NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F089146

Metagenome Family F089146

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089146
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 41 residues
Representative Sequence MTEPVRVGELLPGVLAEVVDRAGHGYSRWAELVAQAGYC
Number of Associated Samples 66
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.06 %
% of genes near scaffold ends (potentially truncated) 88.99 %
% of genes from short scaffolds (< 2000 bps) 87.16 %
Associated GOLD sequencing projects 63
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.321 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere
(26.605 % of family members)
Environment Ontology (ENVO) Unclassified
(30.275 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.284 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.28%    β-sheet: 0.00%    Coil/Unstructured: 56.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF02861Clp_N 10.09
PF01580FtsK_SpoIIIE 10.09
PF00004AAA 2.75
PF01548DEDD_Tnp_IS110 1.83
PF12846AAA_10 0.92
PF10009DUF2252 0.92
PF07702UTRA 0.92
PF06243PaaB 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 10.09
COG1674DNA segregation ATPase FtsK/SpoIIIE or related proteinCell cycle control, cell division, chromosome partitioning [D] 10.09
COG3547TransposaseMobilome: prophages, transposons [X] 1.83
COG34601,2-phenylacetyl-CoA epoxidase, PaaB subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.24 %
UnclassifiedrootN/A13.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_106435279All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300000956|JGI10216J12902_107005748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300005168|Ga0066809_10239487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8503Open in IMG/M
3300005981|Ga0081538_10038770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3067Open in IMG/M
3300005981|Ga0081538_10291903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300006049|Ga0075417_10044760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1889Open in IMG/M
3300006194|Ga0075427_10033181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia852Open in IMG/M
3300006196|Ga0075422_10310678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia678Open in IMG/M
3300006846|Ga0075430_100527882All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300006846|Ga0075430_101664213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300006853|Ga0075420_100109576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2434Open in IMG/M
3300006904|Ga0075424_100732787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1055Open in IMG/M
3300006969|Ga0075419_10250162Not Available1184Open in IMG/M
3300009100|Ga0075418_10833770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia996Open in IMG/M
3300009147|Ga0114129_10283699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2212Open in IMG/M
3300009147|Ga0114129_12544047All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300009156|Ga0111538_12259467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia683Open in IMG/M
3300009789|Ga0126307_10537480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia943Open in IMG/M
3300009789|Ga0126307_10619119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia874Open in IMG/M
3300009816|Ga0105076_1100864All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300009840|Ga0126313_10018844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4553Open in IMG/M
