NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089259

Metagenome / Metatranscriptome Family F089259

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089259
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 40 residues
Representative Sequence RATTAVLSVGATCMFFLQQVDDRDKLRAIVLEMATDLIN
Number of Associated Samples 96
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.83 %
% of genes near scaffold ends (potentially truncated) 98.17 %
% of genes from short scaffolds (< 2000 bps) 86.24 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (55.963 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(27.523 % of family members)
Environment Ontology (ENVO) Unclassified
(19.266 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.376 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.75%    β-sheet: 0.00%    Coil/Unstructured: 49.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF13424TPR_12 29.36
PF01037AsnC_trans_reg 5.50
PF13412HTH_24 5.50
PF00248Aldo_ket_red 4.59
PF01670Glyco_hydro_12 3.67
PF13374TPR_10 3.67
PF03023MurJ 2.75
PF13229Beta_helix 2.75
PF00196GerE 1.83
PF00723Glyco_hydro_15 1.83
PF00291PALP 0.92
PF13480Acetyltransf_6 0.92
PF00498FHA 0.92
PF13613HTH_Tnp_4 0.92
PF13581HATPase_c_2 0.92
PF00535Glycos_transf_2 0.92
PF00903Glyoxalase 0.92
PF13578Methyltransf_24 0.92
PF13432TPR_16 0.92
PF04149DUF397 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0534Na+-driven multidrug efflux pump, DinF/NorM/MATE familyDefense mechanisms [V] 2.75
COG0728Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis)Cell wall/membrane/envelope biogenesis [M] 2.75
COG2244Membrane protein involved in the export of O-antigen and teichoic acidCell wall/membrane/envelope biogenesis [M] 2.75
COG3387Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 familyCarbohydrate transport and metabolism [G] 1.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms55.96 %
UnclassifiedrootN/A44.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_103228605Not Available1018Open in IMG/M
3300000956|JGI10216J12902_109711478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. HKS021003Open in IMG/M
3300003505|JGIcombinedJ51221_10125656Not Available1030Open in IMG/M
3300004479|Ga0062595_100499021All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300005614|Ga0068856_101983344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales593Open in IMG/M
3300005921|Ga0070766_10377420All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300005983|Ga0081540_1231957Not Available651Open in IMG/M
3300006175|Ga0070712_100791028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales813Open in IMG/M
3300006176|Ga0070765_101175724Not Available724Open in IMG/M
3300006176|Ga0070765_101995419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300006804|Ga0079221_10076592All Organisms → cellular organisms → Bacteria1578Open in IMG/M
3300009089|Ga0099828_10822492Not Available831Open in IMG/M
3300009090|Ga0099827_10974749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300009143|Ga0099792_10835626All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300009522|Ga0116218_1271485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia761Open in IMG/M
3300009672|Ga0116215_1000609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia26765Open in IMG/M
3300010375|Ga0105239_12930919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300010379|Ga0136449_101167252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1217Open in IMG/M
