |
| Ga0209378_11594661 | 3300026528 | Soil | GADGMTFGKMLTEHRAHFGKLKPTPVEFAALWDWAEKHGIIQQAL |
| Ga0209056_100231661 | 3300026538 | Soil | MTFGKMLTEHRAHFGRTLKQPPTEFAALWDWAEKHGIVQPAQ |
| Ga0247682_11151501 | 3300028146 | Soil | DPNRAGTDGMTFGKMLMNHRAHFQRTHKSPPPQFVALWDWAEQHRIIQQIQ |
| Ga0137415_100404536 | 3300028536 | Vadose Zone Soil | GKMLMAHQVHFQKALKPPPSEFTALWNWAEKRGIVQQIH |
| Ga0307288_102694621 | 3300028778 | Soil | DGMTLAKMLTEHRAHFGQRHKQPPAEFTALWDWAEKHGIVQPAR |
| Ga0307283_100083603 | 3300028790 | Soil | FGKMLKEHRAHFQKALKPPPPEFTALWDWAGKRGIVQQVH |
| Ga0307504_103749131 | 3300028792 | Soil | TFGKMLMDHRAHFQQTHRSPPTEFAALWDWTEKHGIVQQAKQIQR |
| Ga0308309_114885891 | 3300028906 | Soil | LTEHRAHFGRTHKRPPAEFTALGDWAEKHGIIQPAR |
| Ga0075395_110540041 | 3300030973 | Soil | ADGMTLGKMLKDHRAHFQRTHKSPPVEFGALWDWAEQHGIVQQTQ |
| Ga0170822_101121132 | 3300031122 | Forest Soil | TLGKMLKDHRAHFQRTHKSPPAEFTALWDWAEKRGIVQQTQ |
| Ga0170824_1237122593 | 3300031231 | Forest Soil | LMAHKVHFQKTLKPPPEFTALWDWAERRGIVQQTP |
| Ga0170820_105165061 | 3300031446 | Forest Soil | TFGNMLMAHKVHFQKTLKPPPEFTALWDWAERRGIVQQTP |
| Ga0170818_1020508631 | 3300031474 | Forest Soil | DGMTFGKMLTDHRAHFQRTHKSPPAEFIALWDWAEQHGIIQQIQ |
| Ga0170818_1093250443 | 3300031474 | Forest Soil | DGMTFGKMLTDHRAHFQRTLKWPPVEFIVLWDWAKKHGIVQQAQ |
| Ga0310909_113541941 | 3300031947 | Soil | RAGADGMTFGKMLVDHRVYFGRTLKRPPGKFATLWDWAETHGILRQPK |
| ⦗Top⦘ |