Basic Information | |
---|---|
Family ID | F089146 |
Family Type | Metagenome |
Number of Sequences | 109 |
Average Sequence Length | 41 residues |
Representative Sequence | MTEPVRVGELLPGVLAEVVDRAGHGYSRWAELVAQAGYC |
Number of Associated Samples | 66 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.06 % |
% of genes near scaffold ends (potentially truncated) | 88.99 % |
% of genes from short scaffolds (< 2000 bps) | 87.16 % |
Associated GOLD sequencing projects | 63 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.321 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere (26.605 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.275 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.284 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF02861 | Clp_N | 10.09 |
PF01580 | FtsK_SpoIIIE | 10.09 |
PF00004 | AAA | 2.75 |
PF01548 | DEDD_Tnp_IS110 | 1.83 |
PF12846 | AAA_10 | 0.92 |
PF10009 | DUF2252 | 0.92 |
PF07702 | UTRA | 0.92 |
PF06243 | PaaB | 0.92 |
COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
---|---|---|---|
COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 10.09 |
COG1674 | DNA segregation ATPase FtsK/SpoIIIE or related protein | Cell cycle control, cell division, chromosome partitioning [D] | 10.09 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.83 |
COG3460 | 1,2-phenylacetyl-CoA epoxidase, PaaB subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.24 % |
Unclassified | root | N/A | 13.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_106435279 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300000956|JGI10216J12902_107005748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
3300005168|Ga0066809_10239487 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 503 | Open in IMG/M |
3300005981|Ga0081538_10038770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3067 | Open in IMG/M |
3300005981|Ga0081538_10291903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
3300006049|Ga0075417_10044760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1889 | Open in IMG/M |
3300006194|Ga0075427_10033181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 852 | Open in IMG/M |
3300006196|Ga0075422_10310678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 678 | Open in IMG/M |
3300006846|Ga0075430_100527882 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300006846|Ga0075430_101664213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
3300006853|Ga0075420_100109576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2434 | Open in IMG/M |
3300006904|Ga0075424_100732787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
3300006969|Ga0075419_10250162 | Not Available | 1184 | Open in IMG/M |
3300009100|Ga0075418_10833770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 996 | Open in IMG/M |
3300009147|Ga0114129_10283699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2212 | Open in IMG/M |
3300009147|Ga0114129_12544047 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300009156|Ga0111538_12259467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
3300009789|Ga0126307_10537480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 943 | Open in IMG/M |
3300009789|Ga0126307_10619119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 874 | Open in IMG/M |
3300009816|Ga0105076_1100864 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300009840|Ga0126313_10018844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4553 | Open in IMG/M |
3300009840|Ga0126313_11262699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
3300009840|Ga0126313_11322393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
3300009840|Ga0126313_11455947 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300010041|Ga0126312_11493966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
3300010042|Ga0126314_10349531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1060 | Open in IMG/M |
3300010042|Ga0126314_10382015 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300010042|Ga0126314_10450357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 931 | Open in IMG/M |
3300010042|Ga0126314_11040274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
3300010042|Ga0126314_11128069 | Not Available | 584 | Open in IMG/M |
3300010044|Ga0126310_11068560 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300010044|Ga0126310_11308947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
3300010166|Ga0126306_10801797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
3300010166|Ga0126306_11183165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
3300018028|Ga0184608_10112963 | Not Available | 1145 | Open in IMG/M |
3300018066|Ga0184617_1097105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 819 | Open in IMG/M |
3300018081|Ga0184625_10187689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1083 | Open in IMG/M |
3300018081|Ga0184625_10203484 | Not Available | 1037 | Open in IMG/M |
3300018466|Ga0190268_11753586 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300020003|Ga0193739_1174351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
