Basic Information | |
---|---|
Family ID | F089187 |
Family Type | Metagenome |
Number of Sequences | 109 |
Average Sequence Length | 41 residues |
Representative Sequence | NRVTIADAKTGEVERETLIPGTLHGQVVGTEKLSFNAGQK |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.92 % |
% of genes near scaffold ends (potentially truncated) | 99.08 % |
% of genes from short scaffolds (< 2000 bps) | 88.07 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.321 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (38.532 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.862 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.706 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 13.24% Coil/Unstructured: 82.35% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF01642 | MM_CoA_mutase | 38.53 |
PF06884 | DUF1264 | 10.09 |
PF02310 | B12-binding | 3.67 |
PF13551 | HTH_29 | 0.92 |
PF05193 | Peptidase_M16_C | 0.92 |
PF13432 | TPR_16 | 0.92 |
PF02321 | OEP | 0.92 |
PF07676 | PD40 | 0.92 |
PF03069 | FmdA_AmdA | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 38.53 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.83 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.32 % |
Unclassified | root | N/A | 14.68 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005180|Ga0066685_10918815 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300005450|Ga0066682_10152442 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
3300005538|Ga0070731_10742946 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300005554|Ga0066661_10587384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300005557|Ga0066704_10483088 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300005921|Ga0070766_10814473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300005921|Ga0070766_11058366 | Not Available | 559 | Open in IMG/M |
3300006041|Ga0075023_100448867 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300006047|Ga0075024_100881310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300006050|Ga0075028_100681584 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300006102|Ga0075015_100417571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
3300006176|Ga0070765_101033785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
3300006797|Ga0066659_10543363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
3300007258|Ga0099793_10325453 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300007265|Ga0099794_10042107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2176 | Open in IMG/M |
3300007265|Ga0099794_10074565 | Not Available | 1666 | Open in IMG/M |
3300009012|Ga0066710_101873373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
3300009038|Ga0099829_11133945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300009088|Ga0099830_10344514 | Not Available | 1197 | Open in IMG/M |
3300009090|Ga0099827_10228308 | Not Available | 1558 | Open in IMG/M |
3300009090|Ga0099827_10500580 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300009137|Ga0066709_101037928 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
3300009137|Ga0066709_103969092 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300009143|Ga0099792_10296778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
3300010043|Ga0126380_10581592 | Not Available | 878 | Open in IMG/M |
3300010303|Ga0134082_10257873 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300010341|Ga0074045_10574521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
