NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089281

Metagenome / Metatranscriptome Family F089281

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089281
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 43 residues
Representative Sequence TFGKMLMDHRAHFQRTLKRPPAEFAALWDWAEKHGVVQQAQ
Number of Associated Samples 91
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.83 %
% of genes near scaffold ends (potentially truncated) 95.41 %
% of genes from short scaffolds (< 2000 bps) 92.66 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.165 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(18.349 % of family members)
Environment Ontology (ENVO) Unclassified
(30.275 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.881 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.58%    β-sheet: 0.00%    Coil/Unstructured: 59.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF01554MatE 8.26
PF07969Amidohydro_3 4.59
PF16277DUF4926 1.83
PF13289SIR2_2 1.83
PF08734GYD 1.83
PF14076DUF4258 1.83
PF01936NYN 1.83
PF03372Exo_endo_phos 0.92
PF12872OST-HTH 0.92
PF01641SelR 0.92
PF01914MarC 0.92
PF12867DinB_2 0.92
PF00144Beta-lactamase 0.92
PF00266Aminotran_5 0.92
PF02433FixO 0.92
PF14667Polysacc_synt_C 0.92
PF00023Ank 0.92
PF01790LGT 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG1432NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturationGeneral function prediction only [R] 1.83
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 1.83
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 0.92
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.92
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.92
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.92
COG2095Small neutral amino acid transporter SnatA, MarC familyAmino acid transport and metabolism [E] 0.92
COG2367Beta-lactamase class ADefense mechanisms [V] 0.92
COG2993Cbb3-type cytochrome oxidase, cytochrome c subunit FixOEnergy production and conversion [C] 0.92

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.17 %
UnclassifiedrootN/A1.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16963498All Organisms → cellular organisms → Bacteria2616Open in IMG/M
2124908006|FWIROz_GJ87FRN02GPMY7All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium505Open in IMG/M
2189573002|GZIGXIF01A911IAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia504Open in IMG/M
3300000890|JGI11643J12802_11599096All Organisms → cellular organisms → Bacteria → Proteobacteria1244Open in IMG/M
3300005093|Ga0062594_101491054All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300005093|Ga0062594_102919800All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005181|Ga0066678_10187276All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300005186|Ga0066676_10163570All Organisms → cellular organisms → Bacteria1408Open in IMG/M
3300005187|Ga0066675_11458717All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium500Open in IMG/M
3300005335|Ga0070666_11288462All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005337|Ga0070682_100643802All Organisms → cellular organisms → Bacteria → Proteobacteria843Open in IMG/M
3300005471|Ga0070698_102154152All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005556|Ga0066707_10319374All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300005566|Ga0066693_10306046Not Available636Open in IMG/M
3300005568|Ga0066703_10462806All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300005576|Ga0066708_10485210All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300005764|Ga0066903_102411252All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300005764|Ga0066903_105360471All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300005844|Ga0068862_101709231All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300006046|Ga0066652_100122534All Organisms → cellular organisms → Bacteria2137Open in IMG/M