3300010876|Ga0126361_11244744Not Available795Open in IMG/M
3300012189|Ga0137388_10708828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium934Open in IMG/M
3300012202|Ga0137363_11075040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300012211|Ga0137377_10362431Not Available1387Open in IMG/M
3300012357|Ga0137384_11510214Not Available521Open in IMG/M
3300012960|Ga0164301_11686721Not Available529Open in IMG/M
3300013297|Ga0157378_11459349All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300013297|Ga0157378_12735139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300016341|Ga0182035_11924227Not Available537Open in IMG/M
3300016387|Ga0182040_11140110Not Available654Open in IMG/M
3300016404|Ga0182037_10511959Not Available1008Open in IMG/M
3300017821|Ga0187812_1080033Not Available1078Open in IMG/M
3300017948|Ga0187847_10841749Not Available521Open in IMG/M
3300017970|Ga0187783_10442690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia943Open in IMG/M
3300017973|Ga0187780_10044974All Organisms → cellular organisms → Bacteria3077Open in IMG/M
3300018001|Ga0187815_10019220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2941Open in IMG/M
3300018007|Ga0187805_10014527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3364Open in IMG/M
3300018043|Ga0187887_10104317Not Available1707Open in IMG/M
3300018058|Ga0187766_10766125Not Available671Open in IMG/M
3300019284|Ga0187797_1321432Not Available621Open in IMG/M
3300020581|Ga0210399_10165239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus pulveris1834Open in IMG/M
3300020581|Ga0210399_10936974Not Available701Open in IMG/M
3300020581|Ga0210399_11315405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300020582|Ga0210395_10455393All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300020582|Ga0210395_10613094Not Available816Open in IMG/M
3300021178|Ga0210408_10002685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales17038Open in IMG/M
3300021178|Ga0210408_10989307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae651Open in IMG/M
3300021377|Ga0213874_10296340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300021388|Ga0213875_10062324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium1744Open in IMG/M
3300021403|Ga0210397_10031798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3297Open in IMG/M
3300021403|Ga0210397_10183479Not Available1485Open in IMG/M
3300021406|Ga0210386_10023625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4800Open in IMG/M
3300021407|Ga0210383_10355040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1263Open in IMG/M
3300021477|Ga0210398_11521846Not Available520Open in IMG/M
3300021560|Ga0126371_13706834Not Available515Open in IMG/M
3300022530|Ga0242658_1189707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia553Open in IMG/M
3300022531|Ga0242660_1160431Not Available595Open in IMG/M
3300022532|Ga0242655_10132974Not Available714Open in IMG/M
3300022724|Ga0242665_10138492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. HKS02759Open in IMG/M
3300024271|Ga0224564_1138789All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300025898|Ga0207692_10023200All Organisms → cellular organisms → Bacteria2867Open in IMG/M
3300025898|Ga0207692_10024389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2812Open in IMG/M
3300025900|Ga0207710_10043658Not Available1995Open in IMG/M
3300025911|Ga0207654_10163784Not Available1439Open in IMG/M
