Basic Information | |
---|---|
Family ID | F089153 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 109 |
Average Sequence Length | 39 residues |
Representative Sequence | MSKDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKV |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 96.33 % |
% of genes near scaffold ends (potentially truncated) | 99.08 % |
% of genes from short scaffolds (< 2000 bps) | 98.17 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (54.128 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (21.101 % of family members) |
Environment Ontology (ENVO) | Unclassified (78.899 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.743 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.61% β-sheet: 9.09% Coil/Unstructured: 80.30% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF11753 | DUF3310 | 18.35 |
PF04965 | GPW_gp25 | 0.92 |
PF01327 | Pep_deformylase | 0.92 |
PF14743 | DNA_ligase_OB_2 | 0.92 |
PF03851 | UvdE | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.92 |
COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 54.13 % |
All Organisms | root | All Organisms | 45.87 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559018|JCVI_READ_1207910 | Not Available | 997 | Open in IMG/M |
3300000101|DelMOSum2010_c10054010 | Not Available | 1983 | Open in IMG/M |
3300000115|DelMOSum2011_c10165279 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 643 | Open in IMG/M |
3300000949|BBAY94_10036375 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1377 | Open in IMG/M |
3300001450|JGI24006J15134_10103047 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300001589|JGI24005J15628_10176666 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300001832|ACM6_1012741 | Not Available | 892 | Open in IMG/M |
3300004831|Ga0069134_166047 | Not Available | 572 | Open in IMG/M |
3300005510|Ga0066825_10381973 | Not Available | 517 | Open in IMG/M |
3300005837|Ga0078893_10171845 | Not Available | 752 | Open in IMG/M |
3300006191|Ga0075447_10113008 | Not Available | 933 | Open in IMG/M |
3300006737|Ga0098037_1163440 | Not Available | 743 | Open in IMG/M |
3300006737|Ga0098037_1245933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 575 | Open in IMG/M |
3300006929|Ga0098036_1089636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 946 | Open in IMG/M |
3300007992|Ga0105748_10386183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 603 | Open in IMG/M |
3300009080|Ga0102815_10297480 | Not Available | 892 | Open in IMG/M |
3300009409|Ga0114993_11332363 | Not Available | 502 | Open in IMG/M |
3300009420|Ga0114994_11132353 | Not Available | 505 | Open in IMG/M |
3300009426|Ga0115547_1027624 | All Organisms → cellular organisms → Bacteria | 2155 | Open in IMG/M |
3300009435|Ga0115546_1143035 | Not Available | 847 | Open in IMG/M |
3300009435|Ga0115546_1274366 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 576 | Open in IMG/M |
3300009435|Ga0115546_1280806 | Not Available | 569 | Open in IMG/M |
3300009467|Ga0115565_10563446 | Not Available | 510 | Open in IMG/M |
3300009785|Ga0115001_10541506 | Not Available | 715 | Open in IMG/M |
3300010148|Ga0098043_1083319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
3300010299|Ga0129342_1036055 | All Organisms → Viruses → Predicted Viral | 1979 | Open in IMG/M |
3300011253|Ga0151671_1006916 | Not Available | 892 | Open in IMG/M |
3300012920|Ga0160423_10585857 | All Organisms → Viruses | 756 | Open in IMG/M |