3300009840|Ga0126313_11262699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia610Open in IMG/M
3300009840|Ga0126313_11322393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia596Open in IMG/M
3300009840|Ga0126313_11455947All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300010041|Ga0126312_11493966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300010042|Ga0126314_10349531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1060Open in IMG/M
3300010042|Ga0126314_10382015All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300010042|Ga0126314_10450357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales931Open in IMG/M
3300010042|Ga0126314_11040274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300010042|Ga0126314_11128069Not Available584Open in IMG/M
3300010044|Ga0126310_11068560All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300010044|Ga0126310_11308947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia586Open in IMG/M
3300010166|Ga0126306_10801797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300010166|Ga0126306_11183165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia628Open in IMG/M
3300018028|Ga0184608_10112963Not Available1145Open in IMG/M
3300018066|Ga0184617_1097105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia819Open in IMG/M
3300018081|Ga0184625_10187689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1083Open in IMG/M
3300018081|Ga0184625_10203484Not Available1037Open in IMG/M
3300018466|Ga0190268_11753586All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300020003|Ga0193739_1174351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300027809|Ga0209574_10363416Not Available508Open in IMG/M
3300027907|Ga0207428_10194210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1529Open in IMG/M
3300027909|Ga0209382_11573859All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300028589|Ga0247818_10391734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia935Open in IMG/M
3300028596|Ga0247821_10345522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia917Open in IMG/M
3300028707|Ga0307291_1004004All Organisms → cellular organisms → Bacteria3150Open in IMG/M
3300028708|Ga0307295_10114189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia734Open in IMG/M
3300028719|Ga0307301_10154083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia740Open in IMG/M
3300028719|Ga0307301_10304631Not Available522Open in IMG/M
3300028721|Ga0307315_10312042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300028722|Ga0307319_10144624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia770Open in IMG/M
3300028744|Ga0307318_10234490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia637Open in IMG/M
3300028754|Ga0307297_10306354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia574Open in IMG/M
3300028771|Ga0307320_10150440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia900Open in IMG/M
3300028791|Ga0307290_10265223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia629Open in IMG/M
3300028796|Ga0307287_10077832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1242Open in IMG/M
3300028796|Ga0307287_10089843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1155Open in IMG/M
3300028796|Ga0307287_10110230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1040Open in IMG/M
3300028799|Ga0307284_10252568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia702Open in IMG/M