3300006046|Ga0066652_100304492All Organisms → cellular organisms → Bacteria1417Open in IMG/M
3300006046|Ga0066652_101044609All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium774Open in IMG/M
3300006175|Ga0070712_100219101All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1505Open in IMG/M
3300006175|Ga0070712_100795022All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300006176|Ga0070765_101018295All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium783Open in IMG/M
3300006797|Ga0066659_10624920All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300006797|Ga0066659_11411260All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium582Open in IMG/M
3300006954|Ga0079219_12282283All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300007076|Ga0075435_100662842All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300007255|Ga0099791_10470576All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300009012|Ga0066710_101139510All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300009012|Ga0066710_102404393All Organisms → cellular organisms → Bacteria → Proteobacteria764Open in IMG/M
3300009012|Ga0066710_102761138All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium697Open in IMG/M
3300009012|Ga0066710_102791162Not Available691Open in IMG/M
3300009038|Ga0099829_10628748All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium892Open in IMG/M
3300009137|Ga0066709_100471560All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1761Open in IMG/M
3300009545|Ga0105237_10873616All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium906Open in IMG/M
3300009553|Ga0105249_10033144All Organisms → cellular organisms → Bacteria4676Open in IMG/M
3300010043|Ga0126380_11590179All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300010043|Ga0126380_12135066All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300010320|Ga0134109_10314775All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300010325|Ga0134064_10148117All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium809Open in IMG/M
3300010335|Ga0134063_10509137All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium603Open in IMG/M
3300010358|Ga0126370_11102404All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300010359|Ga0126376_10632990All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1017Open in IMG/M
3300010359|Ga0126376_12653864All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300010366|Ga0126379_11241608All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300010373|Ga0134128_10510075All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1341Open in IMG/M
3300010396|Ga0134126_10409526All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1574Open in IMG/M
3300010397|Ga0134124_10434805All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1256Open in IMG/M
3300010397|Ga0134124_11751332All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300010398|Ga0126383_10980258All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium933Open in IMG/M
3300011444|Ga0137463_1092666All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300012189|Ga0137388_11410720All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300012198|Ga0137364_10175261All Organisms → cellular organisms → Bacteria1562Open in IMG/M
3300012201|Ga0137365_10301770All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300012201|Ga0137365_10414319All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium993Open in IMG/M
3300012202|Ga0137363_10734463All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium836Open in IMG/M