3300025916|Ga0207663_10016262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4121Open in IMG/M
3300025916|Ga0207663_10048428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2631Open in IMG/M
3300026078|Ga0207702_12059263Not Available561Open in IMG/M
3300027096|Ga0208099_1050544Not Available593Open in IMG/M
3300027504|Ga0209114_1046488Not Available756Open in IMG/M
3300027765|Ga0209073_10303617Not Available633Open in IMG/M
3300027765|Ga0209073_10505312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300027768|Ga0209772_10258281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300027855|Ga0209693_10298502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae785Open in IMG/M
3300028789|Ga0302232_10505593Not Available594Open in IMG/M
3300028799|Ga0307284_10204524Not Available777Open in IMG/M
3300028863|Ga0302218_10162589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium709Open in IMG/M
3300028877|Ga0302235_10449333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii549Open in IMG/M
3300028906|Ga0308309_10351225Not Available1257Open in IMG/M
3300030053|Ga0302177_10156979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1277Open in IMG/M
3300030494|Ga0310037_10141937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1094Open in IMG/M
3300030740|Ga0265460_12298624Not Available569Open in IMG/M
3300030906|Ga0302314_11274136Not Available682Open in IMG/M
3300031040|Ga0265754_1043772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300031236|Ga0302324_100336632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia rhizosphera2289Open in IMG/M
3300031525|Ga0302326_11202643Not Available1042Open in IMG/M
3300031573|Ga0310915_11158850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae536Open in IMG/M
3300031681|Ga0318572_10574518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria672Open in IMG/M
3300031708|Ga0310686_103148279Not Available727Open in IMG/M
3300031708|Ga0310686_111744721Not Available1381Open in IMG/M
3300031708|Ga0310686_115417773Not Available1145Open in IMG/M
3300031769|Ga0318526_10493716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300031781|Ga0318547_10596494Not Available685Open in IMG/M
3300031832|Ga0318499_10020093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae2312Open in IMG/M
3300031890|Ga0306925_11956468Not Available555Open in IMG/M
3300031897|Ga0318520_10098218All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300031910|Ga0306923_10783969Not Available1054Open in IMG/M
3300031941|Ga0310912_11202506Not Available577Open in IMG/M
3300031946|Ga0310910_11196418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae590Open in IMG/M
3300032008|Ga0318562_10364580Not Available840Open in IMG/M
3300032043|Ga0318556_10614996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae566Open in IMG/M
3300032044|Ga0318558_10711230Not Available502Open in IMG/M
3300032066|Ga0318514_10578607Not Available598Open in IMG/M
3300032160|Ga0311301_10084486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6450Open in IMG/M
3300032205|Ga0307472_100956541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura798Open in IMG/M
3300032770|Ga0335085_11359901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria746Open in IMG/M
3300032805|Ga0335078_11743400Not Available681Open in IMG/M
3300032829|Ga0335070_11485111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia618Open in IMG/M