3300012928|Ga0163110_11276059 | Not Available | 592 | Open in IMG/M |
3300012936|Ga0163109_10784454 | Not Available | 697 | Open in IMG/M |
3300012936|Ga0163109_11177572 | Not Available | 559 | Open in IMG/M |
3300012952|Ga0163180_10597123 | Not Available | 839 | Open in IMG/M |
3300012954|Ga0163111_10363743 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
3300012954|Ga0163111_12153319 | Not Available | 563 | Open in IMG/M |
3300012954|Ga0163111_12580463 | Not Available | 518 | Open in IMG/M |
3300017717|Ga0181404_1025736 | Not Available | 1512 | Open in IMG/M |
3300017721|Ga0181373_1047477 | Not Available | 782 | Open in IMG/M |
3300017721|Ga0181373_1078844 | Not Available | 586 | Open in IMG/M |
3300017725|Ga0181398_1071744 | Not Available | 831 | Open in IMG/M |
3300017729|Ga0181396_1120660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 540 | Open in IMG/M |
3300017730|Ga0181417_1087169 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 756 | Open in IMG/M |
3300017732|Ga0181415_1039283 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
3300017740|Ga0181418_1053897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Mosig EXVC030M | 998 | Open in IMG/M |
3300017740|Ga0181418_1106941 | Not Available | 678 | Open in IMG/M |
3300017744|Ga0181397_1096606 | Not Available | 779 | Open in IMG/M |
3300017750|Ga0181405_1096940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 745 | Open in IMG/M |
3300017752|Ga0181400_1123981 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium | 745 | Open in IMG/M |
3300017757|Ga0181420_1129884 | Not Available | 761 | Open in IMG/M |
3300017758|Ga0181409_1240129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 515 | Open in IMG/M |
3300017759|Ga0181414_1049781 | Not Available | 1121 | Open in IMG/M |
3300017772|Ga0181430_1191077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 586 | Open in IMG/M |
3300017781|Ga0181423_1258213 | Not Available | 650 | Open in IMG/M |
3300017824|Ga0181552_10521859 | Not Available | 558 | Open in IMG/M |
3300018424|Ga0181591_11067973 | Not Available | 545 | Open in IMG/M |
3300018876|Ga0181564_10517565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
3300020165|Ga0206125_10278876 | Not Available | 630 | Open in IMG/M |
3300020165|Ga0206125_10310245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 588 | Open in IMG/M |
3300020237|Ga0211478_105316 | Not Available | 508 | Open in IMG/M |
3300020296|Ga0211474_1038907 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 756 | Open in IMG/M |
3300020296|Ga0211474_1050045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 646 | Open in IMG/M |
3300020305|Ga0211513_1018321 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
3300020314|Ga0211522_1063742 | Not Available | 624 | Open in IMG/M |
3300020345|Ga0211706_1028169 | All Organisms → Viruses → Predicted Viral | 1234 | Open in IMG/M |
3300020360|Ga0211712_10158972 | Not Available | 557 | Open in IMG/M |
3300020365|Ga0211506_1158378 | Not Available | 637 | Open in IMG/M |
3300020372|Ga0211683_10169653 | Not Available | 699 | Open in IMG/M |
3300020378|Ga0211527_10129287 | Not Available | 727 | Open in IMG/M |
3300020382|Ga0211686_10352212 | Not Available | 600 | Open in IMG/M |
3300020385|Ga0211677_10090449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Mosig EXVC030M | 1347 | Open in IMG/M |
3300020388|Ga0211678_10334209 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium | 612 | Open in IMG/M |
