| Basic Information | |
|---|---|
| Family ID | F089259 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 40 residues |
| Representative Sequence | RATTAVLSVGATCMFFLQQVDDRDKLRAIVLEMATDLIN |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.83 % |
| % of genes near scaffold ends (potentially truncated) | 98.17 % |
| % of genes from short scaffolds (< 2000 bps) | 86.24 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.963 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.523 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.266 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.376 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF13424 | TPR_12 | 29.36 |
| PF01037 | AsnC_trans_reg | 5.50 |
| PF13412 | HTH_24 | 5.50 |
| PF00248 | Aldo_ket_red | 4.59 |
| PF01670 | Glyco_hydro_12 | 3.67 |
| PF13374 | TPR_10 | 3.67 |
| PF03023 | MurJ | 2.75 |
| PF13229 | Beta_helix | 2.75 |
| PF00196 | GerE | 1.83 |
| PF00723 | Glyco_hydro_15 | 1.83 |
| PF00291 | PALP | 0.92 |
| PF13480 | Acetyltransf_6 | 0.92 |
| PF00498 | FHA | 0.92 |
| PF13613 | HTH_Tnp_4 | 0.92 |
| PF13581 | HATPase_c_2 | 0.92 |
| PF00535 | Glycos_transf_2 | 0.92 |
| PF00903 | Glyoxalase | 0.92 |
| PF13578 | Methyltransf_24 | 0.92 |
| PF13432 | TPR_16 | 0.92 |
| PF04149 | DUF397 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0534 | Na+-driven multidrug efflux pump, DinF/NorM/MATE family | Defense mechanisms [V] | 2.75 |
| COG0728 | Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis) | Cell wall/membrane/envelope biogenesis [M] | 2.75 |
| COG2244 | Membrane protein involved in the export of O-antigen and teichoic acid | Cell wall/membrane/envelope biogenesis [M] | 2.75 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 1.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.96 % |
| Unclassified | root | N/A | 44.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_103228605 | Not Available | 1018 | Open in IMG/M |
| 3300000956|JGI10216J12902_109711478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. HKS02 | 1003 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10125656 | Not Available | 1030 | Open in IMG/M |
| 3300004479|Ga0062595_100499021 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005614|Ga0068856_101983344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 593 | Open in IMG/M |
| 3300005921|Ga0070766_10377420 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300005983|Ga0081540_1231957 | Not Available | 651 | Open in IMG/M |
| 3300006175|Ga0070712_100791028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 813 | Open in IMG/M |
| 3300006176|Ga0070765_101175724 | Not Available | 724 | Open in IMG/M |
| 3300006176|Ga0070765_101995419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300006804|Ga0079221_10076592 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300009089|Ga0099828_10822492 | Not Available | 831 | Open in IMG/M |
| 3300009090|Ga0099827_10974749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300009143|Ga0099792_10835626 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300009522|Ga0116218_1271485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300009672|Ga0116215_1000609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 26765 | Open in IMG/M |
