| Basic Information | |
|---|---|
| Family ID | F089251 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 53 residues |
| Representative Sequence | LRAQGVSADDAAKRVDLTAHAKDFPDILGPGAEFRGVRRIYAWMDEQKRK |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.86 % |
| % of genes near scaffold ends (potentially truncated) | 93.58 % |
| % of genes from short scaffolds (< 2000 bps) | 90.83 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.239 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (7.339 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.119 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.881 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF00082 | Peptidase_S8 | 4.59 |
| PF02627 | CMD | 3.67 |
| PF05853 | BKACE | 3.67 |
| PF00679 | EFG_C | 2.75 |
| PF07883 | Cupin_2 | 2.75 |
| PF06439 | 3keto-disac_hyd | 1.83 |
| PF00171 | Aldedh | 1.83 |
| PF02518 | HATPase_c | 1.83 |
| PF09286 | Pro-kuma_activ | 1.83 |
| PF03764 | EFG_IV | 1.83 |
| PF06983 | 3-dmu-9_3-mt | 1.83 |
| PF13669 | Glyoxalase_4 | 0.92 |
| PF13442 | Cytochrome_CBB3 | 0.92 |
| PF13505 | OMP_b-brl | 0.92 |
| PF00753 | Lactamase_B | 0.92 |
| PF02082 | Rrf2 | 0.92 |
| PF01613 | Flavin_Reduct | 0.92 |
| PF12681 | Glyoxalase_2 | 0.92 |
| PF13751 | DDE_Tnp_1_6 | 0.92 |
| PF00593 | TonB_dep_Rec | 0.92 |
| PF04909 | Amidohydro_2 | 0.92 |
| PF03404 | Mo-co_dimer | 0.92 |
| PF02527 | GidB | 0.92 |
| PF03473 | MOSC | 0.92 |
| PF01494 | FAD_binding_3 | 0.92 |
| PF02633 | Creatininase | 0.92 |
| PF01384 | PHO4 | 0.92 |
| PF00497 | SBP_bac_3 | 0.92 |
| PF00106 | adh_short | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 3.67 |
| COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 3.67 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 3.67 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 1.83 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.83 |
| COG0480 | Translation elongation factor EF-G, a GTPase | Translation, ribosomal structure and biogenesis [J] | 1.83 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 1.83 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 1.83 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.83 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.83 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.83 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.92 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.92 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.92 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.92 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.92 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.92 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.92 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.92 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.92 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.92 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.92 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.92 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.92 |
| COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 0.92 |
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.24 % |
| Unclassified | root | N/A | 13.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005330|Ga0070690_100248039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1258 | Open in IMG/M |
| 3300005337|Ga0070682_102027696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 506 | Open in IMG/M |