3300020416|Ga0211644_10140095 | Not Available | 987 | Open in IMG/M |
3300020421|Ga0211653_10006567 | Not Available | 5911 | Open in IMG/M |
3300020438|Ga0211576_10278475 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 874 | Open in IMG/M |
3300020446|Ga0211574_10121002 | Not Available | 1147 | Open in IMG/M |
3300020452|Ga0211545_10501064 | Not Available | 548 | Open in IMG/M |
3300020457|Ga0211643_10394924 | Not Available | 679 | Open in IMG/M |
3300020459|Ga0211514_10272830 | Not Available | 833 | Open in IMG/M |
3300020469|Ga0211577_10504544 | Not Available | 732 | Open in IMG/M |
3300020471|Ga0211614_10375855 | Not Available | 627 | Open in IMG/M |
3300021185|Ga0206682_10076105 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
3300021356|Ga0213858_10169171 | Not Available | 1065 | Open in IMG/M |
3300021378|Ga0213861_10213807 | Not Available | 1042 | Open in IMG/M |
3300021378|Ga0213861_10300078 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium | 826 | Open in IMG/M |
(restricted) 3300022920|Ga0233426_10127758 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1097 | Open in IMG/M |
(restricted) 3300022920|Ga0233426_10146494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Mosig EXVC030M | 1004 | Open in IMG/M |
3300023296|Ga0222664_1067392 | Not Available | 546 | Open in IMG/M |
3300024346|Ga0244775_10628239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 870 | Open in IMG/M |
3300024346|Ga0244775_10816819 | Not Available | 745 | Open in IMG/M |
3300024415|Ga0228662_1141314 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 533 | Open in IMG/M |
3300025138|Ga0209634_1279442 | Not Available | 586 | Open in IMG/M |
3300025138|Ga0209634_1281804 | Not Available | 582 | Open in IMG/M |
3300025168|Ga0209337_1266840 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300025632|Ga0209194_1127769 | Not Available | 618 | Open in IMG/M |
3300025652|Ga0208134_1154501 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 574 | Open in IMG/M |
3300025849|Ga0209603_1214524 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300025849|Ga0209603_1265286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 617 | Open in IMG/M |
3300025860|Ga0209119_1334951 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 523 | Open in IMG/M |
3300025892|Ga0209630_10123446 | All Organisms → Viruses → Predicted Viral | 1354 | Open in IMG/M |
3300026077|Ga0208749_1016795 | All Organisms → Viruses → Predicted Viral | 1537 | Open in IMG/M |
3300027206|Ga0208023_1047146 | Not Available | 715 | Open in IMG/M |
3300027298|Ga0208970_1082533 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 514 | Open in IMG/M |
3300027791|Ga0209830_10112347 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium | 1340 | Open in IMG/M |
3300028194|Ga0257106_1121160 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 933 | Open in IMG/M |
3300028197|Ga0257110_1276907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 614 | Open in IMG/M |
3300028233|Ga0256417_1223496 | Not Available | 502 | Open in IMG/M |
3300031510|Ga0308010_1155083 | Not Available | 852 | Open in IMG/M |
3300031519|Ga0307488_10639110 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300031519|Ga0307488_10798617 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium | 522 | Open in IMG/M |