| 3300010375|Ga0105239_12930919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
| 3300010379|Ga0136449_101167252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1217 | Open in IMG/M |
| 3300010876|Ga0126361_11244744 | Not Available | 795 | Open in IMG/M |
| 3300012189|Ga0137388_10708828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 934 | Open in IMG/M |
| 3300012202|Ga0137363_11075040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300012211|Ga0137377_10362431 | Not Available | 1387 | Open in IMG/M |
| 3300012357|Ga0137384_11510214 | Not Available | 521 | Open in IMG/M |
| 3300012960|Ga0164301_11686721 | Not Available | 529 | Open in IMG/M |
| 3300013297|Ga0157378_11459349 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300013297|Ga0157378_12735139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300016341|Ga0182035_11924227 | Not Available | 537 | Open in IMG/M |
| 3300016387|Ga0182040_11140110 | Not Available | 654 | Open in IMG/M |
| 3300016404|Ga0182037_10511959 | Not Available | 1008 | Open in IMG/M |
| 3300017821|Ga0187812_1080033 | Not Available | 1078 | Open in IMG/M |
| 3300017948|Ga0187847_10841749 | Not Available | 521 | Open in IMG/M |
| 3300017970|Ga0187783_10442690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 943 | Open in IMG/M |
| 3300017973|Ga0187780_10044974 | All Organisms → cellular organisms → Bacteria | 3077 | Open in IMG/M |
| 3300018001|Ga0187815_10019220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2941 | Open in IMG/M |
| 3300018007|Ga0187805_10014527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3364 | Open in IMG/M |
| 3300018043|Ga0187887_10104317 | Not Available | 1707 | Open in IMG/M |
| 3300018058|Ga0187766_10766125 | Not Available | 671 | Open in IMG/M |
| 3300019284|Ga0187797_1321432 | Not Available | 621 | Open in IMG/M |
| 3300020581|Ga0210399_10165239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus pulveris | 1834 | Open in IMG/M |
| 3300020581|Ga0210399_10936974 | Not Available | 701 | Open in IMG/M |
| 3300020581|Ga0210399_11315405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300020582|Ga0210395_10455393 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300020582|Ga0210395_10613094 | Not Available | 816 | Open in IMG/M |
| 3300021178|Ga0210408_10002685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 17038 | Open in IMG/M |
| 3300021178|Ga0210408_10989307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 651 | Open in IMG/M |
| 3300021377|Ga0213874_10296340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300021388|Ga0213875_10062324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → environmental samples → uncultured Corynebacteriales bacterium | 1744 | Open in IMG/M |
| 3300021403|Ga0210397_10031798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3297 | Open in IMG/M |
| 3300021403|Ga0210397_10183479 | Not Available | 1485 | Open in IMG/M |
| 3300021406|Ga0210386_10023625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4800 | Open in IMG/M |