3300010358|Ga0126370_11934556 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300010359|Ga0126376_11853599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300011269|Ga0137392_10592842 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300011269|Ga0137392_10815674 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300011269|Ga0137392_11427086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300011269|Ga0137392_11501483 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300011270|Ga0137391_10176419 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
3300011271|Ga0137393_10740624 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300012096|Ga0137389_10518873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
3300012096|Ga0137389_11453613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300012189|Ga0137388_10493580 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300012189|Ga0137388_11540511 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300012200|Ga0137382_11238548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300012202|Ga0137363_11186634 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300012202|Ga0137363_11202467 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300012205|Ga0137362_11550288 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300012207|Ga0137381_11008096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
3300012207|Ga0137381_11778396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300012359|Ga0137385_11050747 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300012363|Ga0137390_10497354 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300012363|Ga0137390_12002438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300012582|Ga0137358_10592072 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300012683|Ga0137398_10197656 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
3300012918|Ga0137396_10716681 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300012918|Ga0137396_10861518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300012918|Ga0137396_11093854 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300012922|Ga0137394_11319335 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300012925|Ga0137419_10073117 | All Organisms → cellular organisms → Bacteria | 2292 | Open in IMG/M |
3300012927|Ga0137416_11123073 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300012972|Ga0134077_10334141 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300014150|Ga0134081_10118044 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300014166|Ga0134079_10603392 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300014657|Ga0181522_10167342 | Not Available | 1288 | Open in IMG/M |
3300015053|Ga0137405_1236491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300015054|Ga0137420_1190215 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300015358|Ga0134089_10233552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
3300016270|Ga0182036_11604484 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300016319|Ga0182033_10077328 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
3300016357|Ga0182032_11422720 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300017924|Ga0187820_1038257 | Not Available | 1266 | Open in IMG/M |
3300017961|Ga0187778_10138554 | Not Available | 1529 | Open in IMG/M |
3300018433|Ga0066667_10612014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
3300018468|Ga0066662_11447386 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300020579|Ga0210407_10704948 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300020581|Ga0210399_11280390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
