| Basic Information | |
|---|---|
| Family ID | F089197 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 43 residues |
| Representative Sequence | SPPKLHKLEPGWEIAEWFCVLDENKDYDQVVRKPAGVAPASK |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.92 % |
| % of genes near scaffold ends (potentially truncated) | 99.08 % |
| % of genes from short scaffolds (< 2000 bps) | 90.83 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.890 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.431 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.606 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.541 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.71% β-sheet: 0.00% Coil/Unstructured: 94.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 108 Family Scaffolds |
|---|---|---|
| PF04444 | Dioxygenase_N | 14.81 |
| PF10518 | TAT_signal | 2.78 |
| PF13442 | Cytochrome_CBB3 | 1.85 |
| PF01717 | Meth_synt_2 | 1.85 |
| PF01425 | Amidase | 1.85 |
| PF07883 | Cupin_2 | 0.93 |
| PF04365 | BrnT_toxin | 0.93 |
| PF13620 | CarboxypepD_reg | 0.93 |
| PF00155 | Aminotran_1_2 | 0.93 |
| PF00034 | Cytochrom_C | 0.93 |
| PF09822 | ABC_transp_aux | 0.93 |
| PF00753 | Lactamase_B | 0.93 |
| PF12441 | CopG_antitoxin | 0.93 |
| PF00561 | Abhydrolase_1 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
|---|---|---|---|
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 14.81 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.85 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 1.85 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.89 % |
| Unclassified | root | N/A | 32.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10389542 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300004631|Ga0058899_11935848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300005435|Ga0070714_101787142 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005538|Ga0070731_10519074 | Not Available | 793 | Open in IMG/M |
| 3300005541|Ga0070733_10720726 | Not Available | 670 | Open in IMG/M |
| 3300005921|Ga0070766_10247261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1130 | Open in IMG/M |
| 3300006050|Ga0075028_100005415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4965 | Open in IMG/M |
| 3300006050|Ga0075028_100094309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1517 | Open in IMG/M |
| 3300006052|Ga0075029_100602846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300006059|Ga0075017_100110534 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300006086|Ga0075019_10951356 | Not Available | 553 | Open in IMG/M |
| 3300006102|Ga0075015_100310948 | Not Available | 869 | Open in IMG/M |
| 3300006162|Ga0075030_100252825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1413 | Open in IMG/M |
| 3300006176|Ga0070765_100534353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300006176|Ga0070765_101347922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300006176|Ga0070765_101811729 | Not Available | 572 | Open in IMG/M |