3300032895|Ga0335074_10491275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1279Open in IMG/M
3300032897|Ga0335071_10097473All Organisms → cellular organisms → Bacteria2884Open in IMG/M
3300033290|Ga0318519_10322322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2575908Open in IMG/M
3300033806|Ga0314865_088717Not Available808Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil27.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.42%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.42%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.59%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.59%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.59%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.75%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.75%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.83%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.83%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots1.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.83%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.92%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027504Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031040Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033806Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10322860513300000956SoilRATTAVLSVGATCMFFLQQVDDRDKLRAIVLEMATDLIN*
JGI10216J12902_10971147813300000956SoilAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS*
JGIcombinedJ51221_1012565613300003505Forest SoilAPLRDRVRTSAAVLSVSATCLFYLQQVDDPDKLRAIVLEMATDLLH*
Ga0062595_10049902113300004479SoilRATTAVLSVGATCMFFLHEVDDRDKLRAIVLEMATDLIPVAR*
Ga0068856_10198334433300005614Corn RhizosphereRVRATTAVLSVGATCMFFLDQVDDRDKLRAIVLEMATDLIG*
Ga0070766_1037742023300005921SoilAPLRDRVRATTATLAVGATCHFYLQQVDDPDKLRAIVLEIALDLIH*
Ga0081540_123195713300005983Tabebuia Heterophylla RhizosphereAVLSVGATCMFFLQQVDDRDKLRAIVLEMATDLIPLTR*
Ga0070712_10079102813300006175Corn, Switchgrass And Miscanthus RhizosphereTTAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS*
Ga0070765_10117572413300006176SoilRERVRATAALLSVGATCHVYLQQAEDPDKLRAIITEIATDLIR*
Ga0070765_10199541913300006176SoilRDRVRATAAMLSVGAACHVYLQQVDDPDKLRAIILEIATDLIH*
Ga0079221_1007659213300006804Agricultural SoilRVRATAAIMSVGATCIFFLQQVDDRDKLRAIVLEMATDLIG*
Ga0099828_1082249233300009089Vadose Zone SoilAATAVLAVGGTCMVFLQQVDDPDKLRAIVLEMATDLTR*
Ga0099827_1097474923300009090Vadose Zone SoilDRVRATAGVLTVGATCMFYLHQVDDRDKLRAIVLEIASDLTS*
Ga0099792_1083562613300009143Vadose Zone SoilAVLSVGATCMFFVQEVDDRDKLRAIVLEMATDLIS*
Ga0116218_127148523300009522Peatlands SoilVLAVGATCVFYLQQVDDQDKLRAIVLEMATDLIQ*
Ga0116215_100060913300009672Peatlands SoilTTATLAVGATCMFFLQQVDDQDKLRAIVLEIATDLTS*
Ga0105239_1293091913300010375Corn RhizosphereAPLRDRVRATTAVLSVGATCMFFLQQVDDREKLRAIVLEMATDLIG*
Ga0136449_10116725223300010379Peatlands SoilPLRERVRATTAVLAVGATCVFYLQQVDEVDKLRAIVLEMATDLIQ*
Ga0126361_1124474413300010876Boreal Forest SoilLRERVRATAALLSVGATCHVYLQQAEDPDKLRAIITEIATDLIR*
Ga0137388_1070882823300012189Vadose Zone SoilDRVRATAGVLTVGATCMFYLQQVDDRDKLRAIVLEIASDLTS*
Ga0137363_1107504023300012202Vadose Zone SoilRATTAVLSIGATCMFFLQEMDERDKLRATVLEMATDLIS*
Ga0137377_1036243123300012211Vadose Zone SoilAVLSVGATCMFFVQEVDDRDKLRDIVLEMATDLIS*
Ga0137384_1151021433300012357Vadose Zone SoilVRATAAVLSVGATCMFYLHQVDDRDKLRAIVLEMATDLIPVIR*
Ga0164301_1168672123300012960SoilATTAVLSVGAPCIFFLQQVDDRKKLRAIVREMATDLIG*
Ga0157378_1145934923300013297Miscanthus RhizosphereVRATSAVLATGATCMFYLQQVDDPDKLRAIVLEIATDLIG*