3300021170|Ga0210400_10192626 | Not Available | 1655 | Open in IMG/M |
3300021181|Ga0210388_10157667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1974 | Open in IMG/M |
3300021181|Ga0210388_11753416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300021407|Ga0210383_11458945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 567 | Open in IMG/M |
3300021432|Ga0210384_10373967 | Not Available | 1283 | Open in IMG/M |
3300021477|Ga0210398_10469558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1025 | Open in IMG/M |
3300021559|Ga0210409_11616308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300026304|Ga0209240_1021948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2445 | Open in IMG/M |
3300026312|Ga0209153_1006291 | All Organisms → cellular organisms → Bacteria | 3708 | Open in IMG/M |
3300026532|Ga0209160_1054331 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
3300026538|Ga0209056_10290557 | Not Available | 1134 | Open in IMG/M |
3300026538|Ga0209056_10661705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300026547|Ga0209156_10023630 | All Organisms → cellular organisms → Bacteria | 3625 | Open in IMG/M |
3300026551|Ga0209648_10153313 | Not Available | 1816 | Open in IMG/M |
3300026555|Ga0179593_1123312 | All Organisms → cellular organisms → Bacteria | 2961 | Open in IMG/M |
3300027671|Ga0209588_1243058 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300027674|Ga0209118_1005703 | All Organisms → cellular organisms → Bacteria | 4676 | Open in IMG/M |
3300027765|Ga0209073_10282221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300027829|Ga0209773_10497687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300027875|Ga0209283_10206069 | Not Available | 1306 | Open in IMG/M |
3300027898|Ga0209067_10196692 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300027910|Ga0209583_10148744 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300028047|Ga0209526_10252452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1206 | Open in IMG/M |
3300028536|Ga0137415_10675061 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300028536|Ga0137415_10964794 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300028780|Ga0302225_10039640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2348 | Open in IMG/M |
3300028906|Ga0308309_10166043 | Not Available | 1790 | Open in IMG/M |
3300031718|Ga0307474_10669177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
3300031753|Ga0307477_10101848 | Not Available | 1996 | Open in IMG/M |
3300031754|Ga0307475_10029008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3992 | Open in IMG/M |
3300031823|Ga0307478_11681400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300031890|Ga0306925_10026190 | All Organisms → cellular organisms → Bacteria | 5896 | Open in IMG/M |
3300031945|Ga0310913_10052567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2663 | Open in IMG/M |
3300032001|Ga0306922_11316019 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300032180|Ga0307471_100339258 | Not Available | 1608 | Open in IMG/M |
3300032180|Ga0307471_102188898 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300032261|Ga0306920_102813267 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 38.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.17% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.42% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.50% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.59% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.75% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.83% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.92% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.92% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.92% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.92% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.92% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.92% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066685_109188153 | 3300005180 | Soil | EVNRVTIADAKTGEAERETLIPGTLHGQVVGTEKLSFSAGQK* |