3300031774|Ga0315331_10297192 | All Organisms → Viruses → Predicted Viral | 1191 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 21.10% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 15.60% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 13.76% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.34% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 6.42% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.59% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.75% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.83% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.83% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.83% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.83% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.83% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.83% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.83% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.83% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.83% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.92% |
Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.92% |
Environmental And Host-Associated | Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated | 0.92% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.92% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.92% |
Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.92% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.92% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.92% |
Surface Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater | 0.92% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.92% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.92% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.92% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559018 | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean6 (GOS4441574) | Environmental | Open in IMG/M |
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
3300001832 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM6, ROCA_DNA131_0.2um_27b | Environmental | Open in IMG/M |
3300004831 | Marine surface microbial communities from the North Atlantic Ocean - filtered matter | Environmental | Open in IMG/M |
3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
3300020237 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291767-ERR318621) | Environmental | Open in IMG/M |
3300020296 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX556002-ERR599140) | Environmental | Open in IMG/M |
3300020305 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX556024-ERR599003) | Environmental | Open in IMG/M |
3300020314 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974) | Environmental | Open in IMG/M |
3300020345 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX556079-ERR599137) | Environmental | Open in IMG/M |
3300020360 | Marine microbial communities from Tara Oceans - TARA_B100000459 (ERX555918-ERR599165) | Environmental | Open in IMG/M |
3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
3300020372 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) | Environmental | Open in IMG/M |
3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
3300023296 | Saline water microbial communities from Ace Lake, Antarctica - #604 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024415 | Seawater microbial communities from Monterey Bay, California, United States - 76D | Environmental | Open in IMG/M |
3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
3300026077 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B (SPAdes) | Environmental | Open in IMG/M |