| 3300006354|Ga0075021_10889296 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300006806|Ga0079220_10591169 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300007258|Ga0099793_10357435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300009177|Ga0105248_12538162 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300009177|Ga0105248_12794950 | Not Available | 557 | Open in IMG/M |
| 3300009521|Ga0116222_1178440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300009521|Ga0116222_1235000 | Not Available | 790 | Open in IMG/M |
| 3300010048|Ga0126373_13256091 | Not Available | 505 | Open in IMG/M |
| 3300010361|Ga0126378_12044766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300010379|Ga0136449_100041408 | All Organisms → cellular organisms → Bacteria | 10682 | Open in IMG/M |
| 3300010379|Ga0136449_100099170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5995 | Open in IMG/M |
| 3300010379|Ga0136449_100428954 | All Organisms → cellular organisms → Bacteria | 2331 | Open in IMG/M |
| 3300010379|Ga0136449_100955238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
| 3300010379|Ga0136449_101732546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300010397|Ga0134124_11546971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300011120|Ga0150983_15506622 | Not Available | 668 | Open in IMG/M |
| 3300011270|Ga0137391_10177813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1854 | Open in IMG/M |
| 3300011271|Ga0137393_11250031 | Not Available | 630 | Open in IMG/M |
| 3300012199|Ga0137383_10809149 | Not Available | 684 | Open in IMG/M |
| 3300012205|Ga0137362_10186324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1784 | Open in IMG/M |
| 3300012211|Ga0137377_11270648 | Not Available | 666 | Open in IMG/M |
| 3300012361|Ga0137360_11445551 | Not Available | 591 | Open in IMG/M |
| 3300012362|Ga0137361_10647588 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300012363|Ga0137390_10403081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1346 | Open in IMG/M |
| 3300012363|Ga0137390_10973094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300012582|Ga0137358_11007173 | Not Available | 538 | Open in IMG/M |
| 3300012927|Ga0137416_10659311 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300012944|Ga0137410_10814620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300012944|Ga0137410_11634771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300012971|Ga0126369_12343049 | Not Available | 620 | Open in IMG/M |
| 3300015052|Ga0137411_1018947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1711 | Open in IMG/M |
| 3300015242|Ga0137412_10016127 | All Organisms → cellular organisms → Bacteria | 6052 | Open in IMG/M |
| 3300015245|Ga0137409_10351072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1286 | Open in IMG/M |
| 3300017823|Ga0187818_10148340 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300017823|Ga0187818_10220780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300017823|Ga0187818_10538674 | Not Available | 526 | Open in IMG/M |
| 3300017926|Ga0187807_1033364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1595 | Open in IMG/M |
| 3300017926|Ga0187807_1284993 | Not Available | 546 | Open in IMG/M |