Ga0066682_101524423 | 3300005450 | Soil | EVNRVTIADAKTGEAERETLIPGTLHGQVVGTEKLSFNAGQK* |
Ga0070731_107429462 | 3300005538 | Surface Soil | TIADAKHGQIEHDTLIPGTMNGQVVGVDKIFDTKKEGQR* |
Ga0066661_105873842 | 3300005554 | Soil | TIADAKSGEAERETLIPGTLHGQVVGTDKLFFNSGQK* |
Ga0066704_104830881 | 3300005557 | Soil | VNHVTVADAEGGAIDRETLIPGTLHGQVVGVDKLFSGTNAGQK* |
Ga0070766_108144732 | 3300005921 | Soil | DAKSGEVERETLIPGTLHGKVVGTEDVSKGGGMR* |
Ga0070766_110583662 | 3300005921 | Soil | TIADAKHGQIERDTLIPGTINGQVVGTEKIFTTEGQR* |
Ga0075023_1004488671 | 3300006041 | Watersheds | VNHVTIADAKSGEADRDTLIPGTLHGQVVGTEKLFNNGGQR* |
Ga0075024_1008813103 | 3300006047 | Watersheds | IADAKSGETERETLIPGTLHGQVVGTDKLFSNSGQK* |
Ga0075028_1006815841 | 3300006050 | Watersheds | RVTIADAKSGEAERETLIPGTLHGLVVGTEKLSFNAGQK* |
Ga0075015_1004175712 | 3300006102 | Watersheds | LEVNHVTIADAKSGEVEHETLIPGTLHGKVVGTENLFTDRSLR* |
Ga0070765_1010337852 | 3300006176 | Soil | GAVERETLIPGTLHGKVVGTEDLFRDGGSRSSRE* |
Ga0066659_105433633 | 3300006797 | Soil | VTIADAKTGEAERETLIPGTLHGQVVGTEKLSFNAGQK* |
Ga0099793_103254531 | 3300007258 | Vadose Zone Soil | RAVGRTLEVNRVTIADGKTGEAERETLIPGTLHGQVVGTEKLSFNAGQK* |
Ga0099794_100421071 | 3300007265 | Vadose Zone Soil | TLEVNRVTIADAKSGEAERETLIPGTLHGQVVGTDKLSFMSDQK* |
Ga0099794_100745651 | 3300007265 | Vadose Zone Soil | TIADAKSGEAERETLIPGTLHGQVVGTDKLSFMSDQR* |
Ga0066710_1018733732 | 3300009012 | Grasslands Soil | VTIADAKSGEAERETLIPGTLHGQVVGTDKLFFNSGQK |
Ga0099829_111339451 | 3300009038 | Vadose Zone Soil | TLEVNRVTIVDAKSGEVERETLIPGTLHGQVVGVEKLFSNAGQK* |
Ga0099830_103445141 | 3300009088 | Vadose Zone Soil | NAKSGEVDRDPLIPGTLHGQVVGADKLFNNGGQR* |
Ga0099827_102283082 | 3300009090 | Vadose Zone Soil | RAVGRTLEVNRVTIADAKTGEAERETLIPGTLHGQVVGTEKLSFVAGQK* |
Ga0099827_105005801 | 3300009090 | Vadose Zone Soil | IADARTGEVERETLIPGTLHGQVVGTEKLFSNAGQK* |
Ga0066709_1010379281 | 3300009137 | Grasslands Soil | VTIADAKSGEAERETLIPGTLHGQVVGTDKLFFNSGQK* |
Ga0066709_1039690921 | 3300009137 | Grasslands Soil | LEVKRMTIAEAKQGEVERDTLIPGTLHGKVIGTEELPSGGHR* |
Ga0099792_102967781 | 3300009143 | Vadose Zone Soil | IADAKTGEAERETLIPGTLHGQVVGTDKLSFVAGQK* |
Ga0126380_105815921 | 3300010043 | Tropical Forest Soil | RVTIADAKSGEIERDTLIPGTLHGQVVGTDKLWSNGGQK* |
Ga0134082_102578732 | 3300010303 | Grasslands Soil | VTIADALSGDIGRETLIPGTLHGRVVGAEDLFRDGSGR* |
Ga0074045_105745211 | 3300010341 | Bog Forest Soil | NHVTIADAKTGEVERETLIPGTLHGRVVGIESLFRDGGMR* |
Ga0126370_119345562 | 3300010358 | Tropical Forest Soil | LEVNHVTIADAQSGEVERETMIPGTLHGQVVGVDKLFSGSNAGQK* |
Ga0126376_118535992 | 3300010359 | Tropical Forest Soil | GRTLEVNRVTIADAFTGQVERETLIPGTMHGQVVGVDKLFSNAGQK* |
Ga0137392_105928421 | 3300011269 | Vadose Zone Soil | VGRTLEVNRVTIADGKTGEAERETLIPGTLHGQVVGTEKLSFNAGQK* |
Ga0137392_108156742 | 3300011269 | Vadose Zone Soil | VTIADAKSGEAERETLIPGTLHGQVVGTEKLSFNADQK* |
Ga0137392_114270862 | 3300011269 | Vadose Zone Soil | RTLEVNRVTIADGKTGEVERETLIPGTLHGQVVGTEKLSFNAGQK* |
Ga0137392_115014832 | 3300011269 | Vadose Zone Soil | DAKTGEAERETLIPGTLHGQVVGTEKLSFNPGQK* |
Ga0137391_101764191 | 3300011270 | Vadose Zone Soil | RTLEVNRVTIADAKSGEAERETLIPGTLHGQVVGTEKLSFNSGQQ* |