| 3300005341|Ga0070691_11081236 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005366|Ga0070659_100168067 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300005367|Ga0070667_100269296 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300005435|Ga0070714_102259328 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005439|Ga0070711_100688074 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300005444|Ga0070694_100921150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
| 3300005468|Ga0070707_101249156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300005535|Ga0070684_102141121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 528 | Open in IMG/M |
| 3300005539|Ga0068853_102388302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 512 | Open in IMG/M |
| 3300005542|Ga0070732_10676737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300005546|Ga0070696_101083767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300005547|Ga0070693_101556426 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005548|Ga0070665_101554731 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005563|Ga0068855_100354006 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300005575|Ga0066702_10303255 | Not Available | 974 | Open in IMG/M |
| 3300005607|Ga0070740_10050493 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300005614|Ga0068856_100184441 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
| 3300005618|Ga0068864_101715382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 633 | Open in IMG/M |
| 3300005618|Ga0068864_102610628 | Not Available | 511 | Open in IMG/M |
| 3300005718|Ga0068866_11283840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 531 | Open in IMG/M |
| 3300005764|Ga0066903_107068040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300005834|Ga0068851_10438567 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300006052|Ga0075029_100553439 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300006059|Ga0075017_100780790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 738 | Open in IMG/M |
| 3300006086|Ga0075019_10672882 | Not Available | 653 | Open in IMG/M |
| 3300006175|Ga0070712_101107821 | Not Available | 687 | Open in IMG/M |
| 3300006358|Ga0068871_100005572 | All Organisms → cellular organisms → Bacteria | 8826 | Open in IMG/M |
| 3300006358|Ga0068871_100643778 | Not Available | 967 | Open in IMG/M |
| 3300006358|Ga0068871_101913957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300006755|Ga0079222_10116107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1446 | Open in IMG/M |
| 3300006954|Ga0079219_10794863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300007788|Ga0099795_10450100 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009093|Ga0105240_10394067 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300009137|Ga0066709_103087185 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300009148|Ga0105243_10961903 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300009148|Ga0105243_11334642 | Not Available | 736 | Open in IMG/M |
| 3300009174|Ga0105241_12406324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300009176|Ga0105242_10887982 | Not Available | 890 | Open in IMG/M |
| 3300009176|Ga0105242_11455606 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300009177|Ga0105248_11333209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300009551|Ga0105238_11799759 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010043|Ga0126380_11157001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
| 3300010159|Ga0099796_10013770 | All Organisms → cellular organisms → Bacteria | 2318 | Open in IMG/M |