3300027206 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027298 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 (SPAdes) | Environmental | Open in IMG/M |
3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
3300028233 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ocean6-_02435430 | 2166559018 | Environmental And Host-Associated | MDQDVLGYSSHDWRKHTENAVVVDHKTKMKVNESRVFYTPFQP |
DelMOSum2010_100540107 | 3300000101 | Marine | MSKDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKV |
DelMOSum2011_101652791 | 3300000115 | Marine | MSKDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKVRFTHP |
BBAY94_100363751 | 3300000949 | Macroalgal Surface | MSQDVLGYSSHDWRKHTDDAIVVASDIGIKLEVNKSK |
JGI24006J15134_101030474 | 3300001450 | Marine | MSQDILGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKV |
JGI24005J15628_101766661 | 3300001589 | Marine | MDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKVRFTHP |
ACM6_10127414 | 3300001832 | Marine Plankton | MSEDVLGYSSHDWRKNTDDAIVIDSKNMNYAKVNDCKV |
Ga0069134_1660473 | 3300004831 | Surface Seawater | MSQDVLGYSSHDWRKHTDDAIVVASDIGIKLEVNKSKVIFKHP |
Ga0066825_103819733 | 3300005510 | Marine | MSEDVLGYSSHDWRKNTDDAKVFDDKNLTYAKVNDCRVEFTN |
Ga0078893_101718454 | 3300005837 | Marine Surface Water | MSEDVLGYSSHDWRKNTDDAIVIDSKNMNYAKVNDCKVSFK |
Ga0075447_101130081 | 3300006191 | Marine | MDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKVRFT |
Ga0098037_11634401 | 3300006737 | Marine | MSNDVLGYSSHDWRKHTDDAVVVDGKTGIMKVNECR |
Ga0098037_12459332 | 3300006737 | Marine | MSEDILGYSSHDWRKHTDDAVVVDDREYEQMKVNNCRV |
Ga0098036_10896361 | 3300006929 | Marine | MSNDVLGYSSHDWRKHTDDAVVVDDREYEQMKVNN |
Ga0105748_103861833 | 3300007992 | Estuary Water | MSKDITGYSSHDWRKNTDSAVVIDDNVEHKSLKVNDSRVIFI |
Ga0102815_102974801 | 3300009080 | Estuarine | MALSDYSSHDWRKNTDDAVVMDDKNKTYAKVNDCKVKF |
Ga0114993_113323631 | 3300009409 | Marine | MDVLGYSSHDWRKHTDDAVVMDSWGGAMLRVNDSKVRFTHP |
Ga0114994_111323532 | 3300009420 | Marine | MSKDVLGYSSHDWRKHTDDAVVMDSWGGAMLRVNDSKVRFT |
Ga0115547_10276241 | 3300009426 | Pelagic Marine | MSQDILGYSSHDWRKNTDDAIVVASDIGIKLEVNKS |
Ga0115546_11430351 | 3300009435 | Pelagic Marine | MALSDYSSHDWRKYTDDAIVVDDKNKTYAKVNDCK |
Ga0115546_12743663 | 3300009435 | Pelagic Marine | MVGYSSHDWTKNTDDAIVVASDIGIQLEVNKSKVIFTNPKT |
Ga0115546_12808063 | 3300009435 | Pelagic Marine | MVEIMAEDILGYSSHDWRKHTDSAVVVDDTVEHKGLKVNNSRVIFVNPK |
Ga0115565_105634461 | 3300009467 | Pelagic Marine | MALSNYSSHDWTKHTDDAIVVSSNWDHISDEIGVQLKVNESKV |
Ga0115001_105415061 | 3300009785 | Marine | MDVLGYSSHDWRKNTDDAVVMDSWGGAMLRVNDSKV |
Ga0098043_10833194 | 3300010148 | Marine | MSDDILGYSSHDWRKNTDDAVVVDDKGENILKVNK |
Ga0129342_10360555 | 3300010299 | Freshwater To Marine Saline Gradient | MTEYSSHDWRKNTDDAIVVASNIGIQLEANKSKVIF |
Ga0151671_10069161 | 3300011253 | Marine | MSDDVLGYCCHDWRKHTDDAVVVDDKGENILKVNSSRV |
Ga0160423_105858571 | 3300012920 | Surface Seawater | MTVYSSHDWRKHTDDARVVDDKNMTYAKVNDCRVLF |
Ga0163110_112760593 | 3300012928 | Surface Seawater | MSEDVLGYSSHDWRKHTDDAKVFDDKNLTYAKVKDGR |
Ga0163109_107844545 | 3300012936 | Surface Seawater | MSEDVLGYSSHDWRKNTDDAVVLDEVNKSYAKVNDCKV |
Ga0163109_111775721 | 3300012936 | Surface Seawater | MSEDILGYSSHDWRKNTHDAVVVDDKGDNVLKVNSSRVI |
Ga0163180_105971233 | 3300012952 | Seawater | MAISDYSSHDWRKHTDSAVVVDKNKAMLKVNECKVYFT |
Ga0163111_103637431 | 3300012954 | Surface Seawater | MTEYSSHDWRKNTHDAIVESEDASFIKNKIQLEVNKSKVIFKHPKT |
Ga0163111_121533191 | 3300012954 | Surface Seawater | MTEYSSHDWRKNTDDAIVVASNIGIQLEANKSKVIFTNPK |