3300028807|Ga0307305_10541096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300028810|Ga0307294_10284904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia596Open in IMG/M
3300028814|Ga0307302_10022898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2838Open in IMG/M
3300028880|Ga0307300_10191705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia659Open in IMG/M
3300028881|Ga0307277_10415414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300028885|Ga0307304_10239027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia788Open in IMG/M
3300028889|Ga0247827_10956717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300030499|Ga0268259_10102888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300030499|Ga0268259_10195112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300030514|Ga0268253_10265311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia583Open in IMG/M
3300031548|Ga0307408_102039704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia552Open in IMG/M
3300031731|Ga0307405_10236530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1350Open in IMG/M
3300031731|Ga0307405_10397729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1077Open in IMG/M
3300031731|Ga0307405_11335966All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300031824|Ga0307413_10494960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia980Open in IMG/M
3300031824|Ga0307413_10877467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300031824|Ga0307413_11608126All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300031824|Ga0307413_12117956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300031901|Ga0307406_10562909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia934Open in IMG/M
3300031901|Ga0307406_11701832All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300031903|Ga0307407_10104691All Organisms → cellular organisms → Bacteria1764Open in IMG/M
3300031903|Ga0307407_10203330All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300031903|Ga0307407_10739114All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300031903|Ga0307407_11700133All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031938|Ga0308175_102832488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia542Open in IMG/M
3300031995|Ga0307409_100205859All Organisms → cellular organisms → Bacteria1764Open in IMG/M
3300031995|Ga0307409_101238997All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300032002|Ga0307416_100224924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1803Open in IMG/M
3300032002|Ga0307416_100606498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1175Open in IMG/M
3300032002|Ga0307416_100863182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1004Open in IMG/M
3300032002|Ga0307416_101396911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia806Open in IMG/M
3300032002|Ga0307416_101506553All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300032002|Ga0307416_102805294Not Available583Open in IMG/M
3300032002|Ga0307416_102805612Not Available583Open in IMG/M
3300032002|Ga0307416_103364794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300032126|Ga0307415_100080621All Organisms → cellular organisms → Bacteria2322Open in IMG/M
3300032126|Ga0307415_101254386All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300032126|Ga0307415_101816548All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300032159|Ga0268251_10270866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia694Open in IMG/M