| 3300010341|Ga0074045_10613223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300010358|Ga0126370_11083412 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300010360|Ga0126372_11444672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
| 3300010375|Ga0105239_12541844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300010401|Ga0134121_10267632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1501 | Open in IMG/M |
| 3300011270|Ga0137391_11340906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300012189|Ga0137388_11534116 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012361|Ga0137360_10255681 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300012362|Ga0137361_11351842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300012909|Ga0157290_10120618 | Not Available | 802 | Open in IMG/M |
| 3300012923|Ga0137359_11052075 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012971|Ga0126369_10040586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3904 | Open in IMG/M |
| 3300012971|Ga0126369_10579318 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300013105|Ga0157369_11706944 | Not Available | 640 | Open in IMG/M |
| 3300013296|Ga0157374_12899560 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300013297|Ga0157378_12232761 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300013297|Ga0157378_12239952 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300013306|Ga0163162_11540749 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300014164|Ga0181532_10475225 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300014314|Ga0075316_1197843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium zhanjiangense | 529 | Open in IMG/M |
| 3300014325|Ga0163163_12260889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300014968|Ga0157379_11347751 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300014969|Ga0157376_11302263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300016341|Ga0182035_10310741 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1296 | Open in IMG/M |
| 3300017823|Ga0187818_10367105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
| 3300017930|Ga0187825_10170038 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300017994|Ga0187822_10071370 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300017996|Ga0187891_1197152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300018433|Ga0066667_11320291 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300019362|Ga0173479_10891067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300021178|Ga0210408_10774899 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300021478|Ga0210402_11428854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300025901|Ga0207688_10929951 | Not Available | 550 | Open in IMG/M |
| 3300025913|Ga0207695_10273038 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300025913|Ga0207695_11176132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 647 | Open in IMG/M |
| 3300025924|Ga0207694_10577966 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300025938|Ga0207704_11739843 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300025945|Ga0207679_10846891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 835 | Open in IMG/M |
| 3300025945|Ga0207679_11547186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 608 | Open in IMG/M |
| 3300025986|Ga0207658_11342373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300026095|Ga0207676_11455088 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300026116|Ga0207674_12305485 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300026121|Ga0207683_11852612 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300027176|Ga0208992_1020379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 860 | Open in IMG/M |