Ga0157378_1273513913300013297Miscanthus RhizosphereTAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS*
Ga0182035_1192422713300016341SoilTAVLAVGATCHVYLQQVDDPDKLRAIVLEIALDLIH
Ga0182040_1114011023300016387SoilATAAMLSVGATCHVYQQQVDDPDKLRAIVLEIANDLIR
Ga0182037_1051195923300016404SoilAPLRDRMRATAAVLSVGATCHFYLQQVDDPDKLRAIVLEIATDLIS
Ga0187812_108003313300017821Freshwater SedimentAVLTVGATCLFYLQQVDDPDKLRAVVLEIATDLIH
Ga0187847_1084174913300017948PeatlandRASTAVIAVGAACRFFLQRTDDRDKLRAIVLEIATDLTS
Ga0187783_1044269023300017970Tropical PeatlandTAAVLTVGAVCHFYLQQVDDPDKLRAIVMEIATDLIH
Ga0187780_1004497433300017973Tropical PeatlandLRDRVRATAAMLSVGATCHVYQQQVDDPDKLRAIVLEIATDLIR
Ga0187815_1001922013300018001Freshwater SedimentATTAVLTVGATCLFYLQQVDDPDKLRAVVLEIANDLVR
Ga0187805_1001452733300018007Freshwater SedimentATAAVVSVGSTYMFYLQQVDDQDKLGEIILELATDLTH
Ga0187887_1010431713300018043PeatlandAPLRDRVRASTAVIAVGATCRFYLQQIEDRDELRAIVLEITNDLIS
Ga0187766_1076612513300018058Tropical PeatlandRASTAVLAVGATCHVYLQQADDPDKLRAIVLEIALDLIH
Ga0187797_132143213300019284PeatlandAITAILAVGATYMFYMQQVDDPDKLGAIILEIATDLIH
Ga0210399_1016523923300020581SoilRVRATAATLTVGATCHVYLQRVDDPDKLRAIILEIATDLIH
Ga0210399_1093697433300020581SoilRDRVRATAAVLSVGAICMFFLQEVNDRDKLRAIVLEMATDLIG
Ga0210399_1131540513300020581SoilRVRATTAVLSVGATCMFFLQEVNDRDKLRAIVLEMATDLIS
Ga0210395_1045539313300020582SoilRVRATAATLTVGATCHVYLQQVDDPDKLRAVILEIATDLIH
Ga0210395_1061309413300020582SoilVLAVGATCVFYVQQVDDRDKLRAIVLEMATDLIPVDRSY
Ga0210408_1000268513300021178SoilDAPLRERVRATAATLTVGATCHVYLQKVDDPDKLRAIILEIATDLIH
Ga0210408_1098930723300021178SoilATLTVGATCHVYLQKVDDPDKLRAIILEIATDLIH
Ga0213874_1029634013300021377Plant RootsTAVLSVGATCHVYLQQVDDLDKLRAIVLEIATDLIS
Ga0213875_1006232413300021388Plant RootsTAVLSVGMTCMFFLEQVNDRDKLRAIVLEMATDLIS
Ga0210397_1003179843300021403SoilLRERVRATAATLTVGATCHVYLQRVDDPDKLRAIILEIATDLIR
Ga0210397_1018347923300021403SoilDRVRATTAVLSVGATCMFFLQEVNDRDKLRAIVLEMATDLIS
Ga0210386_1002362543300021406SoilRATAATLTVGATCHVYLQKVDDPDKLRAIILEIATDLIH
Ga0210383_1035504013300021407SoilAATLTVGATCHVYLQQVDDPDKLRAIILEIATDLIH
Ga0210398_1152184623300021477SoilSAAVLSVSATCLFYLQQVDDPDKLRAIVLEMATDLLH
Ga0126371_1370683413300021560Tropical Forest SoilQVRDRVRATAAVLTVGATCHFYLQQVDDPDKLRAIILEMATDLIG
Ga0242658_118970713300022530SoilVRATTAVLSVGATCMFFLQEVNDRDKLRAIVLEMAT
Ga0242660_116043113300022531SoilPLRERVRATAATLTVGATCHVYLQQVDDPDKLRAIILEIATDLIH
Ga0242655_1013297423300022532SoilATAATLTVGATCHVYLQQVDDPDKLRAITLEIATDLIH
Ga0242665_1013849213300022724SoilAVLSVGATCMFFLQQVDDRDKLRAIVLEMATDLIS
Ga0224564_113878923300024271SoilPGAPLRERVRATAATLAVGATCHVYLQEVDDPDKLRAIILEIATDLIH
Ga0207692_1002320033300025898Corn, Switchgrass And Miscanthus RhizosphereVRATSAVLATGATCMFYLQQVDDPDKLRAIVLEIATDLIG
Ga0207692_1002438933300025898Corn, Switchgrass And Miscanthus RhizosphereVRATTAVLSLGATCHFYLQRVDDPDKLRAIVLEMAADLIG
Ga0207710_1004365823300025900Switchgrass RhizosphereTAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS
Ga0207654_1016378423300025911Corn RhizosphereRVRATTAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS
Ga0207663_1001626263300025916Corn, Switchgrass And Miscanthus RhizosphereRATTAVLSVGATCIFFLQQVDDREKLRAIVLEMATDLIG
Ga0207663_1004842823300025916Corn, Switchgrass And Miscanthus RhizosphereRVRATTAVLSAGATCMFFVQEVDDRDKLRAIVLEMATDLIS
Ga0207702_1205926313300026078Corn RhizosphereRDRVRATTAVLSVGATCMFFLDQVDDRDKLRAIVLEMATDLIG
Ga0208099_105054413300027096Forest SoilSTAVIAVGATCRFFLQEIDDRDKLRAIVLEIATDLTS
