NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089198

Metagenome / Metatranscriptome Family F089198

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089198
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 42 residues
Representative Sequence WVYSTADRRAYMNQLGACRVEELGVKQHAYAAQTDFGY
Number of Associated Samples 108
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.74 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.330 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(9.174 % of family members)
Environment Ontology (ENVO) Unclassified
(28.440 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.706 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.45%    β-sheet: 0.00%    Coil/Unstructured: 54.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF00581Rhodanese 39.45
PF01799Fer2_2 27.52
PF00111Fer2 7.34
PF00925GTP_cyclohydro2 6.42
PF02738MoCoBD_1 5.50
PF01315Ald_Xan_dh_C 4.59
PF03544TonB_C 1.83
PF07883Cupin_2 0.92
PF03979Sigma70_r1_1 0.92
PF13085Fer2_3 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0807GTP cyclohydrolase IICoenzyme transport and metabolism [H] 6.42
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 1.83
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.33 %
UnclassifiedrootN/A3.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002568|C688J35102_118011839All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300004081|Ga0063454_101998013All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300004091|Ga0062387_100162748All Organisms → cellular organisms → Bacteria1301Open in IMG/M
3300004156|Ga0062589_102205475All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300005175|Ga0066673_10754670All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300005179|Ga0066684_11034562All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300005187|Ga0066675_11273139All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005290|Ga0065712_10440710All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005334|Ga0068869_101982076All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005338|Ga0068868_100444598All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1126Open in IMG/M
3300005468|Ga0070707_101462554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300005533|Ga0070734_10660736All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300005534|Ga0070735_10365698All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300005539|Ga0068853_100249063All Organisms → cellular organisms → Bacteria1630Open in IMG/M
3300005554|Ga0066661_10931560All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300005555|Ga0066692_10148697All Organisms → cellular organisms → Bacteria1437Open in IMG/M
3300005561|Ga0066699_10375382All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300005563|Ga0068855_100418240All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300005564|Ga0070664_100076616All Organisms → cellular organisms → Bacteria2874Open in IMG/M
3300005575|Ga0066702_10537300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300005577|Ga0068857_101419733All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300005587|Ga0066654_10237977All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300005614|Ga0068856_100182897Not Available2109Open in IMG/M
3300005614|Ga0068856_101854267All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300005616|Ga0068852_100821714All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300005888|Ga0075289_1087335All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300005896|Ga0075282_1051726All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300006028|Ga0070717_10344734All Organisms → cellular organisms → Bacteria1331Open in IMG/M