| 3300021407|Ga0210383_10355040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1263 | Open in IMG/M |
| 3300021477|Ga0210398_11521846 | Not Available | 520 | Open in IMG/M |
| 3300021560|Ga0126371_13706834 | Not Available | 515 | Open in IMG/M |
| 3300022530|Ga0242658_1189707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300022531|Ga0242660_1160431 | Not Available | 595 | Open in IMG/M |
| 3300022532|Ga0242655_10132974 | Not Available | 714 | Open in IMG/M |
| 3300022724|Ga0242665_10138492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. HKS02 | 759 | Open in IMG/M |
| 3300024271|Ga0224564_1138789 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300025898|Ga0207692_10023200 | All Organisms → cellular organisms → Bacteria | 2867 | Open in IMG/M |
| 3300025898|Ga0207692_10024389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2812 | Open in IMG/M |
| 3300025900|Ga0207710_10043658 | Not Available | 1995 | Open in IMG/M |
| 3300025911|Ga0207654_10163784 | Not Available | 1439 | Open in IMG/M |
| 3300025916|Ga0207663_10016262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4121 | Open in IMG/M |
| 3300025916|Ga0207663_10048428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2631 | Open in IMG/M |
| 3300026078|Ga0207702_12059263 | Not Available | 561 | Open in IMG/M |
| 3300027096|Ga0208099_1050544 | Not Available | 593 | Open in IMG/M |
| 3300027504|Ga0209114_1046488 | Not Available | 756 | Open in IMG/M |
| 3300027765|Ga0209073_10303617 | Not Available | 633 | Open in IMG/M |
| 3300027765|Ga0209073_10505312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300027768|Ga0209772_10258281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300027855|Ga0209693_10298502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 785 | Open in IMG/M |
| 3300028789|Ga0302232_10505593 | Not Available | 594 | Open in IMG/M |
| 3300028799|Ga0307284_10204524 | Not Available | 777 | Open in IMG/M |
| 3300028863|Ga0302218_10162589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 709 | Open in IMG/M |
| 3300028877|Ga0302235_10449333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 549 | Open in IMG/M |
| 3300028906|Ga0308309_10351225 | Not Available | 1257 | Open in IMG/M |
| 3300030053|Ga0302177_10156979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1277 | Open in IMG/M |
| 3300030494|Ga0310037_10141937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1094 | Open in IMG/M |
| 3300030740|Ga0265460_12298624 | Not Available | 569 | Open in IMG/M |
| 3300030906|Ga0302314_11274136 | Not Available | 682 | Open in IMG/M |
| 3300031040|Ga0265754_1043772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300031236|Ga0302324_100336632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia rhizosphera | 2289 | Open in IMG/M |
| 3300031525|Ga0302326_11202643 | Not Available | 1042 | Open in IMG/M |
| 3300031573|Ga0310915_11158850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 536 | Open in IMG/M |
| 3300031681|Ga0318572_10574518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 672 | Open in IMG/M |
| 3300031708|Ga0310686_103148279 | Not Available | 727 | Open in IMG/M |