Ga0163111_125804631 | 3300012954 | Surface Seawater | MSDDVLGYSSHDWRKNTDDAVVVDDKGENILKVNKSRV |
Ga0181404_10257361 | 3300017717 | Seawater | MSEDILGYSSHDWRKNTDDAVVMDSWGGAMLRVNDSKVRF |
Ga0181373_10474771 | 3300017721 | Marine | MAEDILGYSSHDWRKHTDDAVVVDDREYEQMKVNNCRVIFTN |
Ga0181373_10788443 | 3300017721 | Marine | MAQEDYSSHDWTKHTDDAIIVSSDIGIELKVNQSKVIFTNP |
Ga0181398_10717444 | 3300017725 | Seawater | MSNDVLGYSSHDWRKHTDNAVIVDDREFEQLKVNNSRVIFTN |
Ga0181396_11206603 | 3300017729 | Seawater | MSQDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKVRFTH |
Ga0181417_10871691 | 3300017730 | Seawater | MSQDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKV |
Ga0181415_10392831 | 3300017732 | Seawater | MVDILGYSSHDWRKHTDDAVVVDNKTGIMKVNDCRVL |
Ga0181418_10538971 | 3300017740 | Seawater | MSKDVLGYSSHDWRKYTDDAIVVSDREYEQLKVNNCKVR |
Ga0181418_11069411 | 3300017740 | Seawater | MSIDVLGYSSHDWRKNTDDARVIDQKNMTYAKVNDCKVS |
Ga0181397_10966063 | 3300017744 | Seawater | MVDILGYSSHDWRKHTDDAVVVDNKTGIMKVNDCRVLF |
Ga0181405_10969401 | 3300017750 | Seawater | MSKDILGYSSHDWRKYTDDAIVVASDIGIKLEVNKSKVIF |
Ga0181400_11239813 | 3300017752 | Seawater | MDVLGYSSHDWRKYTDDAIVVASDIGIKLEVNKSKVIFKHP |
Ga0181420_11298841 | 3300017757 | Seawater | MVDVLGYSSHDWRKHTDDAVVVDNKTGIMKVNDCRVL |
Ga0181409_12401291 | 3300017758 | Seawater | MDVLGYSSHDWRKNTDDAIVVASDIGIKLEVNKSKV |
Ga0181414_10497811 | 3300017759 | Seawater | MSKDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKVSLFPLPL |
Ga0181430_11910771 | 3300017772 | Seawater | MSQDVLGYSSHDWRKYTDDAIVVASDIGIKLEVNKSKVIFKHPKT |
Ga0181423_12582131 | 3300017781 | Seawater | MSKDVLGYSSHDWRKYTDDAVVVDDIVEHKALKVNDSRVIF |
Ga0181552_105218591 | 3300017824 | Salt Marsh | MSNDVLGYSSHDWRKHTDDAVVVDDKGDKVFKVNSSRVIFT |
Ga0181591_110679733 | 3300018424 | Salt Marsh | MSEDVLGYSSHDWRKNTDGAIVIDDKNKTYAKVNDCKVSF |
Ga0181564_105175653 | 3300018876 | Salt Marsh | MSDDILGYSSHDWRKHTDSAVVVDDKVEHKALKVNDSRV |
Ga0206125_102788763 | 3300020165 | Seawater | MSQDVLGYSSHDWRKHTDDAIVVASDIGIKLEVNK |
Ga0206125_103102453 | 3300020165 | Seawater | MSQDVLGYSSHDWRKYTDDAVVVDDKIEHKALKVNDS |
Ga0211478_1053161 | 3300020237 | Marine | MAISDYSSHDWRKHTDSAVVVDKNKAMLKVNECKV |
Ga0211474_10389071 | 3300020296 | Marine | MSQDVLGYSSHDWRKHTDDAIVVASDIGIKLEVNKSKVI |
Ga0211474_10500453 | 3300020296 | Marine | MSQDVLGYSSHDWRKYTDDAIVVASDIGIKLEVNKSKVI |
Ga0211513_10183214 | 3300020305 | Marine | MSKDDILGYSSHDWRKHTDSAVVCDSENGMMKVNDSKVYFTN |
Ga0211522_10637421 | 3300020314 | Marine | MSEDVLGYSSHDWRKNTDDAIVIDDKNKTYAKVNDCKVSF |
Ga0211706_10281691 | 3300020345 | Marine | MDQDVLGYSSHDWRKHTDDAVVVDHKTKMKVNESRV |
Ga0211712_101589721 | 3300020360 | Marine | MSEDVLGYSSHDWRKHTDDAIVVSSNIGIQLEVNKSKVI |
Ga0211506_11583783 | 3300020365 | Marine | MSNDVLGYSSHDWRKHTDDAVVVDDKGDKVFKVNS |
Ga0211683_101696531 | 3300020372 | Marine | MDVLGYSSHDWRKNTDDAVVFDNNSATLKVNDCKVKFT |
Ga0211527_101292871 | 3300020378 | Marine | MTVYSSHDWRKHTDDAVVRDNANKTIGKVNDCIVSF |
Ga0211686_103522122 | 3300020382 | Marine | MSKDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKVRFT |
Ga0211677_100904491 | 3300020385 | Marine | MSQDVLGYSSHDWRKNTDDAIVVASDIGIQLEVNKSKVIF |
Ga0211678_103342093 | 3300020388 | Marine | MDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKVR |
Ga0211644_101400953 | 3300020416 | Marine | MSTEANYSSHDWRKNTDDAIVVASDIGIQLEVNKSKVIFT |
Ga0211653_1000656713 | 3300020421 | Marine | MDVLGYSSHDWRKNTDDAIVVASDIGIQLEVNKSKVIFTH |