| 3300017927|Ga0187824_10152574 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300017927|Ga0187824_10197112 | Not Available | 683 | Open in IMG/M |
| 3300017927|Ga0187824_10206624 | Not Available | 669 | Open in IMG/M |
| 3300017928|Ga0187806_1371642 | Not Available | 513 | Open in IMG/M |
| 3300017942|Ga0187808_10022132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2579 | Open in IMG/M |
| 3300017942|Ga0187808_10124502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
| 3300017943|Ga0187819_10245194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
| 3300017955|Ga0187817_10518363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300017993|Ga0187823_10220121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300017995|Ga0187816_10099123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1250 | Open in IMG/M |
| 3300018006|Ga0187804_10396403 | Not Available | 611 | Open in IMG/M |
| 3300018006|Ga0187804_10413064 | Not Available | 599 | Open in IMG/M |
| 3300018007|Ga0187805_10643905 | Not Available | 502 | Open in IMG/M |
| 3300020579|Ga0210407_10406358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300020579|Ga0210407_10471838 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300020579|Ga0210407_11069640 | Not Available | 613 | Open in IMG/M |
| 3300020580|Ga0210403_10711277 | Not Available | 804 | Open in IMG/M |
| 3300021170|Ga0210400_10959992 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300021180|Ga0210396_10261181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1538 | Open in IMG/M |
| 3300021402|Ga0210385_11417593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300021406|Ga0210386_10885145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300021420|Ga0210394_10309403 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300021478|Ga0210402_10369240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1332 | Open in IMG/M |
| 3300021478|Ga0210402_11227220 | Not Available | 677 | Open in IMG/M |
| 3300021478|Ga0210402_11239967 | Not Available | 673 | Open in IMG/M |
| 3300021479|Ga0210410_10141677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2140 | Open in IMG/M |
| 3300021560|Ga0126371_10404730 | Not Available | 1507 | Open in IMG/M |
| 3300025634|Ga0208589_1126060 | Not Available | 593 | Open in IMG/M |
| 3300025927|Ga0207687_10121411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1955 | Open in IMG/M |
| 3300026355|Ga0257149_1016656 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300026376|Ga0257167_1014491 | Not Available | 1086 | Open in IMG/M |
| 3300026557|Ga0179587_10765285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 636 | Open in IMG/M |
| 3300027326|Ga0209731_1048838 | Not Available | 638 | Open in IMG/M |
| 3300027662|Ga0208565_1042083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1499 | Open in IMG/M |
| 3300027663|Ga0208990_1022224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2059 | Open in IMG/M |
| 3300027681|Ga0208991_1037585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1464 | Open in IMG/M |
| 3300027826|Ga0209060_10528632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 535 | Open in IMG/M |