| 3300031708|Ga0310686_111744721 | Not Available | 1381 | Open in IMG/M |
| 3300031708|Ga0310686_115417773 | Not Available | 1145 | Open in IMG/M |
| 3300031769|Ga0318526_10493716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300031781|Ga0318547_10596494 | Not Available | 685 | Open in IMG/M |
| 3300031832|Ga0318499_10020093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 2312 | Open in IMG/M |
| 3300031890|Ga0306925_11956468 | Not Available | 555 | Open in IMG/M |
| 3300031897|Ga0318520_10098218 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300031910|Ga0306923_10783969 | Not Available | 1054 | Open in IMG/M |
| 3300031941|Ga0310912_11202506 | Not Available | 577 | Open in IMG/M |
| 3300031946|Ga0310910_11196418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 590 | Open in IMG/M |
| 3300032008|Ga0318562_10364580 | Not Available | 840 | Open in IMG/M |
| 3300032043|Ga0318556_10614996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 566 | Open in IMG/M |
| 3300032044|Ga0318558_10711230 | Not Available | 502 | Open in IMG/M |
| 3300032066|Ga0318514_10578607 | Not Available | 598 | Open in IMG/M |
| 3300032160|Ga0311301_10084486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6450 | Open in IMG/M |
| 3300032205|Ga0307472_100956541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 798 | Open in IMG/M |
| 3300032770|Ga0335085_11359901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
| 3300032805|Ga0335078_11743400 | Not Available | 681 | Open in IMG/M |
| 3300032829|Ga0335070_11485111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300032895|Ga0335074_10491275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1279 | Open in IMG/M |
| 3300032897|Ga0335071_10097473 | All Organisms → cellular organisms → Bacteria | 2884 | Open in IMG/M |
| 3300033290|Ga0318519_10322322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2575 | 908 | Open in IMG/M |
| 3300033806|Ga0314865_088717 | Not Available | 808 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.42% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.83% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.83% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1032286051 | 3300000956 | Soil | RATTAVLSVGATCMFFLQQVDDRDKLRAIVLEMATDLIN* |
| JGI10216J12902_1097114781 | 3300000956 | Soil | AVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS* |
| JGIcombinedJ51221_101256561 | 3300003505 | Forest Soil | APLRDRVRTSAAVLSVSATCLFYLQQVDDPDKLRAIVLEMATDLLH* |
| Ga0062595_1004990211 | 3300004479 | Soil | RATTAVLSVGATCMFFLHEVDDRDKLRAIVLEMATDLIPVAR* |
| Ga0068856_1019833443 | 3300005614 | Corn Rhizosphere | RVRATTAVLSVGATCMFFLDQVDDRDKLRAIVLEMATDLIG* |
| Ga0070766_103774202 | 3300005921 | Soil | APLRDRVRATTATLAVGATCHFYLQQVDDPDKLRAIVLEIALDLIH* |
| Ga0081540_12319571 | 3300005983 | Tabebuia Heterophylla Rhizosphere | AVLSVGATCMFFLQQVDDRDKLRAIVLEMATDLIPLTR* |
| Ga0070712_1007910281 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TTAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS* |
| Ga0070765_1011757241 | 3300006176 | Soil | RERVRATAALLSVGATCHVYLQQAEDPDKLRAIITEIATDLIR* |