3300027809|Ga0209574_10363416 | Not Available | 508 | Open in IMG/M |
3300027907|Ga0207428_10194210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1529 | Open in IMG/M |
3300027909|Ga0209382_11573859 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300028589|Ga0247818_10391734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 935 | Open in IMG/M |
3300028596|Ga0247821_10345522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 917 | Open in IMG/M |
3300028707|Ga0307291_1004004 | All Organisms → cellular organisms → Bacteria | 3150 | Open in IMG/M |
3300028708|Ga0307295_10114189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 734 | Open in IMG/M |
3300028719|Ga0307301_10154083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 740 | Open in IMG/M |
3300028719|Ga0307301_10304631 | Not Available | 522 | Open in IMG/M |
3300028721|Ga0307315_10312042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
3300028722|Ga0307319_10144624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
3300028744|Ga0307318_10234490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
3300028754|Ga0307297_10306354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
3300028771|Ga0307320_10150440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 900 | Open in IMG/M |
3300028791|Ga0307290_10265223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
3300028796|Ga0307287_10077832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1242 | Open in IMG/M |
3300028796|Ga0307287_10089843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1155 | Open in IMG/M |
3300028796|Ga0307287_10110230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1040 | Open in IMG/M |
3300028799|Ga0307284_10252568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
3300028807|Ga0307305_10541096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
3300028810|Ga0307294_10284904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
3300028814|Ga0307302_10022898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2838 | Open in IMG/M |
3300028880|Ga0307300_10191705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
3300028881|Ga0307277_10415414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
3300028885|Ga0307304_10239027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 788 | Open in IMG/M |
3300028889|Ga0247827_10956717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
3300030499|Ga0268259_10102888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
3300030499|Ga0268259_10195112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
3300030514|Ga0268253_10265311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
3300031548|Ga0307408_102039704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
3300031731|Ga0307405_10236530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1350 | Open in IMG/M |
3300031731|Ga0307405_10397729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1077 | Open in IMG/M |
3300031731|Ga0307405_11335966 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300031824|Ga0307413_10494960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 980 | Open in IMG/M |
3300031824|Ga0307413_10877467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
3300031824|Ga0307413_11608126 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300031824|Ga0307413_12117956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
3300031901|Ga0307406_10562909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 934 | Open in IMG/M |
3300031901|Ga0307406_11701832 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300031903|Ga0307407_10104691 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
3300031903|Ga0307407_10203330 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
3300031903|Ga0307407_10739114 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300031903|Ga0307407_11700133 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300031938|Ga0308175_102832488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
3300031995|Ga0307409_100205859 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
3300031995|Ga0307409_101238997 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300032002|Ga0307416_100224924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1803 | Open in IMG/M |
3300032002|Ga0307416_100606498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1175 | Open in IMG/M |
3300032002|Ga0307416_100863182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1004 | Open in IMG/M |
3300032002|Ga0307416_101396911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 806 | Open in IMG/M |
3300032002|Ga0307416_101506553 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300032002|Ga0307416_102805294 | Not Available | 583 | Open in IMG/M |
3300032002|Ga0307416_102805612 | Not Available | 583 | Open in IMG/M |
3300032002|Ga0307416_103364794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
3300032126|Ga0307415_100080621 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
3300032126|Ga0307415_101254386 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300032126|Ga0307415_101816548 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300032159|Ga0268251_10270866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 694 | Open in IMG/M |