3300006052|Ga0075029_100574517All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300006176|Ga0070765_100420770All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1249Open in IMG/M
3300006755|Ga0079222_11710943All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia603Open in IMG/M
3300006804|Ga0079221_10215754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1063Open in IMG/M
3300006954|Ga0079219_10463354All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300009012|Ga0066710_103188402All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300009093|Ga0105240_12333146All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300009098|Ga0105245_10552740Not Available1173Open in IMG/M
3300009137|Ga0066709_102408193All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300009174|Ga0105241_11606757All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300009683|Ga0116224_10327065All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium729Open in IMG/M
3300009700|Ga0116217_10089784All Organisms → cellular organisms → Bacteria2119Open in IMG/M
3300010048|Ga0126373_11462563All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300010366|Ga0126379_10423255All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300010396|Ga0134126_12664630All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300012189|Ga0137388_10120424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2284Open in IMG/M
3300012205|Ga0137362_10709410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae864Open in IMG/M
3300012208|Ga0137376_10858428All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium780Open in IMG/M
3300012285|Ga0137370_10417293All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300012931|Ga0153915_12866613All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300012944|Ga0137410_11731203All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300012957|Ga0164303_10982708All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300012958|Ga0164299_11393518All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300012984|Ga0164309_11483371All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300012985|Ga0164308_11385778All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300013105|Ga0157369_10100095All Organisms → cellular organisms → Bacteria3090Open in IMG/M
3300013307|Ga0157372_13409428All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300014154|Ga0134075_10287544All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300014165|Ga0181523_10743441All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300014325|Ga0163163_10448607All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300016270|Ga0182036_11091534All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium660Open in IMG/M
3300017930|Ga0187825_10369755All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300017936|Ga0187821_10086814All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300018038|Ga0187855_10136395All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300018090|Ga0187770_11270303All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300018433|Ga0066667_10853679All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300018468|Ga0066662_10670599All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300020012|Ga0193732_1069360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300020022|Ga0193733_1101200All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300020581|Ga0210399_11552945All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300020583|Ga0210401_10469618All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300021403|Ga0210397_10089192All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2061Open in IMG/M