| Ga0070765_1019954191 | 3300006176 | Soil | RDRVRATAAMLSVGAACHVYLQQVDDPDKLRAIILEIATDLIH* |
| Ga0079221_100765921 | 3300006804 | Agricultural Soil | RVRATAAIMSVGATCIFFLQQVDDRDKLRAIVLEMATDLIG* |
| Ga0099828_108224923 | 3300009089 | Vadose Zone Soil | AATAVLAVGGTCMVFLQQVDDPDKLRAIVLEMATDLTR* |
| Ga0099827_109747492 | 3300009090 | Vadose Zone Soil | DRVRATAGVLTVGATCMFYLHQVDDRDKLRAIVLEIASDLTS* |
| Ga0099792_108356261 | 3300009143 | Vadose Zone Soil | AVLSVGATCMFFVQEVDDRDKLRAIVLEMATDLIS* |
| Ga0116218_12714852 | 3300009522 | Peatlands Soil | VLAVGATCVFYLQQVDDQDKLRAIVLEMATDLIQ* |
| Ga0116215_10006091 | 3300009672 | Peatlands Soil | TTATLAVGATCMFFLQQVDDQDKLRAIVLEIATDLTS* |
| Ga0105239_129309191 | 3300010375 | Corn Rhizosphere | APLRDRVRATTAVLSVGATCMFFLQQVDDREKLRAIVLEMATDLIG* |
| Ga0136449_1011672522 | 3300010379 | Peatlands Soil | PLRERVRATTAVLAVGATCVFYLQQVDEVDKLRAIVLEMATDLIQ* |
| Ga0126361_112447441 | 3300010876 | Boreal Forest Soil | LRERVRATAALLSVGATCHVYLQQAEDPDKLRAIITEIATDLIR* |
| Ga0137388_107088282 | 3300012189 | Vadose Zone Soil | DRVRATAGVLTVGATCMFYLQQVDDRDKLRAIVLEIASDLTS* |
| Ga0137363_110750402 | 3300012202 | Vadose Zone Soil | RATTAVLSIGATCMFFLQEMDERDKLRATVLEMATDLIS* |
| Ga0137377_103624312 | 3300012211 | Vadose Zone Soil | AVLSVGATCMFFVQEVDDRDKLRDIVLEMATDLIS* |
| Ga0137384_115102143 | 3300012357 | Vadose Zone Soil | VRATAAVLSVGATCMFYLHQVDDRDKLRAIVLEMATDLIPVIR* |
| Ga0164301_116867212 | 3300012960 | Soil | ATTAVLSVGAPCIFFLQQVDDRKKLRAIVREMATDLIG* |
| Ga0157378_114593492 | 3300013297 | Miscanthus Rhizosphere | VRATSAVLATGATCMFYLQQVDDPDKLRAIVLEIATDLIG* |
| Ga0157378_127351391 | 3300013297 | Miscanthus Rhizosphere | TAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS* |
| Ga0182035_119242271 | 3300016341 | Soil | TAVLAVGATCHVYLQQVDDPDKLRAIVLEIALDLIH |
| Ga0182040_111401102 | 3300016387 | Soil | ATAAMLSVGATCHVYQQQVDDPDKLRAIVLEIANDLIR |
| Ga0182037_105119592 | 3300016404 | Soil | APLRDRMRATAAVLSVGATCHFYLQQVDDPDKLRAIVLEIATDLIS |
| Ga0187812_10800331 | 3300017821 | Freshwater Sediment | AVLTVGATCLFYLQQVDDPDKLRAVVLEIATDLIH |
| Ga0187847_108417491 | 3300017948 | Peatland | RASTAVIAVGAACRFFLQRTDDRDKLRAIVLEIATDLTS |
| Ga0187783_104426902 | 3300017970 | Tropical Peatland | TAAVLTVGAVCHFYLQQVDDPDKLRAIVMEIATDLIH |
| Ga0187780_100449743 | 3300017973 | Tropical Peatland | LRDRVRATAAMLSVGATCHVYQQQVDDPDKLRAIVLEIATDLIR |
| Ga0187815_100192201 | 3300018001 | Freshwater Sediment | ATTAVLTVGATCLFYLQQVDDPDKLRAVVLEIANDLVR |
| Ga0187805_100145273 | 3300018007 | Freshwater Sediment | ATAAVVSVGSTYMFYLQQVDDQDKLGEIILELATDLTH |
| Ga0187887_101043171 | 3300018043 | Peatland | APLRDRVRASTAVIAVGATCRFYLQQIEDRDELRAIVLEITNDLIS |
| Ga0187766_107661251 | 3300018058 | Tropical Peatland | RASTAVLAVGATCHVYLQQADDPDKLRAIVLEIALDLIH |
| Ga0187797_13214321 | 3300019284 | Peatland | AITAILAVGATYMFYMQQVDDPDKLGAIILEIATDLIH |
| Ga0210399_101652392 | 3300020581 | Soil | RVRATAATLTVGATCHVYLQRVDDPDKLRAIILEIATDLIH |
| Ga0210399_109369743 | 3300020581 | Soil | RDRVRATAAVLSVGAICMFFLQEVNDRDKLRAIVLEMATDLIG |
| Ga0210399_113154051 | 3300020581 | Soil | RVRATTAVLSVGATCMFFLQEVNDRDKLRAIVLEMATDLIS |
| Ga0210395_104553931 | 3300020582 | Soil | RVRATAATLTVGATCHVYLQQVDDPDKLRAVILEIATDLIH |