3300012202|Ga0137363_10815716All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300012211|Ga0137377_10607812All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300012211|Ga0137377_10943148All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300012349|Ga0137387_10278732All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1207Open in IMG/M
3300012353|Ga0137367_11129666All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium528Open in IMG/M
3300012359|Ga0137385_10248095All Organisms → cellular organisms → Bacteria1542Open in IMG/M
3300012359|Ga0137385_10997824All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300012362|Ga0137361_11617025All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium569Open in IMG/M
3300012532|Ga0137373_10684917All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter766Open in IMG/M
3300012903|Ga0157289_10048581All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300012922|Ga0137394_10028181All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus4547Open in IMG/M
3300012924|Ga0137413_11384820All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300012971|Ga0126369_12838040All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300012971|Ga0126369_13272378All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300012976|Ga0134076_10238234All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia773Open in IMG/M
3300012977|Ga0134087_10077376All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300012987|Ga0164307_10517724All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus905Open in IMG/M
3300013297|Ga0157378_12632169All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300014157|Ga0134078_10062413All Organisms → cellular organisms → Bacteria1318Open in IMG/M
3300015357|Ga0134072_10463233All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300015373|Ga0132257_104047007All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300017654|Ga0134069_1234232All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300018066|Ga0184617_1258898All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium522Open in IMG/M
3300018076|Ga0184609_10523550All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium538Open in IMG/M
3300018482|Ga0066669_11097488All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300020001|Ga0193731_1138567All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300020062|Ga0193724_1086948All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300021080|Ga0210382_10228998All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300025315|Ga0207697_10388454All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300025903|Ga0207680_11230572All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300025928|Ga0207700_10334306All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1315Open in IMG/M
3300025944|Ga0207661_10937363All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300026309|Ga0209055_1018185All Organisms → cellular organisms → Bacteria3437Open in IMG/M
3300026322|Ga0209687_1001879All Organisms → cellular organisms → Bacteria7092Open in IMG/M
3300026326|Ga0209801_1120584All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300026523|Ga0209808_1224028All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium606Open in IMG/M
3300026528|Ga0209378_1159466All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300026538|Ga0209056_10023166All Organisms → cellular organisms → Bacteria6015Open in IMG/M
3300028146|Ga0247682_1115150All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300028536|Ga0137415_10040453All Organisms → cellular organisms → Bacteria4560Open in IMG/M
3300028778|Ga0307288_10269462All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium671Open in IMG/M
3300028790|Ga0307283_10008360All Organisms → cellular organisms → Bacteria1916Open in IMG/M