| 3300027643|Ga0209076_1231771 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027706|Ga0209581_1040076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1962 | Open in IMG/M |
| 3300027842|Ga0209580_10410890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300027842|Ga0209580_10569957 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300029883|Ga0311327_10931504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300031128|Ga0170823_10518640 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300031232|Ga0302323_100233422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1876 | Open in IMG/M |
| 3300031524|Ga0302320_10021272 | All Organisms → cellular organisms → Bacteria | 12887 | Open in IMG/M |
| 3300031823|Ga0307478_11538762 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031902|Ga0302322_103188148 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031942|Ga0310916_10168245 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300031947|Ga0310909_10720747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 828 | Open in IMG/M |
| 3300031962|Ga0307479_10442880 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300032001|Ga0306922_10710572 | Not Available | 1057 | Open in IMG/M |
| 3300032001|Ga0306922_11729425 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300032076|Ga0306924_11542778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.59% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.75% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.83% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.83% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.92% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.92% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027176 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070690_1002480393 | 3300005330 | Switchgrass Rhizosphere | TAQVATLRKQGVSADDAAKRVDLTSHKKDFPEIAQGAEPRGVRRIYQWMQENKK* |
| Ga0070680_1004909061 | 3300005336 | Corn Rhizosphere | RDKSIITAFQSYLTDITAQIATLRQQGVSADDAAKRLDLTAHKKDFPEIARGAEPRGVRRLYQWMDEREKR* |
| Ga0070682_1020276962 | 3300005337 | Corn Rhizosphere | QQGVSADDAAKRVDLTAHKKDFPDIALGAEPRGVRRIYQWMDERAKQ* |
| Ga0070691_110812361 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | DLRGQGVSPEDAARRVDLTSHAKDFPQIIGPGADIRGVRRVYAWMDETGKK* |
| Ga0070659_1001680672 | 3300005366 | Corn Rhizosphere | TLRQQGVSADDAAKRVDLTAHKKDFPDIALGAEPRGVRRIYQWMDERAKQ* |
| Ga0070667_1002692961 | 3300005367 | Switchgrass Rhizosphere | LRAQGATPEQAAQRVDLTSHQKEFPQITGPGADLRGVRRIYSWMDERARK* |
| Ga0070714_1022593281 | 3300005435 | Agricultural Soil | DDAAKRVDLTKHAKAFPDILGPGAEVRGIRRVYAWMDEQKRK* |
| Ga0070711_1006880743 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SDITTKIAGLRAQGLTADQAASRVDLTNHAKDFPQITGLGADARGVRRIYAWMDERARK* |
| Ga0070694_1009211501 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ELRKQRVPADEAARRVDLTSHRADFPDIRQPGAEVRGVRRLYEWMDEKEKKK* |
| Ga0070707_1012491561 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VADLRAQGATPEQAAQRVDLTSHAKEFPQITGPGADLRGVRRIYAWMDERARK* |
| Ga0070684_1021411212 | 3300005535 | Corn Rhizosphere | TAQVATLRQQGVSADDAAKRVDLTAHKKDFPDIALGAEPRGVRRIYQWMDERAKQ* |
| Ga0068853_1023883022 | 3300005539 | Corn Rhizosphere | VSADDAAKRIDLTSHQKDFPAIRQPGADTRGVRRLYVWLDEHPSR* |
| Ga0070732_106767371 | 3300005542 | Surface Soil | LRAQGVTADEAARRVDLTSHQKDFPQITGPGADIRGVRRIYAWMDERGAKK* |
| Ga0070696_1010837671 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VADLRAQGSTAEQAAARVDMTSHQKEFPQITGPGADLRGVRRIYAWMDDRARK* |