| Ga0210395_106130941 | 3300020582 | Soil | VLAVGATCVFYVQQVDDRDKLRAIVLEMATDLIPVDRSY |
| Ga0210408_100026851 | 3300021178 | Soil | DAPLRERVRATAATLTVGATCHVYLQKVDDPDKLRAIILEIATDLIH |
| Ga0210408_109893072 | 3300021178 | Soil | ATLTVGATCHVYLQKVDDPDKLRAIILEIATDLIH |
| Ga0213874_102963401 | 3300021377 | Plant Roots | TAVLSVGATCHVYLQQVDDLDKLRAIVLEIATDLIS |
| Ga0213875_100623241 | 3300021388 | Plant Roots | TAVLSVGMTCMFFLEQVNDRDKLRAIVLEMATDLIS |
| Ga0210397_100317984 | 3300021403 | Soil | LRERVRATAATLTVGATCHVYLQRVDDPDKLRAIILEIATDLIR |
| Ga0210397_101834792 | 3300021403 | Soil | DRVRATTAVLSVGATCMFFLQEVNDRDKLRAIVLEMATDLIS |
| Ga0210386_100236254 | 3300021406 | Soil | RATAATLTVGATCHVYLQKVDDPDKLRAIILEIATDLIH |
| Ga0210383_103550401 | 3300021407 | Soil | AATLTVGATCHVYLQQVDDPDKLRAIILEIATDLIH |
| Ga0210398_115218462 | 3300021477 | Soil | SAAVLSVSATCLFYLQQVDDPDKLRAIVLEMATDLLH |
| Ga0126371_137068341 | 3300021560 | Tropical Forest Soil | QVRDRVRATAAVLTVGATCHFYLQQVDDPDKLRAIILEMATDLIG |
| Ga0242658_11897071 | 3300022530 | Soil | VRATTAVLSVGATCMFFLQEVNDRDKLRAIVLEMAT |
| Ga0242660_11604311 | 3300022531 | Soil | PLRERVRATAATLTVGATCHVYLQQVDDPDKLRAIILEIATDLIH |
| Ga0242655_101329742 | 3300022532 | Soil | ATAATLTVGATCHVYLQQVDDPDKLRAITLEIATDLIH |
| Ga0242665_101384921 | 3300022724 | Soil | AVLSVGATCMFFLQQVDDRDKLRAIVLEMATDLIS |
| Ga0224564_11387892 | 3300024271 | Soil | PGAPLRERVRATAATLAVGATCHVYLQEVDDPDKLRAIILEIATDLIH |
| Ga0207692_100232003 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VRATSAVLATGATCMFYLQQVDDPDKLRAIVLEIATDLIG |
| Ga0207692_100243893 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VRATTAVLSLGATCHFYLQRVDDPDKLRAIVLEMAADLIG |
| Ga0207710_100436582 | 3300025900 | Switchgrass Rhizosphere | TAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS |
| Ga0207654_101637842 | 3300025911 | Corn Rhizosphere | RVRATTAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS |
| Ga0207663_100162626 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RATTAVLSVGATCIFFLQQVDDREKLRAIVLEMATDLIG |
| Ga0207663_100484282 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RVRATTAVLSAGATCMFFVQEVDDRDKLRAIVLEMATDLIS |
| Ga0207702_120592631 | 3300026078 | Corn Rhizosphere | RDRVRATTAVLSVGATCMFFLDQVDDRDKLRAIVLEMATDLIG |
| Ga0208099_10505441 | 3300027096 | Forest Soil | STAVIAVGATCRFFLQEIDDRDKLRAIVLEIATDLTS |
| Ga0209114_10464882 | 3300027504 | Forest Soil | ERVRATTAVLSAGTSCMFFLEQIDDKDKLRAIVLELAEDLIG |
| Ga0209073_103036171 | 3300027765 | Agricultural Soil | RATTAVISVGATCMFFLDQVDDRDKLRAIVLEMAADLTG |
| Ga0209073_105053121 | 3300027765 | Agricultural Soil | ATTAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS |
| Ga0209772_102582811 | 3300027768 | Bog Forest Soil | DRVRGTTAVLAVGATCMFFLQQVDDHDKLRAIVLEMATDLTG |
| Ga0209693_102985022 | 3300027855 | Soil | RATAATLTVGATCHVYLQQVDDPDKLRAIILEIATDLIH |
| Ga0302232_105055932 | 3300028789 | Palsa | DRVRASTALIAVGATCRFFLQQTEDRDKLRAIVREIATDLTS |
| Ga0307284_102045241 | 3300028799 | Soil | RATTAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS |
| Ga0302218_101625891 | 3300028863 | Palsa | PLRERVRATAATLTVGAICHVYLTQVDDPDKLRAVILEIATDLIH |