| 3300027842|Ga0209580_10478348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300027869|Ga0209579_10354016 | Not Available | 794 | Open in IMG/M |
| 3300027889|Ga0209380_10459966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300027894|Ga0209068_10128508 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300027895|Ga0209624_10433445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300027903|Ga0209488_10138277 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300027905|Ga0209415_10456398 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300027905|Ga0209415_10516731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300027905|Ga0209415_10585098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300031128|Ga0170823_16294023 | Not Available | 773 | Open in IMG/M |
| 3300031708|Ga0310686_108376485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300031753|Ga0307477_10681455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 689 | Open in IMG/M |
| 3300031753|Ga0307477_10899061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 584 | Open in IMG/M |
| 3300031754|Ga0307475_11412859 | Not Available | 536 | Open in IMG/M |
| 3300031962|Ga0307479_12128280 | Not Available | 508 | Open in IMG/M |
| 3300032160|Ga0311301_10072853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7205 | Open in IMG/M |
| 3300032160|Ga0311301_10072853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7205 | Open in IMG/M |
| 3300032160|Ga0311301_12173168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 16.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 12.84% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 8.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.92% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_103895422 | 3300001661 | Forest Soil | LEPTWEIAEWFCVIDEDEAYDEVVRKPAGVAPSPK* |
| Ga0058899_119358482 | 3300004631 | Forest Soil | PKLHKLEPSWEFGEWFCVVDETKTYDDVVRKPAGDAPPSHK* |
| Ga0070714_1017871421 | 3300005435 | Agricultural Soil | KPWVSPPKLHKLEPGWEIAEWFCVLDENKDYDNVVRKPAGVAPASK* |
| Ga0070731_105190742 | 3300005538 | Surface Soil | EPGWELAEWFCVLDENHDYDQVVRKPAGVAPEQGK* |
| Ga0070733_107207261 | 3300005541 | Surface Soil | KLHKLEPGWEIAEWFCVLDEDKTYDDAVRKPAGIAPAK* |
| Ga0070766_102472612 | 3300005921 | Soil | SPPKLHKLEPTWEFGEWFCIVDESEDYDKSVRKPAGNTSPSQK* |
| Ga0075028_1000054156 | 3300006050 | Watersheds | KLHKLEPGWEIAEWFCVLDEHEAYDDAVRKPAGVAPATAK* |
| Ga0075028_1000943093 | 3300006050 | Watersheds | LEPTWEIAEWFCVIEEENAYSDVIRKPAGGISTDPK* |
| Ga0075029_1006028461 | 3300006052 | Watersheds | VWVSPPKLHKLEPKWEIAEWFCASSEIQTYDKDVRKPSGGATTEPK* |
| Ga0075017_1001105341 | 3300006059 | Watersheds | YTKVWVSPPKLHKLEPKWEIAEWFCASSELQTYDKDVRKPSGGVSTAPNQ* |
| Ga0075019_109513561 | 3300006086 | Watersheds | SPPKLHKLEPGWEIAEWFCVLDENKDYDQVVRKPAGVAPASK* |
| Ga0075015_1003109481 | 3300006102 | Watersheds | PPQKFKLEPNWEIAEFFCIVDEENNYGDAVRKPAGVAPK* |
| Ga0075030_1002528251 | 3300006162 | Watersheds | AKWVSPPKLHKLEPKWEIGEWFCAASENLVYDKDVRKPSGGITEPAK* |
| Ga0070765_1005343532 | 3300006176 | Soil | EPGWEIAEWFCVLDEDKAYDNAVRKPAGVAPAPK* |
| Ga0070765_1013479222 | 3300006176 | Soil | HKLEPSWEFGEWFCVVDETKTYDDVVRKPAGGAPPTPK* |