3300033550|Ga0247829_10372834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1170Open in IMG/M
3300034172|Ga0334913_063829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia777Open in IMG/M
3300034174|Ga0334932_015393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1266Open in IMG/M
3300034174|Ga0334932_051131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia706Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere26.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil22.02%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil15.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere14.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.59%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.67%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil2.75%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave2.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.83%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere1.83%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.92%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030514Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M
3300034174Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10643527913300000956SoilMSDPTPVGELLPEVLAEVIDRAGPGYARWAELVAQAGYCHHPI
JGI10216J12902_10700574823300000956SoilMTEPVRVGELLPGVLAEVVDRAGNGYQRWAELVAQAGYCH
Ga0066809_1023948723300005168SoilMTEPTRVGRVLPEVLAEVIDRAGPDYDRWMELVAQTGYCAHPV
Ga0081538_1003877023300005981Tabebuia Heterophylla RhizosphereMTAPVRVGEVLPAVVAEAIARAGHGDDRWMEVAATGSCAHPVRTATVVPVPL*
Ga0081538_1029190313300005981Tabebuia Heterophylla RhizosphereMTDPVRVGELVPGVLGEVVDRAGHGYERWAELVAQAGYCHHPIRL
Ga0075417_1004476043300006049Populus RhizosphereMTDPVRVGELLPGVLAEVVDRAGHGYERWAEQVAATGYCTHPVRLRG
Ga0075427_1003318113300006194Populus RhizosphereMTEPTRVGEVLPGVLAEVIERAGRGYDRWAELVAQAGYCHHPIRLA
Ga0075422_1031067823300006196Populus RhizosphereMTEPTRVGEVLPGVLAEVIERAGRGYDRWAELVAQ
Ga0075430_10052788213300006846Populus RhizosphereMSEPVQVGELLPGVLQEVIERAGPGYERWAEQVAA
Ga0075430_10166421313300006846Populus RhizosphereMTDPVRVSELLPGVLGEVVDRAGHGYERWAELVAQAGYC
Ga0075420_10010957643300006853Populus RhizosphereMTDPVRVGELLPSVLGEVVDRAGAGYERWMELVAQAGYCHHPIRLA
Ga0075424_10018463313300006904Populus RhizosphereMTEPVLVGELLPGVLQEVIDRAGPGYDRWAEQVAATGYCAHPVRLRAGSSTPTLRPG
Ga0075424_10073278713300006904Populus RhizosphereMTDPSRVGELLPGVLAEVVDRAGHGYQRWVELVAQAGYCHHPIRLA
Ga0075419_1025016213300006969Populus RhizosphereMTDPVRVGELLPGVLAEVVDRAGHGYARWAEQVAATGYCAH
Ga0075418_1083377023300009100Populus RhizosphereMTEPVRVGALLPGVLGELVDRAGDGYGRWMELVAQAGYC
Ga0114129_1028369943300009147Populus RhizosphereMTEPVPVGELLPAVVAEAIERAGPGYDRWAEQVAATG*
Ga0114129_1254404713300009147Populus RhizosphereMSEPALVGELLPGVLQEVIARAGPGYDRWAEQVAATGYCAHP
Ga0111538_1225946723300009156Populus RhizosphereMTEPVRVGELLPGVLGEVVERAGHGYARWAELVAQA
Ga0075423_1014657153300009162Populus RhizosphereMTEPVLVGELLPGVLQEVIDRAGPGYDRWAEQVAATGYCAHPVRLRAGSSTPTLRPGRSARS
Ga0126307_1053748013300009789Serpentine SoilMTDPVRVGELLPAVVAELVDRAGHGYDRWAELVAQA
Ga0126307_1061911923300009789Serpentine SoilMSEPTQVGEVLPGVLAEVVDRAGHGYDRWAELVA*
Ga0105076_110086423300009816Groundwater SandMSDPVQVGELLPDVLQEVVQRAGHGYDRWAELVAQAGYCH
Ga0126313_1001884473300009840Serpentine SoilMTEPSLVGELLPGVLQEVIDRAGPSYERWAEQVAATGY
Ga0126313_1110082413300009840Serpentine SoilMSEPMPVGAVLPGVLAEVVDRAGAGYDRWMELVAQAGYCHHPIR