3300021407|Ga0210383_10644143All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium912Open in IMG/M
3300021479|Ga0210410_11729156All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300025898|Ga0207692_11083292All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300025905|Ga0207685_10691497All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300025916|Ga0207663_11728823All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300025920|Ga0207649_11002124All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300025924|Ga0207694_11795974All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300025929|Ga0207664_10070652All Organisms → cellular organisms → Bacteria2810Open in IMG/M
3300025998|Ga0208651_1019984All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300026022|Ga0208649_1003226All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1189Open in IMG/M
3300026142|Ga0207698_11326134All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300026298|Ga0209236_1239779All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300026309|Ga0209055_1055989All Organisms → cellular organisms → Bacteria1684Open in IMG/M
3300026310|Ga0209239_1270626All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300026542|Ga0209805_1291766All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300026548|Ga0209161_10188137All Organisms → cellular organisms → Bacteria → Acidobacteria1157Open in IMG/M
3300027667|Ga0209009_1064550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae919Open in IMG/M
3300027812|Ga0209656_10377759All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300027882|Ga0209590_10978590All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300027910|Ga0209583_10098384All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300027986|Ga0209168_10255246All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium867Open in IMG/M
3300028828|Ga0307312_10318881All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300028884|Ga0307308_10427222All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300029636|Ga0222749_10237086All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae924Open in IMG/M
3300030707|Ga0310038_10059440All Organisms → cellular organisms → Bacteria2119Open in IMG/M
3300030838|Ga0311335_10044717All Organisms → cellular organisms → Bacteria2750Open in IMG/M
3300031057|Ga0170834_101498840Not Available702Open in IMG/M
3300031231|Ga0170824_117054212Not Available696Open in IMG/M
3300031820|Ga0307473_10303678All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300031939|Ga0308174_10184678All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300031941|Ga0310912_10844568All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300031945|Ga0310913_10868395All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300032174|Ga0307470_10318000All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300032180|Ga0307471_103530049All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300032783|Ga0335079_10273835All Organisms → cellular organisms → Bacteria1849Open in IMG/M