| Ga0070765_1018117292 | 3300006176 | Soil | YTKEWVSPPKRHKLEPTWEIAEWFCASSELQTYDKDVRKPSGGAPSVPGK* |
| Ga0075021_108892961 | 3300006354 | Watersheds | KLEPGWEIAEWFCVLDENKGYDQTVRKPAGVAPSSK* |
| Ga0079220_105911691 | 3300006806 | Agricultural Soil | PPKLHKLEPTWEIAEWFCATSEEQTYDEQVRKPSGAAPQPK* |
| Ga0099793_103574352 | 3300007258 | Vadose Zone Soil | KTWVNPPKLHKLEPMWEIAEWFCVIDDENAYGDAVRKPAGVSPTPK* |
| Ga0105248_125381621 | 3300009177 | Switchgrass Rhizosphere | PWVSPPKMHKLEPGWELAEWFCVLDENKDYDQVVRKPAGVAPNSK* |
| Ga0105248_127949501 | 3300009177 | Switchgrass Rhizosphere | KLHKLEPGWQIAEWFCVPDEDNAYDEVVRKPAGVAPGHK* |
| Ga0116222_11784402 | 3300009521 | Peatlands Soil | RHKLEPGWEIAEWFCAVEEDKAYDEVVRKPAGVAPKK* |
| Ga0116222_12350001 | 3300009521 | Peatlands Soil | KLHKLEPGWEIAEWFCVLDENKDYDQVVRKPAGVAPASK* |
| Ga0126373_132560911 | 3300010048 | Tropical Forest Soil | TKPWVSPPKLHKLEPGWEIAEWFCVVDEDNAYDNAVRKPAGVAPAHK* |
| Ga0126378_120447661 | 3300010361 | Tropical Forest Soil | YKLEPGWEIAEWFCIPDEDKSYDDSVRKPAGVAPAPK* |
| Ga0136449_1000414081 | 3300010379 | Peatlands Soil | LHKLEPGWELSEWFCVQDEHNAYDESVRKPAGVAPTRK* |
| Ga0136449_1000991707 | 3300010379 | Peatlands Soil | KLEPGWEIAEWFCVLDENKDYDQVVRKPAGVAPASK* |
| Ga0136449_1004289543 | 3300010379 | Peatlands Soil | RFKLEPSWEIAEFFCVVDEENSYGDAVRKPAGVVPAPK* |
| Ga0136449_1009552383 | 3300010379 | Peatlands Soil | AYTKPWVSPPKLHKLEPGWEIAEWFCVLDEDKAYDDAVRKPAGVAPSK* |
| Ga0136449_1017325461 | 3300010379 | Peatlands Soil | SPPKLHKLEQGWEIAEWFCVLDEDKAYDDVVRKPAGVAPAPNK* |
| Ga0134124_115469711 | 3300010397 | Terrestrial Soil | KPWVSPPKLHKLEPGWELAEWFCILDENKDYDQVVRKPAGVAPNSK* |
| Ga0150983_155066221 | 3300011120 | Forest Soil | KLHKLEPNWEIAEWFCVIEEENAYSDTIRKPAGGISTAPK* |
| Ga0137391_101778132 | 3300011270 | Vadose Zone Soil | MKIEEVKETKEKTWACPPKLHKVEPGWEIAEWFCFLDENRDYDQVVRKPAGVAPESK* |
| Ga0137393_112500311 | 3300011271 | Vadose Zone Soil | EPTWEIAQWFCVIEEENTYSDTIRKPAGGFSTTPK* |
| Ga0137383_108091491 | 3300012199 | Vadose Zone Soil | KLHKLEPTWELAEWFCVPDEHNAYDDVVRKPAGVSPSPK* |
| Ga0137362_101863241 | 3300012205 | Vadose Zone Soil | PKLHKLEPTWEIAEWFCVIDEDKAYDEVVRKPAGVAPSPR* |
| Ga0137377_112706482 | 3300012211 | Vadose Zone Soil | TWVNPPKLHKLEPMWEIAEWFCVIDDENAYGDAVRKPAGVSPTPK* |
| Ga0137360_114455511 | 3300012361 | Vadose Zone Soil | TKPWVSPPKLHKLEPTWELAEWFCVQGEHNAYDEVVRKPAGVSPTPK* |
| Ga0137361_106475882 | 3300012362 | Vadose Zone Soil | SYTKVWVSPPKLHKLEPTWEIAEWFCATSEEQAYDEQVRKPSGVAPPSK* |
| Ga0137390_104030812 | 3300012363 | Vadose Zone Soil | WVSPPKLHKLEPKWEIAEWFCAASELQTYDKDVRKPSGGGTIAPKQ* |
| Ga0137390_109730941 | 3300012363 | Vadose Zone Soil | PKLHKLEPGWELAEWFCVQDEHNAYDESVRKPAGASPAKK* |
| Ga0137358_110071731 | 3300012582 | Vadose Zone Soil | KTWVNPPKLHKLEPMWEIAEWFCVIDDENAYGDAVRKPAGVSATPK* |
| Ga0137416_106593111 | 3300012927 | Vadose Zone Soil | KVWVSPPKLHKLEPTWEIAEWFCAISEEQAYDEQVRKPSGVAASPGK* |
| Ga0137410_108146202 | 3300012944 | Vadose Zone Soil | SYTKVWVSPPKLHKLEPAWEIAEWFCVLDEDKAYDEVVRKPAGVSPSPK* |
| Ga0137410_116347712 | 3300012944 | Vadose Zone Soil | PKLHKLEPMWEIAEWFCVIDDENAYGDAVRKPAGVSPTPK* |
| Ga0126369_123430491 | 3300012971 | Tropical Forest Soil | KPWVNPPKLHKLEPGWEIAEWFCVIDEENAYSEAVRKPAGGAPK* |