Ga0126313_1126269923300009840Serpentine SoilMNEPARVGELLPGVLGELVERAGHGYDRWAELVAQAGY
Ga0126313_1132239313300009840Serpentine SoilMSEPVRVGELLPGVLGEVVDRAGPGYARWMELVAQAG
Ga0126313_1145594713300009840Serpentine SoilMTDPVLVGDVLPGVVAEAIARAGPGYDRWAEQVAATGYCVHPVRLRGTV
Ga0126312_1149396623300010041Serpentine SoilMTDPVRVGELLPGVLTEVVDRAGNGYERWAEQVAATGYCA
Ga0126314_1034953123300010042Serpentine SoilVTGPVRVGELVPGVLGEVVERAGHGYDRWAELVAQAG*
Ga0126314_1038201513300010042Serpentine SoilMTEPVLVGEVLPGVVAEAIARAGPGYDRWMEQVAATGY
Ga0126314_1045035733300010042Serpentine SoilMTEPVRVGEVLPEVVAEAIARAGPGYDRWMEQVAQTG
Ga0126314_1104027413300010042Serpentine SoilMSQPVQVGELLPGVVAEAIARAGPGYDRWAEQVAATGYCAHP
Ga0126314_1112806923300010042Serpentine SoilMTEPVRVGEVLPEVVAEAIARAGPGYDRWMEQVAQTGY
Ga0126310_1106856023300010044Serpentine SoilMTEPTRVGDVLPAVLAEVVDRAGAGYERWMELVAQ
Ga0126310_1130894713300010044Serpentine SoilMTEPERVGELLPGVLGEVVDRAGHGYQRWAELVAQAGYCHHPIR
Ga0126306_1080179723300010166Serpentine SoilMRVGDVLPEVLAEVVDRAGHGYDRWRELVAQAGYCHHPI
Ga0126306_1118316513300010166Serpentine SoilMIEPVRVGELLPGVLDEVVDRAGHGYQRWAELVAQAGYCHHPIRL
Ga0184608_1011296333300018028Groundwater SedimentMTGPVRVGEVLPEVVAEAIARAGPDYDRWMELVAQKGYCAHPVRL
Ga0184617_109710523300018066Groundwater SedimentMSEPARVGELLPGVPGEVVERAGHGYERWAELVAQAGYCHHP
Ga0184625_1018768933300018081Groundwater SedimentVTEPVRVGELLPGVIGEVVDRAGHGYDRWMELVAQAGYCHHPIRL
Ga0184625_1020348423300018081Groundwater SedimentMTEPVRVGELLPDVLGELVERAGHGYERWAELVAQAGYCH
Ga0190268_1175358613300018466SoilMSEPMAVGELLPGVLQEVIDRAGAGYERWAEQVAATGYCAHPVRLRGR
Ga0193739_117435123300020003SoilMTEPIQVGELLPGVVAEAIARAGPGYDRWMEQVAATGYCTHPVRLRG
Ga0209574_1036341623300027809AgaveVSEPVRVGELLPGVVGELVERAGHGYERWAELVAQAGYCHHP
Ga0207428_1019421013300027907Populus RhizosphereMTEPVRVGELLPGVLAEVVDRAGHGYSRWAELVAQAGYC
Ga0209382_1157385913300027909Populus RhizosphereMSEPVLVGELLPGVLQEVIERAGPGYERWAEQVAATGYCAH
Ga0247818_1039173413300028589SoilMTEPTRVGELLPGVLGEVIDRAGHGYERWATSSAHRS
Ga0247821_1034552213300028596SoilMTEPVRVGELLPGVLGEVVDRAGHGYDRWAELVAQA
Ga0307291_100400413300028707SoilMSEPARVGELLPGVLGEVVDRAGHGYDRWAELVAQAGYC
Ga0307295_1011418923300028708SoilMTDPVRVGELLPGVLAEVVDRAGHSYDRWAEQVAATGYCTH
Ga0307301_1015408313300028719SoilVTDPARVGELLPGVLGEVVDRAGQGYDRWAELVAQAGYC
Ga0307301_1030463113300028719SoilMSDPVRVGELVPGVLGEVVERAGHGYDRWAELVAQAGYCH
Ga0307315_1031204213300028721SoilMTDPVRVGELLPGVLAEVVDRAGHSYDRWAEQVAATGYCTHP
Ga0307319_1014462423300028722SoilMIEPVRVGEVLPGVLAEVVERAGRGYDRWAELVAQAGY
Ga0307319_1020564623300028722SoilMTEPVRVGELLPDVLGELVERAGHGYERWAELVAQAGYCHHPIRLAG
Ga0307318_1023449013300028744SoilMEPIQVGELLPGVLQEVIDRAGPGYERWAEQVAATGYCAHPVRLR
Ga0307297_1030635423300028754SoilVTEPTRVGELLPGVLGEVVDRAGHGYDRWAELVAQA
Ga0307320_1015044013300028771SoilMTDPVRVGELLPGVLAEVVDRAGHGYDRWAEQVAATGYCTHPVRLRG
Ga0307290_1026522313300028791SoilMSEPVGVGELLPGVLGEVVDRAGPGYDRWMELVAQ
Ga0307287_1007783223300028796SoilMTDPVRVGELLPGVLAEVVDRAGHSYDRWAEQVAATGY
Ga0307287_1008984313300028796SoilMTEPVQVGELLPGVLGEVVERAGHGYERWAELVAQAGY
Ga0307287_1011023023300028796SoilMTEPVRVGELLPGVLGEVVDRAGHGYDRWAELVAQAGYCHHPIRLA
Ga0307284_1025256823300028799SoilMTDPVRVGELLPGVLAEVVDRAGHSYDRWAEQVAATG
Ga0307305_1054109623300028807SoilMTEPTRVGELVLGVLGEVVERAGHGYERWAELVAQAGYCHHPIR
Ga0307294_1028490413300028810SoilMTDPVGVGELLPGVLAEVVDRAGHGYQRWAELVAQAGY
Ga0307302_1002289843300028814SoilMSEPVLVGELLPEVVAEAIARAGPGYDRWMEQVTAT
Ga0307310_1066166213300028824SoilVTEPTRVGELLPGVLGEVVDRAGHGYDRWAELVAQAGYCHHPIRLAG