3300032829|Ga0335070_11632523All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300032892|Ga0335081_10828254All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300033412|Ga0310810_10677667All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300034820|Ga0373959_0191540All Organisms → cellular organisms → Bacteria536Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.34%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.59%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil3.67%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.75%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.75%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.83%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.83%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.92%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.92%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.92%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300005896Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025998Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes)EnvironmentalOpen in IMG/M
3300026022Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J35102_11801183923300002568SoilAWLQRWVDGIADRKAYMNQLGACRIEDLAVKNHAYAAPTDFGY*
Ga0063454_10199801313300004081SoilRWVYGVADRAAYMNQLGACRVDELSVKQHAYAAQTDFGY*
Ga0062387_10016274813300004091Bog Forest SoilAWLDRWVYSTADRRLYMNQLGACRVEELGVKQHAYAAQADFGY*
Ga0062589_10220547523300004156SoilQRWVHDVADRQAYMDQMGGCRVEDLGVKQHAYAAQTDFGY*
Ga0066673_1075467013300005175SoilERWVYGVRDRAEYVERLGARAEELRVKQHAYAAQADFGY*
Ga0066684_1103456213300005179SoilWLDRWVYGLEDRAAYMNQLGGCRVKDLAVKQHVYAAATDFGY*
Ga0066675_1127313923300005187SoilDSDAWLERWIYSVPDRRAYMNQLGACRVEELAVKQHAYAAQTDYGC*
Ga0065712_1044071013300005290Miscanthus RhizosphereWLNRWVYGVSDRRAYVNQLGGCRVEELGVKQHAYAAATDYGY*
Ga0068869_10198207613300005334Miscanthus RhizosphereNRWVYGVSDRRAYVNQLGGCRVEELGVKQHAYAVATDYGY*
Ga0068868_10044459813300005338Miscanthus RhizosphereQYHENTKTLGDSEAWLQRWVYAVADRAGYMSQLGTCRVADLAVKHHAYAAPTEFGY*
Ga0070707_10146255413300005468Corn, Switchgrass And Miscanthus RhizosphereDRWVYGLEDRAAYMNQLGGCRVEDLAVKQHAYAAQTDFGY*
Ga0070734_1066073613300005533Surface SoilEAWLSRWVYALSDRREYTNQLGACRVGELGVKQHAYAAQADFGY*
Ga0070735_1036569833300005534Surface SoilNTWLRDWVYSLPDRQAYIEQRGTDRIGALGVKQHAYAAQADFGY*
Ga0068853_10024906313300005539Corn RhizosphereRWVNGVADRSEYVKLLGAARVEDLGVKQHAYAAQTDYGY*
Ga0066661_1093156023300005554SoilDSDAWLERWVYSVPDRRAYMNQLGACRVEELDVKQHAYAAQTDYGY*
Ga0066692_1014869713300005555SoilVEDRRAYINQLGACRVEELGVKQHAYAASTDYGY*
Ga0066699_1037538213300005561SoilSDSDAWLERWVYSVPDRRAYMNQLGACRVEELDVKQHAYAAQTDYGY*
Ga0068855_10041824013300005563Corn RhizosphereTKADSEAWLNRWVYGVSDRRAYMNQIGACRLEELGVKQHAYAAATDYGY*
Ga0070664_10007661613300005564Corn RhizosphereKTQADSDAWLQRWVHGVADRQAYVNQLGGCRVEDLGVKQHAYAAQADFGY*
Ga0066702_1053730013300005575SoilWVRGVKDRKEYMNLLGGCRVEELGVKQHAYAAAADFGY*
Ga0068857_10141973313300005577Corn RhizosphereIYGIDDCAAYARQLGSGRVDELSVKQHAYAAETDYGY*
Ga0066654_1023797713300005587SoilSTPDRQAYLDQLGADRVEALGVKEHAYAAQADFGY*
Ga0068856_10018289743300005614Corn RhizosphereLDSDAWLQRWVYAVADRAGYMSQLGTCRVADLAVKHHAYAAPTEFGY*
Ga0068856_10185426733300005614Corn RhizosphereTEAWLQRWVYGTADRSEYVNRLGKCRVEGLGVKQHAYAAATDFGY*
Ga0068852_10082171433300005616Corn RhizosphereETWLKRWVYEVADRKQYLSQLGACRVEELGVKQHAYAAQTDYGY*
Ga0075289_108733523300005888Rice Paddy SoilWVHGLADHRAYMNQLGACRVEALAVERHAYAAPTDFGY*
Ga0075282_105172623300005896Rice Paddy SoilWVHGVADCEHYVELLGGARVEALGVKQHAYAAATDFGY*
Ga0070717_1034473433300006028Corn, Switchgrass And Miscanthus RhizosphereRVADRREYAKQLGSARVEDLGVKKHAYAEKTDYGY*