| Ga0137411_10189471 | 3300015052 | Vadose Zone Soil | KLEPAWEIAEWFCVMEEENAYSDAIRKPAGGISTVPK* |
| Ga0137412_100161275 | 3300015242 | Vadose Zone Soil | PKLHKLDTMWEIAEWFCVIDHENAYGDAVRKPAGISPTPK* |
| Ga0137409_103510721 | 3300015245 | Vadose Zone Soil | PKSYTKVWVSPPKLHKLEPAWEIAEWFCVLDEDKAYDEVVRKPAGVSPSPK* |
| Ga0187818_101483401 | 3300017823 | Freshwater Sediment | PWVSPPKLHKLEPGWEIAEWFCVLDENKDYDQVVRKPAGVAPASK |
| Ga0187818_102207801 | 3300017823 | Freshwater Sediment | TKTWVSPPKLHKLEPTWEIAEWFCVLDEDKAYDDVVRKPAGVAPTLNK |
| Ga0187818_105386742 | 3300017823 | Freshwater Sediment | KAYTKTWVSPPKLHKLEPTWEIAEWFCVLDEDKAYDDVVRKPAGGAPASNK |
| Ga0187807_10333643 | 3300017926 | Freshwater Sediment | VNPPKLHKLEPTWEIAEWFCVIEEENAYGDAIRKPAGGISTAPK |
| Ga0187807_12849931 | 3300017926 | Freshwater Sediment | SPPKLHKLEPTWEIAEWFCVLDEDKAYDDVVRKPAGGAPASNK |
| Ga0187824_101525741 | 3300017927 | Freshwater Sediment | PPRLHKLEPTWEIAEWFCVIEEENAYSDVVRKPAGGISTAPK |
| Ga0187824_101971121 | 3300017927 | Freshwater Sediment | KLHKLEPGWEIAEWFCVLDENKDYDQVVRKPAGVAPASK |
| Ga0187824_102066241 | 3300017927 | Freshwater Sediment | PKLHKLEPGWEIAEWFCVLDEDKAYDDAVRKPAGVAPTSKK |
| Ga0187806_13716421 | 3300017928 | Freshwater Sediment | TKPWVSPPKLHKLEPGWEIAEWFCVLDENKDYDQVVRKPAGVAPASK |
| Ga0187808_100221321 | 3300017942 | Freshwater Sediment | KLEPTWEIAEWFCVLDEDKAYDDVVRKPAGGAPASNK |
| Ga0187808_101245021 | 3300017942 | Freshwater Sediment | LHKLEPGWEIAEWFCVNDEDKSYDETVRKPAGVTPAYNK |
| Ga0187819_102451942 | 3300017943 | Freshwater Sediment | VSPPKLHKLEPTWEIAEWFCVLDEDKAYDDVVRKPAGGAPMPTK |
| Ga0187817_105183632 | 3300017955 | Freshwater Sediment | YTKTWVSPPKLHKLEPTWEIAEWFCVLDEDKAYDDVVRKPAGGAPASNK |
| Ga0187823_102201212 | 3300017993 | Freshwater Sediment | SYTKVWVSPPKLHKLEPGWEIAEWFCVNDEDKSYDETVRKPAGVAPAYNK |
| Ga0187816_100991231 | 3300017995 | Freshwater Sediment | LHKLEPAWEIAEWFCVLDEDKAYDEVVRKPAGLAPAANK |
| Ga0187804_103964032 | 3300018006 | Freshwater Sediment | AYTKTWVSPPKLHKLEPAWEIAEWFCVLDEDKAYDEVVRKPAGLAPAANK |
| Ga0187804_104130642 | 3300018006 | Freshwater Sediment | WVSPPKLHKLEPTWEIAEWFCVLDEDKAYDDVVRKPAGGAPASNK |
| Ga0187805_106439052 | 3300018007 | Freshwater Sediment | PPKLHKLEPTWEIAEWFCVLDEDKAYDDVVRKPAGVAPAPEK |
| Ga0210407_104063582 | 3300020579 | Soil | VSPPKLHKLEPGWELAEWFCVQDEHNAYDQSVRKPAGASPTKK |
| Ga0210407_104718381 | 3300020579 | Soil | RPWVGPPKLHKLEPGWEIAEWFCVLDENKDYDQVVRKPAGVVPASK |
| Ga0210407_110696401 | 3300020579 | Soil | KVWVSPPKLHKLEPKWEIAEWFCASSELQTYDKDVRKPSGGSTDPKK |
| Ga0210403_107112771 | 3300020580 | Soil | PKLHKLEPGWEIAEWFCVLDENKDYDQVVRKPAGVAPAPK |
| Ga0210400_109599922 | 3300021170 | Soil | KLHKLEPGWEIAEWFCVLEEDKAYDEVVRKPAGIAPTTK |
| Ga0210396_102611813 | 3300021180 | Soil | ISPPKLHKLEPGWEIAEWFCVPDEDNAYDDAVRKPAGVAPKSR |
| Ga0210385_114175931 | 3300021402 | Soil | AYTKTWVSPPKLHKLESSWEFGEWFCVVEETKTYDDVVRKPAGDAPPMRK |
| Ga0210386_108851452 | 3300021406 | Soil | TEKWVSPPKLHKLEPKWEIGEWFCAASENQVYDKDVRKPSGGITEPTK |
| Ga0210394_103094031 | 3300021420 | Soil | TWVSPPKLHKLEPGWEIAEWFCVLDEDQAYDDVVRKPAGVAPATKK |
| Ga0210402_103692402 | 3300021478 | Soil | VWTSPPKLYKHEPGWEIAEWFCIADEDKSYDNTVRKPAGVAPASK |