Ga0307300_1019170523300028880SoilMSEPARVGELLPGVPGEVVERAGHGYERWAELVAQA
Ga0307277_1041541413300028881SoilMTEPVRVGELLPGVLGEVVDRAGHGYERWAELVAQVGYCH
Ga0307304_1023902723300028885SoilMTDPVRVGELLPGVLAEVVDRAGHGYDRWAEQVAATGYCTHPVGLRG
Ga0247827_1095671713300028889SoilVTEPVRVGELLPGVIGEVVDRAGHGYERWTELVAQAGYCHHPI
Ga0268259_1010288813300030499AgaveMTEPIRVGEALPGVLAEVVDRAGHGYERWAELVAQAG
Ga0268259_1019511223300030499AgaveVSEPIQVGELLPGVLQEVIDRAGPDYDRWAEQVAATGYCAHPVR
Ga0268253_1026531113300030514AgaveVSEPVRVGELLPGVVGELVERAGHGYERWAELVAQAGYCHHPIRL
Ga0307408_10203970413300031548RhizosphereMTEPVRVGELLPGVLGELVDRAGHGYERWAELVAQAG
Ga0307405_1023653013300031731RhizosphereVTEPVQVGELLPGVLGEVVDRAGHGYERWAELVAQAGYCHHP
Ga0307405_1039772913300031731RhizosphereMTEPARVGEMLPGVLAEVVDRAGHGYDRWAELVAQAGYCHH
Ga0307405_1133596623300031731RhizosphereMSQPVQVGELLPEVLAEVIQRAGNRYDRWAEQVAAT
Ga0307413_1049496013300031824RhizosphereMSEPMPVGAVLPGVLAEVVDRAGAGYDRWMELVAQAGFCHHPIR
Ga0307413_1087746713300031824RhizosphereVTEPVQVGELLPGVLGEVVDRAGVGYDRWAELVAQAGYCHHPI
Ga0307413_1160812613300031824RhizosphereMTEPVLVGDVLPGVVAEAIARAGPGYDRWAEQVAATGYCVH
Ga0307413_1211795613300031824RhizosphereMTDPVRVGELLPDVLAEVIDRAGHGYERWAELVAQAGYCH
Ga0307410_1040350813300031852RhizosphereMSEPIQVGELVPGVLGELVDRAGAGYARWAELVAQAGYCHHPIRLA
Ga0307406_1056290923300031901RhizosphereMTEPSLVGELLPGVLQEVIDRAGPSYERWAEQVAATGYCAH
Ga0307406_1170183213300031901RhizosphereMTEPARVGELLPEVLQEVVQRAGHGYDRWAELVAQAGYCHH
Ga0307407_1010469113300031903RhizosphereMTEPVLVGDVLPGVVAEAIARAGPGYDRWAEQVAATGY
Ga0307407_1020333033300031903RhizosphereMSEPALVAELLPGVLQEVIDRAGPGYERWAEQVAATGYCTHPVR
Ga0307407_1073911433300031903RhizosphereMTDPTRVGELLPSVLGEVVERAGHGYERWAELVAQAGY
Ga0307407_1170013313300031903RhizosphereMTDPVLIGELLPEVVAEAIARAGPGYDRWAEQVAATG
Ga0308175_10283248823300031938SoilMSEPARVGEVVPGVLAEVIGRAGHGYARWAELVAQAGY
Ga0307409_10020585933300031995RhizosphereMSEPAQVGDVLPGVLAEVIDRAGHGYARWAELVAQA
Ga0307409_10123899713300031995RhizosphereMTDPARVGDVLPGVLAEVVDRAGHGYDRWAELVAQAG
Ga0307416_10022492433300032002RhizosphereMSEPARVGELLPGVLGEVVDRAGHGYERWAELVAQAGYCHHPI
Ga0307416_10060649813300032002RhizosphereMTDPVRVGELLPGVLAEVVDRAGHGYERWAELVAQAGYCHHPIRLA
Ga0307416_10086318213300032002RhizosphereMTEPVRVGELLPGVVAELVERAEHGYDRWAELVAQAGYCHHPIR
Ga0307416_10139691123300032002RhizosphereMSQPVQVGELLPGVVAEAIARAGPGYDRWAEQVAATGY
Ga0307416_10150655323300032002RhizosphereMTQPTRVGELLPGVLGEVVDRAGHGYQRWAELVAQAGYCHHPIR
Ga0307416_10280529413300032002RhizosphereVSGPVLVGELLPKVLAEVVQRGGPGYGRWAELVAQAGYCHHPI
Ga0307416_10280561213300032002RhizosphereMTEPVRVGEVLPEVIAEAIARAGPGYARWMELVAQTGYCTH
Ga0307416_10336479423300032002RhizosphereVTEPTRVRELLPGVLEEVVDRAAHSYDRWAELVAQ
Ga0307415_10008062143300032126RhizosphereMSEPAQVGDVLPGVLAEVIDRAGHGYARWADLVAQAG
Ga0307415_10125438613300032126RhizosphereMSDPALVGDVLPGVVAEAIARAGPGYDRWMEQVAATGYCTH
Ga0307415_10181654823300032126RhizosphereMSEPVAVGELLPGVLQEVIDRAGPGYDRWAEQVAATG
Ga0307415_10219644713300032126RhizosphereVTGPVRVGELLPGVVAELVERAGHGYDRWAELVAQAGYCHHPIRLAG
Ga0268251_1027086613300032159AgaveMSAPALVAELLPGVLQEVIDRAGPGYDRWAEQIAAT
Ga0247829_1037283423300033550SoilMNEPTRVGDVLPGVLAEVVDRAGRGYDRWAALALPS
Ga0334913_063829_671_7753300034172Sub-Biocrust SoilMTEPTRVGELLPGVLQEVIDRAGPGYDRWAEQVAA
Ga0334932_015393_2_1393300034174Sub-Biocrust SoilVREPIQVGELLPGVLQEVIDRAGPGYEQWAEQVAATGYCAHPVRLR
Ga0334932_051131_2_1123300034174Sub-Biocrust SoilMTDPVRVGELLPGVLAEVVDRAGYGYDRWAELVAQAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.