| Ga0302235_104493331 | 3300028877 | Palsa | IAVGATCRFFLQQADDRDKLRAIVLEIATDLIPVDR |
| Ga0308309_103512251 | 3300028906 | Soil | VRATAAMLSVGATCHVYLQQVDDPDKLRAITLEIATDLIH |
| Ga0302177_101569792 | 3300030053 | Palsa | PLRDRVRASTAVIAVGATCRFFLQQTDDRDKLRAIVLEIATDLTS |
| Ga0310037_101419372 | 3300030494 | Peatlands Soil | RTTAAVLSVGATYMFYLQQAEDQDKLGAIILELATDLTH |
| Ga0265460_122986242 | 3300030740 | Soil | APLRARVRATAAVLSVGATYMFYLQEVDDPDKLGAIILELATDLTH |
| Ga0302314_112741362 | 3300030906 | Palsa | STAVIAVGAGCRFFLRQAGDEDKLRAIVLEMATDLTSG |
| Ga0265754_10437721 | 3300031040 | Soil | LRDRVRATAAMLSVGAACHVYLQQVDDPDKLRAIILEIATDLIH |
| Ga0302324_1003366323 | 3300031236 | Palsa | DRVRASTAVIAVGATCRFFLQQTDDRDELRTIALEIATDLIPVDR |
| Ga0302326_112026433 | 3300031525 | Palsa | LRERVRATAATLTVGAICHVYLTQVDDPDKLRAVILEIATDLIH |
| Ga0310915_111588501 | 3300031573 | Soil | VRATAAMLSVGATCHVYLQQVDDPDKLRAIILEIATDLIH |
| Ga0318572_105745182 | 3300031681 | Soil | VRATAGVLSVGATCMFYLQQVDDPDKLRAIVLEMATDLIS |
| Ga0310686_1031482791 | 3300031708 | Soil | RVRATAALLSVGAACHVYLQQVDDPDKLRAIILEIATDLIH |
| Ga0310686_1117447212 | 3300031708 | Soil | RATAATLTVGATCHVYLQQVDDPDKLRAIILEIATDLIR |
| Ga0310686_1154177732 | 3300031708 | Soil | RERVRATAATLTVGATCHVYLQQVDDPDKLRAIILEIATDLIR |
| Ga0318526_104937161 | 3300031769 | Soil | LRDRVRATTAILAVGATCMFYLQRVDDPEKLRAIILETSLDLIH |
| Ga0318547_105964942 | 3300031781 | Soil | ASAAVLGVGATCHVYLQQVDDPDKLRAIVLEIALDLIR |
| Ga0318499_100200931 | 3300031832 | Soil | ALLRDRVRASAALLSVGATCHVYLQQVDDPDKLRAIVLEMATDLIH |
| Ga0306925_119564682 | 3300031890 | Soil | SAAVLGVGATCHVYLQQVDDPDKLRAIVLEIALDLIR |
| Ga0318520_100982182 | 3300031897 | Soil | GAPLRDRMRATAAVLSVGATCHFYLQQVDDPDKLRAIILEMATDLIS |
| Ga0306923_107839692 | 3300031910 | Soil | APLRDRVRASAAMLSVGATCHVYLQQIDDPDKLRAIVLEIATDLIH |
| Ga0310912_112025062 | 3300031941 | Soil | RVRATTAVLAVGTSCMFFLRQVDDPDKLRAIVLEMATDLIS |
| Ga0310910_111964181 | 3300031946 | Soil | APLRDRVRATAAMLSVGATCHVYQQQVDDPDKLRAIVLEIATDLIH |
| Ga0318562_103645803 | 3300032008 | Soil | RVRASAALLSVGATCHVYLQQVEDPDKLRAIVLEMATDLIH |
| Ga0318556_106149961 | 3300032043 | Soil | RVRASAALISVGASCHVYLQQIDDPDKLRAIVLEIATDLIH |
| Ga0318558_107112301 | 3300032044 | Soil | TALLSVGVTCMFFLQQVDDPDKLRAIVLELATDLVR |
| Ga0318514_105786072 | 3300032066 | Soil | AMLSVGATCHVYLQQVDDPDKLRAITLEIATDLIH |
| Ga0311301_100844869 | 3300032160 | Peatlands Soil | RDRVRATTAVLTVGATCMFFLRQVDDPDKLRAIVLEIATDLTS |
| Ga0307472_1009565411 | 3300032205 | Hardwood Forest Soil | DRVRATTAVLSVGATCMFFLQEVDDRDKLRAIVLEMATDLIS |
| Ga0335085_113599012 | 3300032770 | Soil | AVLSVGMTCMFFLQQVDDRDKLRAIVLEMATDLIS |
| Ga0335078_117434002 | 3300032805 | Soil | ATTAVLSVGATCMFFLRQVDDPDKLRAIVLEMATDLIS |
| Ga0335070_114851111 | 3300032829 | Soil | DRVRATAAVLTVGATCHFYLQQVEDPDKLRAIILEMATDLIS |
| Ga0335074_104912751 | 3300032895 | Soil | TAAVLSVSATCLFYLQQVDDPDKLRAIVLELATDLIH |
| Ga0335071_100974731 | 3300032897 | Soil | AVLTVGATCHFYLQQVEDPDKLRAIILEMATDLIS |
| Ga0318519_103223221 | 3300033290 | Soil | DRVRASAAVLGVGATCHVYLQQVDDPDKLRAIVLEIALDLIR |
| Ga0314865_088717_680_808 | 3300033806 | Peatland | DRVRATSAVLAVGATCMFYLQQVDDPDKLRAIVLEMATDLVH |
| ⦗Top⦘ |