Ga0209114_104648823300027504Forest SoilERVRATTAVLSAGTSCMFFLEQIDDKDKLRAIVLELAEDLIG
Ga0209073_1030361713300027765Agricultural SoilRATTAVISVGATCMFFLDQVDDRDKLRAIVLEMAADLTG
Ga0209073_1050531213300027765Agricultural SoilATTAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS
Ga0209772_1025828113300027768Bog Forest SoilDRVRGTTAVLAVGATCMFFLQQVDDHDKLRAIVLEMATDLTG
Ga0209693_1029850223300027855SoilRATAATLTVGATCHVYLQQVDDPDKLRAIILEIATDLIH
Ga0302232_1050559323300028789PalsaDRVRASTALIAVGATCRFFLQQTEDRDKLRAIVREIATDLTS
Ga0307284_1020452413300028799SoilRATTAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS
Ga0302218_1016258913300028863PalsaPLRERVRATAATLTVGAICHVYLTQVDDPDKLRAVILEIATDLIH
Ga0302235_1044933313300028877PalsaIAVGATCRFFLQQADDRDKLRAIVLEIATDLIPVDR
Ga0308309_1035122513300028906SoilVRATAAMLSVGATCHVYLQQVDDPDKLRAITLEIATDLIH
Ga0302177_1015697923300030053PalsaPLRDRVRASTAVIAVGATCRFFLQQTDDRDKLRAIVLEIATDLTS
Ga0310037_1014193723300030494Peatlands SoilRTTAAVLSVGATYMFYLQQAEDQDKLGAIILELATDLTH
Ga0265460_1229862423300030740SoilAPLRARVRATAAVLSVGATYMFYLQEVDDPDKLGAIILELATDLTH
Ga0302314_1127413623300030906PalsaSTAVIAVGAGCRFFLRQAGDEDKLRAIVLEMATDLTSG
Ga0265754_104377213300031040SoilLRDRVRATAAMLSVGAACHVYLQQVDDPDKLRAIILEIATDLIH
Ga0302324_10033663233300031236PalsaDRVRASTAVIAVGATCRFFLQQTDDRDELRTIALEIATDLIPVDR
Ga0302326_1120264333300031525PalsaLRERVRATAATLTVGAICHVYLTQVDDPDKLRAVILEIATDLIH
Ga0310915_1115885013300031573SoilVRATAAMLSVGATCHVYLQQVDDPDKLRAIILEIATDLIH
Ga0318572_1057451823300031681SoilVRATAGVLSVGATCMFYLQQVDDPDKLRAIVLEMATDLIS
Ga0310686_10314827913300031708SoilRVRATAALLSVGAACHVYLQQVDDPDKLRAIILEIATDLIH
Ga0310686_11174472123300031708SoilRATAATLTVGATCHVYLQQVDDPDKLRAIILEIATDLIR
Ga0310686_11541777323300031708SoilRERVRATAATLTVGATCHVYLQQVDDPDKLRAIILEIATDLIR
Ga0318526_1049371613300031769SoilLRDRVRATTAILAVGATCMFYLQRVDDPEKLRAIILETSLDLIH
Ga0318547_1059649423300031781SoilASAAVLGVGATCHVYLQQVDDPDKLRAIVLEIALDLIR
Ga0318499_1002009313300031832SoilALLRDRVRASAALLSVGATCHVYLQQVDDPDKLRAIVLEMATDLIH
Ga0306925_1195646823300031890SoilSAAVLGVGATCHVYLQQVDDPDKLRAIVLEIALDLIR
Ga0318520_1009821823300031897SoilGAPLRDRMRATAAVLSVGATCHFYLQQVDDPDKLRAIILEMATDLIS
Ga0306923_1078396923300031910SoilAPLRDRVRASAAMLSVGATCHVYLQQIDDPDKLRAIVLEIATDLIH
Ga0310912_1120250623300031941SoilRVRATTAVLAVGTSCMFFLRQVDDPDKLRAIVLEMATDLIS
Ga0310910_1119641813300031946SoilAPLRDRVRATAAMLSVGATCHVYQQQVDDPDKLRAIVLEIATDLIH
Ga0318562_1036458033300032008SoilRVRASAALLSVGATCHVYLQQVEDPDKLRAIVLEMATDLIH
Ga0318556_1061499613300032043SoilRVRASAALISVGASCHVYLQQIDDPDKLRAIVLEIATDLIH
Ga0318558_1071123013300032044SoilTALLSVGVTCMFFLQQVDDPDKLRAIVLELATDLVR
Ga0318514_1057860723300032066SoilAMLSVGATCHVYLQQVDDPDKLRAITLEIATDLIH
Ga0311301_1008448693300032160Peatlands SoilRDRVRATTAVLTVGATCMFFLRQVDDPDKLRAIVLEIATDLTS
Ga0307472_10095654113300032205Hardwood Forest SoilDRVRATTAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS
Ga0335085_1135990123300032770SoilAVLSVGMTCMFFLQQVDDRDKLRAIVLEMATDLIS
Ga0335078_1174340023300032805SoilATTAVLSVGATCMFFLRQVDDPDKLRAIVLEMATDLIS
Ga0335070_1148511113300032829SoilDRVRATAAVLTVGATCHFYLQQVEDPDKLRAIILEMATDLIS
Ga0335074_1049127513300032895SoilTAAVLSVSATCLFYLQQVDDPDKLRAIVLELATDLIH
Ga0335071_1009747313300032897SoilAVLTVGATCHFYLQQVEDPDKLRAIILEMATDLIS
Ga0318519_1032232213300033290SoilDRVRASAAVLGVGATCHVYLQQVDDPDKLRAIVLEIALDLIR
Ga0314865_088717_680_8083300033806PeatlandDRVRATSAVLAVGATCMFYLQQVDDPDKLRAIVLEMATDLVH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.