| Ga0070693_1015564262 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | QGVSADDAAKRVDLRSHAKDFPDIEDVGAEFRGVRRIYAWMDERGKK* |
| Ga0070665_1015547311 | 3300005548 | Switchgrass Rhizosphere | VAKLRAQGVSADDAAKRVDLRSHAKDFPDIEAVGAEVRGIRRLYAWMDETGRK* |
| Ga0068855_1003540063 | 3300005563 | Corn Rhizosphere | LRGQGATAEEAALRVDLTSHQKDFPQIAGPGADLRGVRRIYAWMDERAPNKITK* |
| Ga0066702_103032551 | 3300005575 | Soil | QLKAQGVPAEEAARRVDLTSHARYFPQIQGPGTDLRGMKRVYAWLDERYAK* |
| Ga0070740_100504931 | 3300005607 | Surface Soil | KFKNEGVSPEDAAKRVDLTAHAKDFPQITGPGADIRGVRRMYAWLDEQQAAK* |
| Ga0068856_1001844413 | 3300005614 | Corn Rhizosphere | LTDITAQVAALRQQGVSADDAAKRVDLTAHKKDFPDIALGAEPRGVRRIYQWMDERAKQ* |
| Ga0068864_1017153821 | 3300005618 | Switchgrass Rhizosphere | QVATLRQQGVSADDAAKRVDLTAHKKDFPDIALGAEPRGVRRIYQWMDERAKQ* |
| Ga0068864_1026106281 | 3300005618 | Switchgrass Rhizosphere | KLRAQGVSADDAAKRVDLTKHAKAFPDILGPGAEVRGVRRIYAWMDEQKRK* |
| Ga0068866_112838401 | 3300005718 | Miscanthus Rhizosphere | ITAQVATLRQQGVSADDAAKRVDLTAHKKDFPDIALGAEPRGVRRIYQWMDERAKQ* |
| Ga0066903_1070680402 | 3300005764 | Tropical Forest Soil | LTDLINQVTKLKNEGVSPDDAAKRVDLTAHAKDFPQITGLGAEIRGVRRVYAWLDEQRSSR* |
| Ga0068851_104385672 | 3300005834 | Corn Rhizosphere | VTKKVGDLRAQGATPEQAAQRVDLTSHQKEFPQITGPGADLRGVRRIYAWMDERARK* |
| Ga0075029_1005534391 | 3300006052 | Watersheds | ARVADLRKQGATPEEAAKRVDLTSHQKDFPEIQSVGADLRGVRRIYQWMDETQKK* |
| Ga0075017_1007807902 | 3300006059 | Watersheds | VSADDAAQRVNLTSHAKDFPQITGPGAEVRGVRRIYAWMDERGKK* |
| Ga0075019_106728821 | 3300006086 | Watersheds | NQVSKLKNDGVSPDDAAKRVDLTAHAKNFSQITGPGAEIRGVRRMYAWLDEQRAAK* |
| Ga0075030_1013710831 | 3300006162 | Watersheds | PFRDKGLIAAFQSYLSDLLAQVAKLRAKGISADDAAKQVDLTSHTKDFPDIQGPGAEVRGVRRVYAWMDERHKK* |
| Ga0070712_1011078212 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RAQGVSADDAAKRVDLTAHAKAFPDIQGPGAEVRGIRRVYAWMDEQKPK* |
| Ga0068871_10000557212 | 3300006358 | Miscanthus Rhizosphere | LRQQGVSADDAAKRVDLTAHKKDFPDIALGAEPRGVRRIYQWMDERAKQ* |
| Ga0068871_1006437782 | 3300006358 | Miscanthus Rhizosphere | KLRAQGVSADDAAKRVDLTAHAKDFPDILGPGAEFRGVRRIYAWMDEQKRK* |
| Ga0068871_1019139572 | 3300006358 | Miscanthus Rhizosphere | VTKKVGDLRAQGATAEQAAVRVDLTSHQKDFPQITGPGADLRGVRRIYAWMDERTARK* |
| Ga0079222_101161073 | 3300006755 | Agricultural Soil | RAHGATAEEAARRVDLTSHQKDFPQITGPGADLRGVRRIYAWMDERAAGAKK* |
| Ga0079219_107948631 | 3300006954 | Agricultural Soil | DITKKVADLRAHGATAEEAARRVDLTSHQKDFPQITGPGADLRGVRRIYAWMDEKAAGANQ* |
| Ga0099795_104501001 | 3300007788 | Vadose Zone Soil | KNEGVSPEDAAKRVDLTAHAKEFAQITGPGAEIRGVRRMYVWLDEQRAAR* |
| Ga0105240_103940673 | 3300009093 | Corn Rhizosphere | VTKKVGDLRAQGATPEQAAQRVDLTSHQKEFPQITGPGADLRGVRRIYSWMDERARK* |
| Ga0066709_1030871852 | 3300009137 | Grasslands Soil | AQGTSADEAAKQVDLTAHAKDFPDIQGLGAEVRGVRRVYAWMDERSRK* |
| Ga0105243_109619031 | 3300009148 | Miscanthus Rhizosphere | VAKLRAQGVSADDAAKRVDLRSHAKDFPDIEDVGAEVRGIRRVYAWMDEQKKK* |
| Ga0105243_113346422 | 3300009148 | Miscanthus Rhizosphere | AQVATLRKQGVSADDAAKRVDLTSHKKDFPEIAQGAEPRGVRRIYQWMQENKK* |
| Ga0105241_124063242 | 3300009174 | Corn Rhizosphere | VTKKVADLRGQGATAEQAALRVDLTSHQKDFPQIAGPGADLRGVRRIYAWMDERAPNKITK* |
| Ga0105242_108879821 | 3300009176 | Miscanthus Rhizosphere | AAKRVDMRAHAKAFPDIEDVGAEVRGVRRIYAWMDERKTKNK* |
| Ga0105242_114556061 | 3300009176 | Miscanthus Rhizosphere | LKRSGVTPEDAAKRIDMTSHAKDFPQITGPGVDVRGTRRLYAWLDERGGG* |
| Ga0105248_113332092 | 3300009177 | Switchgrass Rhizosphere | VADLRAQGATAEDAARRVDLTSHAKDFPQITGPGADLRGVRRIYAWMDERAAKK* |