3300028792|Ga0307504_10374913All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300028906|Ga0308309_11488589All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium578Open in IMG/M
3300030973|Ga0075395_11054004All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031122|Ga0170822_10112113All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300031231|Ga0170824_123712259All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300031446|Ga0170820_10516506All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Hyalangium → unclassified Hyalangium → Hyalangium sp. H56D211040Open in IMG/M
3300031474|Ga0170818_102050863All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300031474|Ga0170818_109325044All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300031947|Ga0310909_11354194All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium571Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil18.35%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.42%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.50%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.59%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.83%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.83%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.92%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.92%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.92%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2124908006Soil microbial communities from sample at FACE Site Metagenome WIR_Oz2EnvironmentalOpen in IMG/M
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300028146Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030973Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_007012002088090014SoilLMDHRAHFQRTLKRPPVEFIVLWDWAEKHGIVQQAQ
FWIROz_092053902124908006SoilMTFANMLMAHQVHFQKALKPPPSEFTALWDWAEKRGLVQRVH
FE1_066057702189573002Grass SoilADGMTLGKMLTEHRTHFGRTLKQAPAEFTALWDWAEKRGIVQQAR
JGI11643J12802_1159909623300000890SoilADPNGDGTDGMTFGKMLTSHRSLFQRTHKSPPPQFVALWDWAEQHGIIKQIQ*
Ga0062594_10149105413300005093SoilPSRAGADGMTFANMLMAHQVHFQKALKPPPSEFTALWDWAEKRGLVQRVH*
Ga0062594_10291980013300005093SoilRAGADGMTFGKLLKDHRAHFEHKKQPAEFVALWNWAEQHGIIQQTP*
Ga0066678_1018727643300005181SoilFGKMLTDHRAHFGRTHKQPPAEFTALWDWVEKHGIVQQAR*
Ga0066676_1016357053300005186SoilNRAGADGMTFGNMLMAHRAHFQQTLKRPPTEFATLWDWAEKRGIVQQILTRNL*
Ga0066675_1145871723300005187SoilGMTLGNMLMTHQAHFQRTLKPPPAEFTALWDWAEKRGIVQKTQ*
Ga0070666_1128846213300005335Switchgrass RhizosphereGTDGMTFGKMLMNHRAHFQRTHKSPPPQFVALWDWAEQHRIIQQIQ*
Ga0070682_10064380213300005337Corn RhizosphereGADPNRAGADGMTFGKLLKDHRAHFEHKKQPAEFVALWNWAEQHGIIQQTP*
Ga0070698_10215415213300005471Corn, Switchgrass And Miscanthus RhizosphereGMTFGKMLMNHRAHFQRTHKSPPPQFVALWDWAEQHRIIQQIQ*
Ga0066707_1031937413300005556SoilGKMLMDHRAHFQRTRKNPPVEFATLWDWAEKHGIVQQAWQIQR*
Ga0066693_1030604623300005566SoilKMLTEHRAHFGRTLKRPPAEFAALWDWAEKHGIIQPAK*
Ga0066703_1046280613300005568SoilADGMTFEKMLKDHQAHFTGTLKRPPAEFAALWDWAAKRGTVQQAQ*
Ga0066708_1048521033300005576SoilGMTFGNMLMAHRAHFQQTLKPPPTEFATLWDWAEKRGIVQRIH*
Ga0066903_10241125213300005764Tropical Forest SoilTFGKMLMDHRAHFQRTHKSPPPQFAALWDWAEQHGIIKQIQ*
Ga0066903_10536047113300005764Tropical Forest SoilNRAGADGLKFSNMMRTHQVHFQQKLKGLPTEFAALWDWAEKRGIVQQTH*
Ga0068862_10170923113300005844Switchgrass RhizosphereTDGMTFGKMLTSHRSLFQRTDKSPPPQFVALWDWAEQHGIIKQIQ*
Ga0066652_10012253433300006046SoilGMTFGNMLMAHRAHFQQTLKRPPTEFATLWDWAEKRGIVQQILTRNL*
Ga0066652_10030449233300006046SoilADGMTFGKMLTEHRAHFGRTLKHPPTEFAALWDWAEKHGIIQPAQ*
Ga0066652_10104460913300006046SoilMTFGKMLTEHRAHFGRTLKHPPTEFAALWDWAEKHG
Ga0070712_10021910113300006175Corn, Switchgrass And Miscanthus RhizosphereGADGMTFGKMLTEHRAHFGRTHKQPPAEFAALWDWAEKHGIIQPAQ*