Ga0075029_10057451733300006052WatershedsAWLQRWVHSVADREAYMNQLGECRVEELSVKQHVFTAQTDFGY*
Ga0070765_10042077013300006176SoilTKTDSEAWLERWVYGLDDRTAYMNQLGDYRVEELAVKQHAYAAPTDFGY*
Ga0079222_1171094323300006755Agricultural SoilRWVYGVEGRGAYMNQLGACRVEDLGVKQHAYAAQTDFGY*
Ga0079221_1021575433300006804Agricultural SoilGVADCEQYVELLGGARVEALGVKQHAYAAATDYGY*
Ga0079219_1046335413300006954Agricultural SoilWLNRWAYGVSDRRAYMNQIGACRAEELGVKQHAYAAATDYGY*
Ga0066710_10318840213300009012Grasslands SoilADSNAWLERWVYSVADRRAYMNQLGACRVEELAVKQHAYAAQTDYGY
Ga0105240_1233314613300009093Corn RhizosphereQGDSEAWLQRWVHSMADRKAYVNQLGGCRVEELSVKQHAYAAQTDFGY*
Ga0105245_1055274013300009098Miscanthus RhizosphereEAWLQRWVYAVADRAGYMSQLGTCRVADLAVKHHAYAAPTEFGY*
Ga0066709_10240819313300009137Grasslands SoilYGVEDRRAYMNQLGACRVEELGVKQHAYAASTDYGY*
Ga0105241_1160675723300009174Corn RhizosphereWVHGFADRQAYMNQLGGCRVEDLGVKQHAYAAQADFGY*
Ga0116224_1032706523300009683Peatlands SoilEAWLNHWIYNTPDRRAYMNQLGACRVEELGVKQHAYAAQADFGY*
Ga0116217_1008978433300009700Peatlands SoilWVYSTADRRTYMNQLGACRVDDLGVKQHAYAAQADFGY*
Ga0126373_1146256313300010048Tropical Forest SoilHGVKDREAYARLLGEDRVAELGVKSHAYAAQTDYGY*
Ga0126379_1042325533300010366Tropical Forest SoilWISGVADREAYARQLGETRVADLGVKQHAYAAATDYGY*
Ga0134126_1266463013300010396Terrestrial SoilKTQADSDAWLQRWVHGVADRQAYMNQLGGCRVEDLGVKQHAYAAQADFGY*
Ga0137388_1012042413300012189Vadose Zone SoilAKADSDAWLQRCVYGVADRPAYMNQLGACRVEELGVKQHAYAAQTDFGY*
Ga0137362_1070941013300012205Vadose Zone SoilVEDRRAYINRLGGCRLEDLGVKRHAYAAQTDFGY*
Ga0137376_1085842823300012208Vadose Zone SoilRWVYGLEDRAAYMNQLGGCRVKDLAVKQHVYAAATDFGY*
Ga0137370_1041729333300012285Vadose Zone SoilQTKTKADSDAWLERWIYSVPDRHAYMNQLGACRVEELSVKQHAYAVQTDYGY*
Ga0153915_1286661323300012931Freshwater WetlandsAQRWVHGVTDRAGYVELLGECRVKELGVKRHAYAAAADYGY*
Ga0137410_1173120313300012944Vadose Zone SoilKADGDAWLQRWIYEVEDRRAYINRLGGCRVEDLGVKRHAYAAQTDFGY*
Ga0164303_1098270833300012957SoilWAYGVSDRRAYMNQIGACRAEELGVKQHAYAAATDYGY*
Ga0164299_1139351823300012958SoilTKTRADNETWLKRWVYEVADRKQYLSQLGACRVEELGVKQHAYAAQTDYGY*
Ga0164309_1148337123300012984SoilVHEIADRNAYINQLGACRVDGLGVKGHAYAAQADFGY*
Ga0164308_1138577813300012985SoilWVHDVADRQAYMNQLGGCRVDDLGVKQHAYAAQTDFGY*
Ga0157369_1010009513300013105Corn RhizosphereTQADSDAWLQRWVHGVADRQAYMNQLGGCRIEDLGVKQHAYAAQADFGY*
Ga0157372_1340942823300013307Corn RhizosphereKWIYGVADREDYTRALGSSRVKELAVKQHAYAAATDYGY*
Ga0134075_1028754423300014154Grasslands SoilWVYGVADRRAYMNQLGACRVDELSVKQHAYAAQTDFGY*
Ga0181523_1074344113300014165BogHWVYSTSDRRAYMNQLGACRVEDLGVKQHAYAAQTDFGY*
Ga0163163_1044860743300014325Switchgrass RhizosphereVSDRRAYVNQLGGCRVEELGVRQHAYAAATDYGY*
Ga0182036_1109153423300016270SoilRWVYSISDRREYINRVGACRLDNLGVKQHAYAAQADFGY
Ga0187825_1036975513300017930Freshwater SedimentKTKADFENWSARWIHGISDRRAYMNQLGACRVEELGVKNHAYAAATDFGY
Ga0187821_1008681443300017936Freshwater SedimentLERWVYSIADRRAYMNQLGACRVDELGVKRHAFAAQTDYGY
Ga0187855_1013639513300018038PeatlandHWVYSTSDRRAYMNQLGACRVEDLGVKQHAYAAQTDFGY
Ga0187770_1127030313300018090Tropical PeatlandRWVYGLADRKAYMNRLGACRVDELGVKQHAYAAQADFGY
Ga0066667_1085367913300018433Grasslands SoilKADSDAWLERWIYSVPDRHAYMNQLGACRVEELSVKQHAYAIQTDYGY
Ga0066662_1067059913300018468Grasslands SoilGVGGVKDRKEYMNLLGGCRVQELGVKQHAYAAAADFGY
Ga0193732_106936023300020012SoilGVKDRKEYMNLLGGCRVEELGVKQHAYAAAADFGY
Ga0193733_110120033300020022SoilVYSVPDRRAYMNQLGACRVEELDVKQHAYAAQTDYGY
Ga0210399_1155294513300020581SoilYDVADRRAYMNQLGACRVDNLGVKQHAYAAQADFGY
Ga0210401_1046961833300020583SoilYKLADRRAYVNQLGTCRVDDLGVKQHAYAAQADFGY