| Ga0105238_117997592 | 3300009551 | Corn Rhizosphere | RAQGVSADDAAKRVDLRSHAKDFPDIEDVGAEVRGVRRIYAWMDERGPKNK* |
| Ga0126380_111570011 | 3300010043 | Tropical Forest Soil | TDLINQVTKLKNEGVSPDESAKRVDLTAHAKDFPQITGLGAEIRGVRRMYAWLDEQGAAR |
| Ga0099796_100137703 | 3300010159 | Vadose Zone Soil | QVTKLKNEGVSPEDAAKRVDLTAHAKEFAQITGPGAEIRGVRRMYVWLDEQRAAR* |
| Ga0074045_106132232 | 3300010341 | Bog Forest Soil | ITQVTKLKSEGVSPNDAAKRVDLTAHAKEFPQITAPDADIRGVRRMYAWLDEQRAAR* |
| Ga0126370_110834121 | 3300010358 | Tropical Forest Soil | KLKNDGVSPDDAAKRVDLTAHAKEFPQITGPGAEIRGVRRMYAWLDEQRAAR* |
| Ga0126372_114446721 | 3300010360 | Tropical Forest Soil | KNEGVSPDDAAKRVDLTAHAKDFPQITGPGAEIRGVRRMYAWLDEQRAAR* |
| Ga0105239_125418442 | 3300010375 | Corn Rhizosphere | LRAQGATAEQAAARVDLTSHQKDFPQITGPGADLRGVRRIYAWMDERAKK* |
| Ga0134121_102676321 | 3300010401 | Terrestrial Soil | QGVSADDAAKRVDLTKHAKAFPDILGPGAEVRGVRRIYAWLDEQKRK* |
| Ga0137391_113409061 | 3300011270 | Vadose Zone Soil | KLKNEGVSPDDAAKRVDLTAHAKDFPQITGPGAEIRGVRRMYAWLDEQRAAR* |
| Ga0137388_115341162 | 3300012189 | Vadose Zone Soil | LRKQGLSPEDAAKRVDLTSHQKDFSQIQGPGAEIRGIRRV* |
| Ga0137360_102556811 | 3300012361 | Vadose Zone Soil | INQVTKLKNEGVSPEDAAKRVDLTAHAKEFAQITGPGAEIRGVRRMYVWLDEQRAAR* |
| Ga0137361_113518422 | 3300012362 | Vadose Zone Soil | VSADDAAKRVNLTSHAKDFPQITGPGAEVRGVRRIYAWMDERGKR* |
| Ga0157290_101206182 | 3300012909 | Soil | RAAGVPADEAARRVDLRAHAKSFPDIEEVGAEPRGIRRLYAWMDETGRK* |
| Ga0137359_110520752 | 3300012923 | Vadose Zone Soil | AKLRAQGVSADDAAKRVDLTAHAKDFPDIEGVGAEVRGIRRIYVWMDERGKK* |
| Ga0126369_100405866 | 3300012971 | Tropical Forest Soil | LTDLINQVTKLKNEGVSPDEAAKRVDLTAHAKDFPQITGHGAEIRGVRRMYAWLDEQGAAR* |
| Ga0126369_105793183 | 3300012971 | Tropical Forest Soil | VSPDDAAKRVDLTAHAKEFPQITGPGAEIRGVRRMYAWLDEQRAAR* |
| Ga0157369_117069442 | 3300013105 | Corn Rhizosphere | QLATLRQQGVSADDAAKRLDLTAHKKDFPEIALGAEPRGVRRIYEWMQEREKH* |
| Ga0157374_128995601 | 3300013296 | Miscanthus Rhizosphere | ADEAAKRVDLRSHAKDFPDIEDVGAEVRGIRRVYAWMDERGKK* |
| Ga0157378_122327611 | 3300013297 | Miscanthus Rhizosphere | KLRAQGVSADDAAKRVDLRSPAKDFPDIEDVGAEVRGIRRVYAWMDERGKK* |
| Ga0157378_122399521 | 3300013297 | Miscanthus Rhizosphere | VSPEDAARRVDLTSHAKDFPQIIGPGADIRGVRRVYAWMDETGKK* |
| Ga0163162_115407492 | 3300013306 | Switchgrass Rhizosphere | KRSGVTPEDAAKRIDMTSHAKDFPQITGPGVDVRGTRRLYAWLDERGGG* |
| Ga0181518_103181022 | 3300014156 | Bog | ITAFQSYLKDLTAQVANLRKQGVTPDEAAKRVDLTSHKKDFPDIQGAGADLRGVRRLYQWMDETQKK* |
| Ga0181532_104752252 | 3300014164 | Bog | GVSPDDAAKRVDLTAHAKDFAQITGPGADIRGVRRMYTWLDEQRATR* |
| Ga0075316_11978432 | 3300014314 | Natural And Restored Wetlands | LKRAGMSPEDAAKAIDLTSHAKDFPQITGPGADLRGMRRLYAWLTERGGG* |
| Ga0163163_102125411 | 3300014325 | Switchgrass Rhizosphere | IITAFQSYLTDITAQIATLRQQGVSADDAAKRLDLTAHKKDFPEIARGAEPRGVRRLYQWMDEREKR* |
| Ga0163163_122608891 | 3300014325 | Switchgrass Rhizosphere | KKVGDLRAQGATAEQAAVRVDLTSHQKDFPQITGPGADLRGVRRIYAWMDERTARK* |
| Ga0157379_113477511 | 3300014968 | Switchgrass Rhizosphere | TTLRREGVSPEDAAKRVDLTSHRKDFPDIQGPGADLRGVRRIYQWLDEKQKK* |
| Ga0157376_113022632 | 3300014969 | Miscanthus Rhizosphere | AQAAKLKAQGVSTDDAAKRVDLTSHAKDFPDIEGVGAEVRGVRRIYAWMDEKGRK* |
| Ga0182035_103107411 | 3300016341 | Soil | VTKLKGDGVSPEDAAMRVDLTAHAKDFPQITGPGADIRGVRRMYAWLEEQRAAK |
| Ga0187818_103671051 | 3300017823 | Freshwater Sediment | QVTKFKNEGVSADDAAKRVDLTEHAKDFPQITGPGADIRGVRRMYAWLDEQRAAR |
| Ga0187825_101700381 | 3300017930 | Freshwater Sediment | KLKEQGVPAEEAARRVDLTAHAKYFPQIQGPGADLRGVKRVYAWLEERDRK |
| Ga0187822_100713701 | 3300017994 | Freshwater Sediment | GVPAEEAARRVDLTAHAKYFPQIQGPGADLRGVKLVYAWLEARDRK |