Ga0137393_107406241 | 3300011271 | Vadose Zone Soil | VHRVTIADARTGEVERETLIPGTLHGQVVGTEKLFSNAGQK* |
Ga0137389_105188732 | 3300012096 | Vadose Zone Soil | EVNQVTIADAKTGEADRETLIPGTLHGQVVGTEKLFFNAGQR* |
Ga0137389_114536132 | 3300012096 | Vadose Zone Soil | SIADAKSGEVERETLIPGTLHGQVVGTEKLSFNSGQR* |
Ga0137388_104935801 | 3300012189 | Vadose Zone Soil | LEVNRVTIADAKSGEAERETLIPGTLHGQVVGTDKLSFMPGQR* |
Ga0137388_115405111 | 3300012189 | Vadose Zone Soil | EVHRVTIADARTGEVERETLIPGTLHGQVVGTEKLFSNAGQK* |
Ga0137382_112385482 | 3300012200 | Vadose Zone Soil | GRTLEVNRVSIADGKTGEVERETLIPGTLHGQVVGTEKLSFNAGQR* |
Ga0137363_111866341 | 3300012202 | Vadose Zone Soil | NRVTIADAKTGEAERETLIPGTLHGQVVGTEKLSFVAGQK* |
Ga0137363_112024671 | 3300012202 | Vadose Zone Soil | ADAKTGEAERGTLIPGTLHGQVVGTDKLSFVAGQK* |
Ga0137362_115502882 | 3300012205 | Vadose Zone Soil | EVNQVTIADAKSGEAERETLIPGTLHGQVVGTEKLSFNADLK* |
Ga0137381_110080961 | 3300012207 | Vadose Zone Soil | VNHVSIDDARTGDVERETQIPGSLHGQVVGVDKLFSSAGQK* |
Ga0137381_117783962 | 3300012207 | Vadose Zone Soil | GRTLEVNRVTIADAKSGEADRETLIPGTLHGQVVGTEKLSFNAGEK* |
Ga0137385_110507471 | 3300012359 | Vadose Zone Soil | VGRTLEVNRVSIADAKSGEVERETLIPGTLHGQVVGTDKLSFNSGQR* |
Ga0137390_104973541 | 3300012363 | Vadose Zone Soil | NRVTIADAKTGEVERETLIPGTLHGQVVGTEKLSFNAGQK* |
Ga0137390_120024381 | 3300012363 | Vadose Zone Soil | VGRTLEVNQVTIADAKTGEAERETLIPGTLHGQVVGTEKLSFNAGQK* |
Ga0137358_105920721 | 3300012582 | Vadose Zone Soil | DGKTGEAARETLIPGTLHGQVVGTEKLSYNAGQK* |
Ga0137398_101976561 | 3300012683 | Vadose Zone Soil | DAKTGEAARETLIPGTLHGQVVGTEKLSFNAGQK* |
Ga0137396_107166811 | 3300012918 | Vadose Zone Soil | RVTIADAKTGEAERETLIPGTLHGQVVGTDKLSFMSDQK* |
Ga0137396_108615181 | 3300012918 | Vadose Zone Soil | TIADAKSGEAERETLIPGTLHGQVVGTDKLSFMSGQK* |
Ga0137396_110938542 | 3300012918 | Vadose Zone Soil | ADAKSGEADRETLIPGTLHGQVVGTEKLWSDAGQK* |
Ga0137394_113193352 | 3300012922 | Vadose Zone Soil | RAVGRTLESNRVTIADAKSGEAERETLIPGTLHGQVVGTDKLSFMSGQK* |
Ga0137419_100731171 | 3300012925 | Vadose Zone Soil | TIADAKTGEAERETLIPGTLHGQVIGTEKLSFNAGQK* |
Ga0137416_111230731 | 3300012927 | Vadose Zone Soil | TIADAKTGEVERDTLIPGTLHGQVVGTEKLSFNAGQK* |
Ga0134077_103341412 | 3300012972 | Grasslands Soil | IADAKSGEAERETLIPGTLHGQVVGTEKLSFNAGQK* |
Ga0134081_101180442 | 3300014150 | Grasslands Soil | RAVGRTLEVNRVSIADGKTGEVERETLIPGTLHGQVVGTERLSFNAGQR* |
Ga0134079_106033921 | 3300014166 | Grasslands Soil | NRVTIADAKTGEAERETLIPGTLHGQVVGTEKLSFNTGQK* |
Ga0181522_101673422 | 3300014657 | Bog | GRTLEVNRVTIADAKHGQVDHDTLIPGTLNGQVVGVDKIFDNQKQGQR* |
Ga0137405_12364911 | 3300015053 | Vadose Zone Soil | VTIADAKAKSGDVDRETLIPGTLHGKVVGTDDLFRDQGRR* |
Ga0137420_11902151 | 3300015054 | Vadose Zone Soil | RAVGRTLEVNRVTIADGKSGEVERETLIPGTLHGQVVGTEKLSFNAGQK* |
Ga0134089_102335521 | 3300015358 | Grasslands Soil | DAKTGEAERETLIPGTLHGQVVGTERLSFNSGQK* |
Ga0182036_116044842 | 3300016270 | Soil | RVTIADAKTGAVEPDTLIPGTLHGQVVGADKIWSLPGQR |
Ga0182033_100773283 | 3300016319 | Soil | IADAEAGGIDRETLIPGTLHGQVVGVDKLFSDTSAGQK |
Ga0182032_114227201 | 3300016357 | Soil | TLEVNRVTIADAKTGAVEPDTLIPGTLHGQVVGADKIWSLPGQR |
Ga0187820_10382571 | 3300017924 | Freshwater Sediment | ADAKTGEVERETLIPGTLHGQVVGTDKLFSNAGQK |
Ga0187778_101385542 | 3300017961 | Tropical Peatland | ADALTGEVERETLIPGTLHGRVIGTDKLFANYGQK |
Ga0066667_106120142 | 3300018433 | Grasslands Soil | NRVTIADAKSGEAERETLIPGTLHGQVVGTEKLSFNAGQK |
Ga0066662_114473861 | 3300018468 | Grasslands Soil | RVTIADARTGEVERETLIPGTLHGQVVGTERLFSNAGQK |
Ga0210407_107049481 | 3300020579 | Soil | NHVTIADAKSGEVEHESLIPGTLHGKVVGTEDLFTDRGQR |