| Ga0210402_112272202 | 3300021478 | Soil | NPPKLHKLEPKWEIAEWFCVIEEENAYSDAIRKPAGGISTAPK |
| Ga0210402_112399672 | 3300021478 | Soil | HKLEPTWELAEWPCVIEETKDYDETVRKPAGDASPARVQ |
| Ga0210410_101416771 | 3300021479 | Soil | SYTKVWVSPPKLHKLEPKWEIAEWFCASSELQTYDKDVRKPSGGNVTEPKK |
| Ga0126371_104047303 | 3300021560 | Tropical Forest Soil | EPGWEIAEWFCVIDEEKAYSEAVRKPAGIAPATKP |
| Ga0208589_11260602 | 3300025634 | Arctic Peat Soil | PPKLHKLEPKWEIGEWFCAASENQVYDKDVRKPSGAVDEPAK |
| Ga0207687_101214114 | 3300025927 | Miscanthus Rhizosphere | LEPGWQIAEWFCVPDEDNAYDEVVRKPAGVAPGHK |
| Ga0257149_10166562 | 3300026355 | Soil | SPPKLHKLEPTWEIAEWFCVIDEDKAYDEVVRKPAGVAPSPR |
| Ga0257167_10144911 | 3300026376 | Soil | KLHKLEPTWEIAEWFCVIDEDKAYDEVVRKPAGVAPSPR |
| Ga0179587_107652852 | 3300026557 | Vadose Zone Soil | KLHKLEPGWEIAEWFCILDEDNAYDQVVRKPAGVAPKSK |
| Ga0209731_10488381 | 3300027326 | Forest Soil | NPPKLHKLEPGWEIAEWFCVIDEENAYSEAIRKPAGIAPEKK |
| Ga0208565_10420831 | 3300027662 | Peatlands Soil | VWVSPPKLHKLEPKWEIAEWFCASSELQTYDKDVRKPSGGGTTAPSK |
| Ga0208990_10222241 | 3300027663 | Forest Soil | PKLHKLEPMWEIAEWFCVIDDENAYGDAVRKPAGVSPTPK |
| Ga0208991_10375852 | 3300027681 | Forest Soil | KLHKLEPTWEIAEWFCVIDEDKAYDEVVRKPAGVAPSPK |
| Ga0209060_105286321 | 3300027826 | Surface Soil | KFKLEPNWEIAEFFCIVDEENTYGDAVRKPAGVAPKK |
| Ga0209580_104783481 | 3300027842 | Surface Soil | KLHKLEPGWELAEWFCVQDEHNAYDDAVRKPAGVSAPPK |
| Ga0209579_103540162 | 3300027869 | Surface Soil | LEPGWELAEWFCVLDENHDYDQVVRKPAGVAPEQGK |
| Ga0209380_104599662 | 3300027889 | Soil | LHKLEPGWEIAEWFCVLDEDKAYDEAVRKPAGVAPTPNK |
| Ga0209068_101285082 | 3300027894 | Watersheds | PWVSPPKLHKLEPGWEIAEWFCVLDENQGYDQVVRKPAGVAPASK |
| Ga0209624_104334451 | 3300027895 | Forest Soil | VSPPKLHKLKPTWEFGEWFCIADETEGYDQSVRKPAGGDSPLH |
| Ga0209488_101382773 | 3300027903 | Vadose Zone Soil | WVSPPKLHKLEPTWEIAEWFCATSEEQTYDEQVRKPSGVAPGPDK |
| Ga0209415_104563981 | 3300027905 | Peatlands Soil | WVSPPKLHKLEPGWELAEWFCVLDENKDYDQVVRKPAGVAPASK |
| Ga0209415_105167312 | 3300027905 | Peatlands Soil | IWVNPPKLHKLEPMWEIAEWFCVIEEENAYSDAIRKPAGGISIAPK |
| Ga0209415_105850982 | 3300027905 | Peatlands Soil | TKPWVSPPKLHKLEPGWELSEWFCVQDEHNAYDESVRKPAGVAPTRK |
| Ga0170823_162940232 | 3300031128 | Forest Soil | MYTKPWVSPPKLHKLEPGWELAEWFCVLDENHDYDQVVRKPAGVAPASGK |
| Ga0310686_1083764851 | 3300031708 | Soil | KAYSKPWVSPPKLHKLEPGWELSEWFCVQDEHNAYDESVRKPAGVSPARK |
| Ga0307477_106814552 | 3300031753 | Hardwood Forest Soil | TKLWVSPPKLHKLEPTWEIAEWFCIVDEEHAYSDTVRIPAGTPPAGRK |
| Ga0307477_108990611 | 3300031753 | Hardwood Forest Soil | PPKLHKLEPGWEIAEWFCVIDEENAYSEAIRKPAGIAPEKK |
| Ga0307475_114128592 | 3300031754 | Hardwood Forest Soil | TKPWVSPPKLHKLEPGWEIAEWFCVLDENKDYDQTVRKPAGVAPALK |
| Ga0307479_121282801 | 3300031962 | Hardwood Forest Soil | NPPKLHKLEPTWEIAEWFCVIEEENTYSDAVRKPAGGISTAPK |
| Ga0311301_100728531 | 3300032160 | Peatlands Soil | SPTKLHKLEPGWEIAEWFCVLDEDKAYDDAVRKPAGVAPSK |
| Ga0311301_1007285311 | 3300032160 | Peatlands Soil | TKPWVSPPKLHRLEPGWEIAEWFCVLDENKDYDQVVRKPAGVAPASK |
| Ga0311301_121731681 | 3300032160 | Peatlands Soil | TKPWVSPPKLHKLEPGWEIAEWFCAVEEDKAYDEVVRKPAGVAPKK |
| ⦗Top⦘ |