| Ga0187891_11971522 | 3300017996 | Peatland | QGMTPEEAAKRVDLTSHKKDFPDIQTAGADLRGVRRIYQWMDETHKN |
| Ga0066667_113202911 | 3300018433 | Grasslands Soil | LTDFTRQASDLKRQGLTPEETAQRVDLTSHAKDFPSIQRPGADLRGVRRLYVWVDERAKR |
| Ga0173479_108910672 | 3300019362 | Soil | MAQVAKLRAQGVSADDAAKRVDLRSHAKDFPDIEGVGAEVRGIRRLYAWMDETGRK |
| Ga0210408_107748991 | 3300021178 | Soil | LRKQGLSPEDAAQRVDLTSHAKDFPQITGPGAEVRGVRRIYEWMTQRGQ |
| Ga0210402_114288541 | 3300021478 | Soil | INQVTKLKNEGVSPDDAAKRVDLTAHAKDFAQITGPGAEIRGVRRMYAWLDEQRAAR |
| Ga0207688_109299511 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | LSDVMSQVAKLRAQGVSPEDAAKRVDLRSHAKDFPDIEDVGAEPRGIRRVYAWMDEQKKK |
| Ga0207695_102730383 | 3300025913 | Corn Rhizosphere | VTKKVGDLRAQGATPEQAAQRVDLTSHQKEFPQITGPGADLRGVRRIYSWMDERARK |
| Ga0207695_111761322 | 3300025913 | Corn Rhizosphere | ATLRQQGVSADDAAKRVDLTAHKKDFPDIALGAEPRGVRRIYQWMDERAKQ |
| Ga0207694_105779661 | 3300025924 | Corn Rhizosphere | GQGATAEQAALRVDLTSHQKDFPQIAGPGADLRGVRRIYAWMDERAPNKITK |
| Ga0207704_117398431 | 3300025938 | Miscanthus Rhizosphere | LRAQGVSADDAAKRVDLTAHAKDFPDILGPGAEFRGVRRIYAWMDEQKRK |
| Ga0207679_108468911 | 3300025945 | Corn Rhizosphere | GLTDITAQVAALRQQGVSADDAAKRVDLTAHKKDFPDIALGAEPRGVRRIYQWMDERAKQ |
| Ga0207679_115471861 | 3300025945 | Corn Rhizosphere | SADEAAKRVDLTAHAKDFPDVEGVGAEVRGIRRVYAWMDENERNRKTK |
| Ga0207658_113423731 | 3300025986 | Switchgrass Rhizosphere | KKVGDLRAQGATPEQAAQRVDLTSHQKEFPQITGPGADLRGVRRIYSWMDERARK |
| Ga0207676_114550882 | 3300026095 | Switchgrass Rhizosphere | GVSADDAAKRIDLTSHQKDFPAIRQPGADIRGVRRLYAWLDEPSR |
| Ga0207674_123054851 | 3300026116 | Corn Rhizosphere | AQGVSADDAAKRVDLRSHAKDFPDIEDVGAEVRGVRRIYAWMDERGPKNK |
| Ga0207683_118526121 | 3300026121 | Miscanthus Rhizosphere | LAQVAKLRAQGVSADDAAKRVDLRSHAKDFPDIEDVGAEVRGIRRVYAWMDERGKK |
| Ga0208992_10203791 | 3300027176 | Forest Soil | AEEEKLEQARNELKRGGMSADEIAQKIDLTSHAKAFPQITGPGMDVRGARRLYAWLTERGGG |
| Ga0209076_12317711 | 3300027643 | Vadose Zone Soil | EGISPDDAAKRVDLTAHAKDFPQITGPGAEIRGVRRMYAWLDEQRASR |
| Ga0209581_10400766 | 3300027706 | Surface Soil | KFKNEGVSPEDAAKRVDLTAHAKDFPQITGPGADIRGVRRMYAWLDEQQAAK |
| Ga0209580_104108901 | 3300027842 | Surface Soil | KVADLRAQGVTADEAARRVDLTSHQKDFPQITGPGADIRGVRRIYAWMDERGAKK |
| Ga0209580_105699572 | 3300027842 | Surface Soil | KQVAALRKQGVSADDAAQRVNLTSHAKDFPQITGPGAEVRGVRRIYTWMDERGKK |
| Ga0311327_109315041 | 3300029883 | Bog | DLINQVTKLKNDGVSPDDAAKRVDLTAHAKDFPQITGPGADIRGVRRMYAWLDEQRAAK |
| Ga0170823_105186402 | 3300031128 | Forest Soil | AALRKQGVSADDAAKRVNLTSHAKDFPQITGPGAEVRGVRRIYAWMDERGKKSN |
| Ga0302323_1002334221 | 3300031232 | Fen | KQGMTADDAAKKIDMTSHVKDFAQLKEPGAEPRGVRRLYAWLDETGRK |
| Ga0302320_100212721 | 3300031524 | Bog | LKKQGVSADDAAKKIDMTVHAKDFPQIMGPGAEARGMRRLYAWLDETGKK |
| Ga0307478_115387623 | 3300031823 | Hardwood Forest Soil | QVAALRKKGLNADQAAPKVDLTSHASAFPQITGPGADIRGVRRVYEWMDETKK |
| Ga0302322_1031881481 | 3300031902 | Fen | GDLIAQVTKLKNDGVSPDDAAKRVDLTKHAKDFPQIAGPGADIRGVRRMYAWLDEQKAVK |
| Ga0310916_101682453 | 3300031942 | Soil | LKGDGVSPEDAAKRVDLTAHAKDFPQITGPGADIRGVRRMYAWLEEQRAAK |
| Ga0310909_107207473 | 3300031947 | Soil | KLKNDGVSPDDAAKRVDLTKHAKDFPQITGPGADIRGVRRVYAWLDEQRAAK |
| Ga0307479_104428801 | 3300031962 | Hardwood Forest Soil | LKAQGISADEAAKRVDLTSHAKAFPDILGPGAETRGVRRVYAWMDEKRRK |
| Ga0306922_107105721 | 3300032001 | Soil | QGISADEAAKRVDLTSHAKAFPDILGPGAEVRGVRRVYAWMDERGGK |
| Ga0306922_117294251 | 3300032001 | Soil | EKLKAQGVPADEAAKRVDLMKYAKDFPQITGPGADLRGVRRIYAWLDERGRK |
| Ga0306924_115427781 | 3300032076 | Soil | LTDLVNQVTKLKNDGVSPDDAAKRVDLTKHAKDFPQITGPGADIRGVRRMYAWLDEQRAA |
| ⦗Top⦘ |