Ga0210397_1008919243300021403SoilDTEAWLKRWTHNVADRRAYMNQLGACRAEELGVKQHAYAVQTDFGY
Ga0210383_1064414313300021407SoilQTKTKADSDAWLYRWVYSTADRRAYMNQLGACRVEELGVKQHAYAAQADFGY
Ga0210410_1172915613300021479SoilSAVDRRAYMNQLGACRVEDLGVKQHAYAAQADFGY
Ga0207692_1108329213300025898Corn, Switchgrass And Miscanthus RhizosphereWLQRWVYAVADRAGYMSQLGTCRVADLAVKHHAYAAPTEFGY
Ga0207685_1069149713300025905Corn, Switchgrass And Miscanthus RhizosphereWLQRWVYGVRDRREYMNQLGACRAEELGVKQHAYAAATDYGY
Ga0207663_1172882313300025916Corn, Switchgrass And Miscanthus RhizosphereAWLQRWVYAVADRAGYMNQLGACRVEDLAVKHHAYAAPTEFGY
Ga0207649_1100212423300025920Corn RhizosphereLQRWVHGVADRQAYMNQLGGCRVEDLGVKQHAYAAQADFGY
Ga0207694_1179597423300025924Corn RhizosphereTTTKADSEAWLNRWVYGVSDRRAYVNQLGGCRVEELGVKQHAYAAATDYGY
Ga0207664_1007065213300025929Agricultural SoilGVADRGEYAKQLGAARVEELGVKQHAYAEKTDFGY
Ga0208651_101998413300025998Rice Paddy SoilWVHGVADCEHYVELLGGARVEALGVKQHAYAAATDFGY
Ga0208649_100322613300026022Rice Paddy SoilRWVYGVEDRAAYVNQLGKCRVEELGVKQHAYAAAADFGY
Ga0207698_1132613433300026142Corn RhizosphereTRADNETWLKRWVYEVADRKQYLSQLGACRVEELGVKQHAYAAQTDYGY
Ga0209236_123977913300026298Grasslands SoilWLDRWVYGLEDRAAYMNQLGGCRVKDLAVKQHVYAAATDFGY
Ga0209055_105598943300026309SoilTKTKADSDAWLERWIYSVPDRRAYMNQLGACRVEELAVKQHAYAAQTDYGY
Ga0209239_127062613300026310Grasslands SoilADSDDWLDRWVYGLEDRTAYMNQLGGCRVEDLAVKQHAYAVATDFGY
Ga0209805_129176623300026542SoilDSDAWLERWVYSVPDRRAYMNQLGACRVEELDVKQHAYAAQTDYGY
Ga0209161_1018813713300026548SoilWVYSVADRRAYMNQLGACRVEELAVKQHAYAAQTDYGY
Ga0209009_106455013300027667Forest SoilDTEAWLKRWIHNVADRRAYMNQLGACRVEELGVKQHAYAAQTDFGY
Ga0209656_1037775923300027812Bog Forest SoilWVYSTADRRAYMNQLGACRVEELGVKQHAYAAQTDFGY
Ga0209590_1097859013300027882Vadose Zone SoilGVEDRRAYMNQLGACRVEELGVKQHAYAASTDYGY
Ga0209583_1009838443300027910WatershedsVYSVADRRAYINQLGGCRVDELGVRRHAYAAQTDFGY
Ga0209168_1025524623300027986Surface SoilSNTWLRDWVYSLPDRQAYIEQRGTDRIGALGVKQHAYAAQADFGY
Ga0307312_1031888133300028828SoilWVYGVADRKQYLNQLGACRVAELGVKRHAYAAQTDYGY
Ga0307308_1042722223300028884SoilTKSDSDAWLERWVYSVPDRRAYMNQLGACRVEELDVKQHAYAAQTDYGY
Ga0222749_1023708613300029636SoilLKRWTHNVADRRAYMNQLGACRAEELGVKQHAYAVQTDFGY
Ga0310038_1005944013300030707Peatlands SoilKTKADSEAWLNHWIYNTPDRRAYMNQLGACRVEELGVKQHAYAAQADFGY
Ga0311335_1004471743300030838FenTNAWLERWVYGIGDRRAYMNQLGACRVEELGVKQHAYAAQADFGY
Ga0170834_10149884013300031057Forest SoilQYHEHTKTKPDSDAWLNRWVYSIADRRAYMNQLGACRVDELGVKQHAYAAQADFGY
Ga0170824_11705421213300031231Forest SoilHEHTKTKPDSDAWLNRWVYSIADRRAYMNQLGACRVDELGVKQHAYAAQADFGY
Ga0307473_1030367813300031820Hardwood Forest SoilWLERWIYSVPDRRAYMNQLGACRVEELAVKQHAYAAQTDYGY
Ga0308174_1018467813300031939SoilKRVHGVGDRDGYSKLLGSTRLQELAVKQHAYAAATDFGY
Ga0310912_1084456823300031941SoilSISDRREYINRVGACRLDNLGVKQHAYAAQADFGY
Ga0310913_1086839513300031945SoilSDAWLERWVYGICDRRDYMNQLGACRVDDLGVKQHAYAEKTDFGY
Ga0307470_1031800033300032174Hardwood Forest SoilQADSDAWLQRWVHDVADRQAYMNQLGGCRVEDLGVKQHAYAAQTDFGY
Ga0307471_10353004913300032180Hardwood Forest SoilRWIYSVPDRRAYMNQLGACRVEELAVKQHAYAAQTDYGY
Ga0335079_1027383533300032783SoilAWLERWVYGMADRRAYMNQLGACRVDELGVKQHAYAAATDYGY
Ga0335070_1163252313300032829SoilWVYEIADRHAYVNQLGACRIDELGVKQHAYAAETDFGY
Ga0335081_1082825433300032892SoilTQADTEAWLGRWVYNVSDRQEYMNQLGACRVEDLGVKQHAYAAQTDFGY
Ga0310810_1067766713300033412SoilGVADRQAYVNQLGGCRVEDLGVKQHAYAAQADFGY
Ga0373959_0191540_379_5343300034820Rhizosphere SoilTKTQADSDAWLQRWVHGFADRQAYMNQLGGCRVEDLGVKQHAYAAQADFGY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.