Ga0210399_112803902 | 3300020581 | Soil | VNHVTIADAKSGEVERETLIPGTLHGKVVGTEDLFRDGGSR |
Ga0210400_101926262 | 3300021170 | Soil | EVNHVTIADAKSGEVDRDTLIPGTLHGKVVGTENLSTAGNGQK |
Ga0210388_101576671 | 3300021181 | Soil | GRTLDVNHVTIADAKSGEIERDTLIPGTLHGKVVGTEDLFRDGGMR |
Ga0210388_117534162 | 3300021181 | Soil | TLEVNRVTIADGKSGQAERETLIPGTLHGQVVGVDKIFASSGQK |
Ga0210383_114589452 | 3300021407 | Soil | GRTLEVNRVTIADAKHGQIERDTLIPGTLNGQVVGTDKIFTNEGQR |
Ga0210384_103739672 | 3300021432 | Soil | VGRTLEVNRVTIADAKHGQIERDTLIPGTLNGQVVGTEKIFTNEGQR |
Ga0210398_104695581 | 3300021477 | Soil | ALGRTLEVNRVTVANAKSGEVDRETLIPGTLHGHVVGTETMFTTSGEK |
Ga0210409_116163081 | 3300021559 | Soil | NHVTVADAKTGEVERETLIPGTLHGKVVGTEDLFKEGGSR |
Ga0209240_10219484 | 3300026304 | Grasslands Soil | VGRTLEVHRVTIADAKSGEANRDTLIPGTLHGQVVGTENLMNASRQR |
Ga0209153_10062914 | 3300026312 | Soil | ADATTGEVDRETLIPGTLHGQVVGVDKLFSGSDAGQK |
Ga0209160_10543314 | 3300026532 | Soil | HVTVADAEGGAIDRETLIPGTLHGQVVGVDKLFSGTNAGQK |
Ga0209056_102905571 | 3300026538 | Soil | TLEVNRVSIADGKTGEVERETLIPGTLHGQVVGTEKLSFNAGQR |
Ga0209056_106617052 | 3300026538 | Soil | VNRVTIADGKTGEVERQTLIPGTLHGQVVGTEKLSFNAGQK |
Ga0209156_100236301 | 3300026547 | Soil | VTIAEAESGDVDRETLIPGTLHGQVVGVDKLFSGSTAGQK |
Ga0209648_101533132 | 3300026551 | Grasslands Soil | VNRVTIADAKTGEVERETLIPGTLHGQVVGTEKLSFNAGQK |
Ga0179593_11233124 | 3300026555 | Vadose Zone Soil | VTIADAKTGEAERETLIPGTLRGQVVGTDKLSFMSGQK |
Ga0209588_12430581 | 3300027671 | Vadose Zone Soil | VGRTLEVNQVTIADAKTGEADRETLIPGTLHGQVVGTEKLFFNDGQK |
Ga0209118_10057036 | 3300027674 | Forest Soil | ANAKTGEVERETLIPGTLHGQVVGTEKLSFNAGQK |
Ga0209073_102822212 | 3300027765 | Agricultural Soil | IADAKSGDVERETLIPGTLHGRVVGTENLFADGGAR |
Ga0209773_104976871 | 3300027829 | Bog Forest Soil | IAGAKSGEIERDTLIPGTLHGKVVGTEDLFKAGGMR |
Ga0209283_102060691 | 3300027875 | Vadose Zone Soil | VTIANAKSGEVDRDPLIPGTLHGQVVGADKLFNNGGQR |
Ga0209067_101966922 | 3300027898 | Watersheds | EVNRVTIADAQSGELERETLIPGTLHGKVVGTEDFFRDGGMR |
Ga0209583_101487441 | 3300027910 | Watersheds | VNHVTIADAKTGEVERDTLIPGTLHGKVVGTEDLLRDQGRR |
Ga0209526_102524522 | 3300028047 | Forest Soil | RTLEVNRVTIADAKHGQIERETLIPGTLNGQVVGTEKISTIEGQR |
Ga0137415_106750612 | 3300028536 | Vadose Zone Soil | GRTLEVNRVTTADGKTGEAERDTLIPGTLHGQVVGTEKLSFNAGQK |
Ga0137415_109647942 | 3300028536 | Vadose Zone Soil | EVNRVTIADAKTGETERETLIPGTLHGQVVGTEKLSFNAGQK |
Ga0302225_100396401 | 3300028780 | Palsa | TIADAGRGEVEHDTLIPGTLHGKVVGTDQLFSDGKR |
Ga0308309_101660432 | 3300028906 | Soil | GRTLEVNRVTIADARHGQIERDTLIPGTLHGQVVGTEKIFTNEGQR |
Ga0307474_106691771 | 3300031718 | Hardwood Forest Soil | RTLEVNHVTIADAKTGEVERETLIPGTLHGKVVGTEDLFRERGLR |
Ga0307477_101018482 | 3300031753 | Hardwood Forest Soil | SIADAKSGEVERETLIPGTLHGRVVGADKLFSDGGQK |
Ga0307475_100290081 | 3300031754 | Hardwood Forest Soil | RTLEVNHVTIADAKSGEVQHETLIPGTLHGKVVGTEDLFSDRSLR |
Ga0307478_116814001 | 3300031823 | Hardwood Forest Soil | TIADAKSGEVERETLIPGTLHGKVVGTEDLFRDQGRR |
Ga0306925_100261901 | 3300031890 | Soil | GKTLEVNHVTIADAKGGEIDHQTLIPGTLHGQVVGVDKLFSDTSAGQK |
Ga0310913_100525671 | 3300031945 | Soil | NHVTIADAKGGEIDHQTLIPGTLHGQVVGVDKLFSDTSAGQK |
Ga0306922_113160191 | 3300032001 | Soil | LEVNRVTIADAKTGAVEPDTLIPGTLHGQVVGADKIWSLPGQR |
Ga0307471_1003392581 | 3300032180 | Hardwood Forest Soil | GRTLEVNRVTIADAKHGQVEHDTLIPGTLNGHVVGTEKLFTNEGQR |
Ga0307471_1021888982 | 3300032180 | Hardwood Forest Soil | LEANHVTIADAKTGEVERETLIPGTLHGQVVGTDKLFSNSGQK |
Ga0306920_1028132671 | 3300032261 | Soil | AVGKTLEVNHVTIADAKSGEVERETLIPGTLHGQVVGVDKLFSGSNAGQK |
⦗Top⦘ |