Ga0070712_10079502223300006175Corn, Switchgrass And Miscanthus RhizosphereGADGMTLGKMLKDHRAHFQRTHKSPPAEFTALWDWAEQHGIVQQTQ*
Ga0070765_10101829523300006176SoilLTEHRAHFGRTHKRPPAEFTALGDWAEKHGIIQPAR*
Ga0066659_1062492033300006797SoilAGADGMTFGKMLTEHRAHFQRTHKPPPAEFTALLDWAEKHGIVQQAQ*
Ga0066659_1141126023300006797SoilLTDHRAHFGRTHKQPPAEFAALWDWAEKHGIIQQAR*
Ga0079219_1228228313300006954Agricultural SoilMTFGKMLMDHRAHFQRLRKSPPPQFIALWDWAEQHGIIQQIQ*
Ga0075435_10066284223300007076Populus RhizosphereMTFGKMLADHKGHFQRTHKSPPPQFVALWDWAEQHGIIQQIQ*
Ga0099791_1047057623300007255Vadose Zone SoilGMTFGKMLIEHRAHFQRTHKPPPPEFTALWDWAEKHGIVQ*
Ga0066710_10113951043300009012Grasslands SoilGKMLMDHRAHFQRTRKNPPVEFATLWDWAEKHGIVQQAWQIQR
Ga0066710_10240439333300009012Grasslands SoilLMAHRAHFQQTLKRPPTEFATLWDWAEKRGIVQQILTRNL
Ga0066710_10276113823300009012Grasslands SoilGADGMTFGKMLTDHRAHFRRTHKQPPAEFAALWDWAEKHGIVQQAR
Ga0066710_10279116223300009012Grasslands SoilGMTFAKMLMEHRAHFGRTLKQPPAEFAALWDWAEKHGIIQTAR
Ga0099829_1062874833300009038Vadose Zone SoilGMTFGKMLTEHRAHFGRLKPPPVEFAALWDWAEKHGMIQQAR*
Ga0066709_10047156043300009137Grasslands SoilAGADGMTFGNMLMAHRAHFQQTLKRPPTEFATLWDWAEKRGIVQQILTRNL*
Ga0105237_1087361613300009545Corn RhizospherePEHRAHFGRTLKQPPTEFAALWDWAEKHGIVQQAQ*
Ga0105249_1003314493300009553Switchgrass RhizosphereDGMTLAKLLTEHKAHFARTHKQPPAEFAALWDWAERHGVVH*
Ga0126380_1159017913300010043Tropical Forest SoilFGKMLNDHRAHFQRTHQSPPAEFVALWEWGEKHGVVQHG*
Ga0126380_1213506613300010043Tropical Forest SoilNILMAHRAHFQQTLKPPPTEFATLWDWAQKRGIVQQIH*
Ga0134109_1031477513300010320Grasslands SoilDGMTFGKMLMEHRAHFQRTHKPSPVEFTALWDWAEKHGIVQQAQ*
Ga0134064_1014811723300010325Grasslands SoilMTFGNLLTVHRAHFQQMLKPPPAEFATLWDWAEKRGIVQQIH*
Ga0134063_1050913723300010335Grasslands SoilPNRTGVDGMTFGKMLKDHQAHFQRTLKSPPEFKALWDWAEKRGIVQKTQ*
Ga0126370_1110240413300010358Tropical Forest SoilAGADGMTFGNILMAHRAHFQQTLKPPPTEFATLWDWAQKRGIVQQIH*
Ga0126376_1063299033300010359Tropical Forest SoilMLRDHRAQFQRTNKSPPVEFATLWDWADQHEIVQQTQ*
Ga0126376_1265386413300010359Tropical Forest SoilKMLMDHRAHFQRTHKSPPPEFVALWDWAEQHEIIHQIQ*
Ga0126379_1124160813300010366Tropical Forest SoilTDGMTFGKMLMDHRAHFQRTHKSPPPQFVALWDWAEQHGIIQQIQ*
Ga0134128_1051007513300010373Terrestrial SoilKMLTEHKAHFGRTHKQPPAEFAALWDWAEKHGIIQQAQ*
Ga0134126_1040952633300010396Terrestrial SoilLTEYKAHFGQTHKQPPAEFAALWDWAEKHRIIQQAQ*
Ga0134124_1043480533300010397Terrestrial SoilADGMTLGKMLKDHRAHFQRTHKSPPAEFTALWDWAEQHGIVQQTQ*
Ga0134124_1175133213300010397Terrestrial SoilGMTFGKLLKDHRAHFEHKKQPVEFAALWNWAEQHGIVQQTP*
Ga0126383_1098025833300010398Tropical Forest SoilGKILADHRAHFQTTNKSAPTEFATLWDWAEKHGIVQHGQ*
Ga0137463_109266613300011444SoilKMLMVHQVHFQKALKPPPPEFTALWNWAEKRGIVQQIH*
Ga0137388_1141072023300012189Vadose Zone SoilTLWNMLMAHRAHFQQTLKPPPAEFATLWDWAEKRGIVQQIH*
Ga0137364_1017526113300012198Vadose Zone SoilGADGMTFGNMLMAHRAHFQQTLKPPPTEFATLWDWAEKRGIVQRIH*
Ga0137365_1030177013300012201Vadose Zone SoilLMEHRAHFQRTHKPPPVEFTALWDWAEKHGIVQQAQ*
Ga0137365_1041431923300012201Vadose Zone SoilMLMDHRAHFQRTRKNPPVEFATLWDWAEKHGIVQQAQQIQR*
Ga0137363_1073446323300012202Vadose Zone SoilMAHRTHFQQTLKPPPAEFATLWDWAEKRGIVQQIH*
Ga0137363_1081571633300012202Vadose Zone SoilTFGKMLMDHRAHFQRTLKRPPAEFAALWDWAEKHGVVQQAQ*
Ga0137377_1060781213300012211Vadose Zone SoilGADGMTFGKMLMDHRAHFQGTHKPPPAEFTALWDWAEKHGIVQQAQ*
Ga0137377_1094314813300012211Vadose Zone SoilTFGKMLMDHRAHFQRTRKNPPVEFATLWDWAEKHGIVQQAQQIQR*
Ga0137387_1027873223300012349Vadose Zone SoilLMAHRAHFQQTLKRPPTEFATLWDWAEKRGIVQQILTRNL*
Ga0137367_1112966613300012353Vadose Zone SoilKMLTEHRAHFGRRLKPPPVEFAALWDWAEKHGIIR*
Ga0137385_1024809543300012359Vadose Zone SoilHFQRTRKNPPVEFATLWDWAEKHGIVQQAQQIQR*
Ga0137385_1099782413300012359Vadose Zone SoilRAGADGMTFGKMLMDHRAHFQRTLKRPPVEFVVLWDWAEKHGIVQQAQ*
Ga0137361_1161702513300012362Vadose Zone SoilEHRAHFGRRLKSPPAEFAALWDWAEKHGIIQQAKK*