Ga0211576_102784754 | 3300020438 | Marine | MSQDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVND |
Ga0211574_101210025 | 3300020446 | Marine | MSEDILGYSSHDWRKNTDNAIVIDDKNKTYAKVNDCKVSFKN |
Ga0211545_105010641 | 3300020452 | Marine | MSTEANYSSHDWRKNTDDAIVVASDIGIKLEVNKSKVIFTNPK |
Ga0211643_103949241 | 3300020457 | Marine | MSTEANYSSHDWRKNTDDAIVVASDIGIQLEVNKS |
Ga0211514_102728301 | 3300020459 | Marine | MSKDDVLGYSSHDWRKHTDDAIVRDDTNKTFAKVNDCVVSFKNPRTLQI |
Ga0211577_105045441 | 3300020469 | Marine | MSVDVLGYSSHDWRKYTDDALVVDGATGIMKVNDC |
Ga0211614_103758553 | 3300020471 | Marine | MSEDVLGYSSHDWRKNTDDAIVIDEKNMNYAKVNDCKVSFKN |
Ga0206682_100761056 | 3300021185 | Seawater | MSQDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKVRF |
Ga0213858_101691714 | 3300021356 | Seawater | MSEDVLGYSSHDWRKNTDDARVVDDKNLSYAKVNDCRVI |
Ga0213861_102138074 | 3300021378 | Seawater | MSEDVLGYSSHDWRKNTDDARVVDDKNLSYAKVNDCRVIFT |
Ga0213861_103000784 | 3300021378 | Seawater | MDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKV |
(restricted) Ga0233426_101277586 | 3300022920 | Seawater | MSQDVLGYSSHDWRKYTDDAVVVDDTVEHKALKVND |
(restricted) Ga0233426_101464941 | 3300022920 | Seawater | MSKDILGYSSHDWRKNTDDAVVMDSWGGAMLRVNDSKVRFTH |
Ga0222664_10673922 | 3300023296 | Saline Water | MAQEDYSSHDWRKHTDDARVIDDKNLTYAKVNDCRV |
Ga0244775_106282391 | 3300024346 | Estuarine | MSKDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDS |
Ga0244775_108168194 | 3300024346 | Estuarine | MSKDVLGYSSHDWRKNTDDAVVMDSWGGAMLRVNDSKVRF |
Ga0228662_11413141 | 3300024415 | Seawater | MSQDILGYSSHDWRKNTDDAIVVASDIGIKLEVNKSKVIFKHP |
Ga0209634_12794422 | 3300025138 | Marine | MDVLGYSSHDWRKNTDDAVVMDSWGGAMLRVNDSKVRFT |
Ga0209634_12818041 | 3300025138 | Marine | MDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSK |
Ga0209337_12668403 | 3300025168 | Marine | MDVLGYSSHDWRKYTDDATVTDDNSATLKVNDCTVKFTHP |
Ga0209194_11277693 | 3300025632 | Pelagic Marine | MALSDYSSHDWRKYTDDAIVVDDKNKTYAKVNDCKVSFKN |
Ga0208134_11545013 | 3300025652 | Aqueous | MSKDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKVR |
Ga0209603_12145241 | 3300025849 | Pelagic Marine | MSKDILGYSSHDWRKHTDDAVVLDEVNKSYAKVNDCKVSFTNPKS |
Ga0209603_12652861 | 3300025849 | Pelagic Marine | MSQDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKVR |
Ga0209119_13349511 | 3300025860 | Pelagic Marine | MSKDVLGYSSHDWRKHTDDAVVMDSWGGAMLRVND |
Ga0209630_101234461 | 3300025892 | Pelagic Marine | MTKDVLGYSSHDWRKNTDDAVVMDSWGGAMLRVNDSK |
Ga0208749_10167951 | 3300026077 | Marine | MSEDVLGYSSHDWRKNTDDARVVDDKNLSYAKVNDCR |
Ga0208023_10471461 | 3300027206 | Estuarine | MSKDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKVRFTH |
Ga0208970_10825333 | 3300027298 | Marine | MSKDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKVRF |
Ga0209830_101123471 | 3300027791 | Marine | MSKDVLGYSSHDWRKNTDDAVVMDSWGGAMLRVNDSK |
Ga0257106_11211601 | 3300028194 | Marine | MSQDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSKVRFTHP |
Ga0257110_12769071 | 3300028197 | Marine | MSKDVLGYSSHDWRKYTDDAVVMDSWGGAMLRVNDSK |
Ga0256417_12234963 | 3300028233 | Seawater | MSNDVLGYSSHDWRKHTDSAVVVDDYNTEKFKVNNSRVIFIN |
Ga0308010_11550831 | 3300031510 | Marine | MDVLGYSSHDWRKNTDDAVVFDNNSATLKVNDCKVKF |
Ga0307488_106391103 | 3300031519 | Sackhole Brine | MDVLGYSSHDWRKYTDDATVTDDNSATLKVNDCTV |
Ga0307488_107986173 | 3300031519 | Sackhole Brine | MDVLGYSSHDWRKHTDDAVVMDSWGGAMLRVNDSKVRF |
Ga0315331_102971921 | 3300031774 | Seawater | MTEYSSHDWRKNTDDAIVVASDIGIKLEVNKSKVIFTN |
⦗Top⦘ |