Ga0137373_1068491733300012532Vadose Zone SoilGMTFGKMLMDHRAHFQRTHKSPPAQLIALWDWAEQHGIIQQIQ*
Ga0157289_1004858133300012903SoilMLTEHRAHFGQTHKQPPAEFTALWNWAEKHGIVQQAQ*
Ga0137394_1002818113300012922Vadose Zone SoilKMLIEHRAHFQRTHKPPPAEFTALWDWAEKHGMVQ*
Ga0137413_1138482033300012924Vadose Zone SoilDGMTLGSMLITHQAHFQRTLKPPPAEFMALWDWAEKRGIVQQIH*
Ga0126369_1283804013300012971Tropical Forest SoilDHRAHFQRTHKSPPPQFVALWDWAEQHGIIQQIQ*
Ga0126369_1327237813300012971Tropical Forest SoilKFSNMMRTHQVHFQQKLKGLPTEFAALWDWAEKRGIVQQTH*
Ga0134076_1023823413300012976Grasslands SoilTFGKMLTEHKSHFGRTHKQPPAEFTALWDWAEKHGIIQPAR*
Ga0134087_1007737613300012977Grasslands SoilMTFGKMLTEHRAHFGRTHKQPPAEFTALWDWAEKHGIVQQAR*
Ga0164307_1051772413300012987SoilPNRSGANGMTLGKMLKEHRAHFQKALKPPPPEFTALWDWAEQRGIVQQVH*
Ga0157378_1263216913300013297Miscanthus RhizosphereAKMLNEHRQQFAKGKGAPPEFTALWDWAEKHGVVLGK*
Ga0134078_1006241333300014157Grasslands SoilGKMLTEHRAHFGKLKPTPVEFTALWDWAEKHGIIQQAR*
Ga0134072_1046323313300015357Grasslands SoilRAGADGMTFGNMLMAHRAHFQQTLKRPPTEFATLWDWAEKRGIVQQILTRNL*
Ga0132257_10404700723300015373Arabidopsis RhizosphereDPNRPATDGLTFGKMLTNHRAHFQQTNSSPPSEFVALWDWAEQHRIIQQIQ*
Ga0134069_123423213300017654Grasslands SoilMDHRAHFQDTLKTPPAEFAALLGWAEKHGIVQQAQ
Ga0184617_125889823300018066Groundwater SedimentDGMTFGKMLTDHRAARLSQRRPMPPEFTALWDWAEKHGIIQQAQ
Ga0184609_1052355013300018076Groundwater SedimentFGKMLMDQRAQFRQRRKPPPAQFGALWEWAEKHGIIQQAQ
Ga0066669_1109748833300018482Grasslands SoilAGADGMTFGNMLMAHRAHFQQTLKPPPTEFATLWDWAEKRGIVQRIH
Ga0193731_113856713300020001SoilRAGADGMTLGSMLMAHKVHFQKALKPPPPEFTALWDWAEKRGIVQQIH
Ga0193724_108694813300020062SoilMPHQVHFQKALKPPPSEFTALWDWAEKRGIVQQIH
Ga0210382_1022899823300021080Groundwater SedimentGKMLTDHRAHFQRTHKSPPAQLIALWDWAEQHGVIQQIQ
Ga0207697_1038845413300025315Corn, Switchgrass And Miscanthus RhizosphereSRAGADGMTFANMLMAHQVHFQKALKPPPSEFTALWDWAEKRGLVQQIH
Ga0207680_1123057223300025903Switchgrass RhizospherePNRAGTDGMTFGKMLMNHRAHFQRTHKSPPPQFVALWDWAEQHRIIQQIQ
Ga0207700_1033430613300025928Corn, Switchgrass And Miscanthus RhizosphereFGKMLTEHRAHFGRTQKQPPAEFAALWDWAEKHGIIQPAQ
Ga0207661_1093736333300025944Corn RhizosphereQRGAEPNRAGADGMTFGKLLKDHRAHFEHKKQPAEFVALWNWAEQHGIIQQTP
Ga0209055_101818583300026309SoilMTFGKMLTEHRAHFGRTLKQPPTEFAALWDWAEKHGIVQPAR
Ga0209687_100187913300026322SoilGMTFGKMLTEHRAHFGRTLKQPPTEFAALWDWAEKHGIVQPAR
Ga0209801_112058443300026326SoilADGMTFEKMLTDHRAHFGRTHKQPPAEFTALWDWVEKHGIVQQAR
Ga0209808_122402823300026523SoilRAGADGMTFGKMLTEHRAHFGKLKPTPVEFAALWDWAEKHGILQQAR
Ga0209378_115946613300026528SoilGADGMTFGKMLTEHRAHFGKLKPTPVEFAALWDWAEKHGIIQQAL
Ga0209056_1002316613300026538SoilMTFGKMLTEHRAHFGRTLKQPPTEFAALWDWAEKHGIVQPAQ
Ga0247682_111515013300028146SoilDPNRAGTDGMTFGKMLMNHRAHFQRTHKSPPPQFVALWDWAEQHRIIQQIQ
Ga0137415_1004045363300028536Vadose Zone SoilGKMLMAHQVHFQKALKPPPSEFTALWNWAEKRGIVQQIH
Ga0307288_1026946213300028778SoilDGMTLAKMLTEHRAHFGQRHKQPPAEFTALWDWAEKHGIVQPAR
Ga0307283_1000836033300028790SoilFGKMLKEHRAHFQKALKPPPPEFTALWDWAGKRGIVQQVH
Ga0307504_1037491313300028792SoilTFGKMLMDHRAHFQQTHRSPPTEFAALWDWTEKHGIVQQAKQIQR
Ga0308309_1148858913300028906SoilLTEHRAHFGRTHKRPPAEFTALGDWAEKHGIIQPAR
Ga0075395_1105400413300030973SoilADGMTLGKMLKDHRAHFQRTHKSPPVEFGALWDWAEQHGIVQQTQ
Ga0170822_1011211323300031122Forest SoilTLGKMLKDHRAHFQRTHKSPPAEFTALWDWAEKRGIVQQTQ
Ga0170824_12371225933300031231Forest SoilLMAHKVHFQKTLKPPPEFTALWDWAERRGIVQQTP
Ga0170820_1051650613300031446Forest SoilTFGNMLMAHKVHFQKTLKPPPEFTALWDWAERRGIVQQTP
Ga0170818_10205086313300031474Forest SoilDGMTFGKMLTDHRAHFQRTHKSPPAEFIALWDWAEQHGIIQQIQ
Ga0170818_10932504433300031474Forest SoilDGMTFGKMLTDHRAHFQRTLKWPPVEFIVLWDWAKKHGIVQQAQ
Ga0310909_1135419413300031947SoilRAGADGMTFGKMLVDHRVYFGRTLKRPPGKFATLWDWAETHGILRQPK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.