3300033550|Ga0247829_10372834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1170 | Open in IMG/M |
3300034172|Ga0334913_063829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 777 | Open in IMG/M |
3300034174|Ga0334932_015393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1266 | Open in IMG/M |
3300034174|Ga0334932_051131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 706 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 26.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.02% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 15.60% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.59% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.67% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 2.75% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 2.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.83% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.83% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 1.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
3300034174 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1064352791 | 3300000956 | Soil | MSDPTPVGELLPEVLAEVIDRAGPGYARWAELVAQAGYCHHPI |
JGI10216J12902_1070057482 | 3300000956 | Soil | MTEPVRVGELLPGVLAEVVDRAGNGYQRWAELVAQAGYCH |
Ga0066809_102394872 | 3300005168 | Soil | MTEPTRVGRVLPEVLAEVIDRAGPDYDRWMELVAQTGYCAHPV |
Ga0081538_100387702 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MTAPVRVGEVLPAVVAEAIARAGHGDDRWMEVAATGSCAHPVRTATVVPVPL* |
Ga0081538_102919031 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MTDPVRVGELVPGVLGEVVDRAGHGYERWAELVAQAGYCHHPIRL |
Ga0075417_100447604 | 3300006049 | Populus Rhizosphere | MTDPVRVGELLPGVLAEVVDRAGHGYERWAEQVAATGYCTHPVRLRG |
Ga0075427_100331811 | 3300006194 | Populus Rhizosphere | MTEPTRVGEVLPGVLAEVIERAGRGYDRWAELVAQAGYCHHPIRLA |
Ga0075422_103106782 | 3300006196 | Populus Rhizosphere | MTEPTRVGEVLPGVLAEVIERAGRGYDRWAELVAQ |
Ga0075430_1005278821 | 3300006846 | Populus Rhizosphere | MSEPVQVGELLPGVLQEVIERAGPGYERWAEQVAA |
Ga0075430_1016642131 | 3300006846 | Populus Rhizosphere | MTDPVRVSELLPGVLGEVVDRAGHGYERWAELVAQAGYC |
Ga0075420_1001095764 | 3300006853 | Populus Rhizosphere | MTDPVRVGELLPSVLGEVVDRAGAGYERWMELVAQAGYCHHPIRLA |
Ga0075424_1001846331 | 3300006904 | Populus Rhizosphere | MTEPVLVGELLPGVLQEVIDRAGPGYDRWAEQVAATGYCAHPVRLRAGSSTPTLRPG |
Ga0075424_1007327871 | 3300006904 | Populus Rhizosphere | MTDPSRVGELLPGVLAEVVDRAGHGYQRWVELVAQAGYCHHPIRLA |
Ga0075419_102501621 | 3300006969 | Populus Rhizosphere | MTDPVRVGELLPGVLAEVVDRAGHGYARWAEQVAATGYCAH |
Ga0075418_108337702 | 3300009100 | Populus Rhizosphere | MTEPVRVGALLPGVLGELVDRAGDGYGRWMELVAQAGYC |
Ga0114129_102836994 | 3300009147 | Populus Rhizosphere | MTEPVPVGELLPAVVAEAIERAGPGYDRWAEQVAATG* |
Ga0114129_125440471 | 3300009147 | Populus Rhizosphere | MSEPALVGELLPGVLQEVIARAGPGYDRWAEQVAATGYCAHP |
Ga0111538_122594672 | 3300009156 | Populus Rhizosphere | MTEPVRVGELLPGVLGEVVERAGHGYARWAELVAQA |
Ga0075423_101465715 | 3300009162 | Populus Rhizosphere | MTEPVLVGELLPGVLQEVIDRAGPGYDRWAEQVAATGYCAHPVRLRAGSSTPTLRPGRSARS |
Ga0126307_105374801 | 3300009789 | Serpentine Soil | MTDPVRVGELLPAVVAELVDRAGHGYDRWAELVAQA |
Ga0126307_106191192 | 3300009789 | Serpentine Soil | MSEPTQVGEVLPGVLAEVVDRAGHGYDRWAELVA* |
Ga0105076_11008642 | 3300009816 | Groundwater Sand | MSDPVQVGELLPDVLQEVVQRAGHGYDRWAELVAQAGYCH |
Ga0126313_100188447 | 3300009840 | Serpentine Soil | MTEPSLVGELLPGVLQEVIDRAGPSYERWAEQVAATGY |
Ga0126313_111008241 | 3300009840 | Serpentine Soil | MSEPMPVGAVLPGVLAEVVDRAGAGYDRWMELVAQAGYCHHPIR |
Ga0126313_112626992 | 3300009840 | Serpentine Soil | MNEPARVGELLPGVLGELVERAGHGYDRWAELVAQAGY |
Ga0126313_113223931 | 3300009840 | Serpentine Soil | MSEPVRVGELLPGVLGEVVDRAGPGYARWMELVAQAG |
Ga0126313_114559471 | 3300009840 | Serpentine Soil | MTDPVLVGDVLPGVVAEAIARAGPGYDRWAEQVAATGYCVHPVRLRGTV |
Ga0126312_114939662 | 3300010041 | Serpentine Soil | MTDPVRVGELLPGVLTEVVDRAGNGYERWAEQVAATGYCA |
Ga0126314_103495312 | 3300010042 | Serpentine Soil | VTGPVRVGELVPGVLGEVVERAGHGYDRWAELVAQAG* |
Ga0126314_103820151 | 3300010042 | Serpentine Soil | MTEPVLVGEVLPGVVAEAIARAGPGYDRWMEQVAATGY |
Ga0126314_104503573 | 3300010042 | Serpentine Soil | MTEPVRVGEVLPEVVAEAIARAGPGYDRWMEQVAQTG |
Ga0126314_110402741 | 3300010042 | Serpentine Soil | MSQPVQVGELLPGVVAEAIARAGPGYDRWAEQVAATGYCAHP |
Ga0126314_111280692 | 3300010042 | Serpentine Soil | MTEPVRVGEVLPEVVAEAIARAGPGYDRWMEQVAQTGY |
Ga0126310_110685602 | 3300010044 | Serpentine Soil | MTEPTRVGDVLPAVLAEVVDRAGAGYERWMELVAQ |
Ga0126310_113089471 | 3300010044 | Serpentine Soil | MTEPERVGELLPGVLGEVVDRAGHGYQRWAELVAQAGYCHHPIR |
Ga0126306_108017972 | 3300010166 | Serpentine Soil | MRVGDVLPEVLAEVVDRAGHGYDRWRELVAQAGYCHHPI |
Ga0126306_111831651 | 3300010166 | Serpentine Soil | MIEPVRVGELLPGVLDEVVDRAGHGYQRWAELVAQAGYCHHPIRL |
Ga0184608_101129633 | 3300018028 | Groundwater Sediment | MTGPVRVGEVLPEVVAEAIARAGPDYDRWMELVAQKGYCAHPVRL |
Ga0184617_10971052 | 3300018066 | Groundwater Sediment | MSEPARVGELLPGVPGEVVERAGHGYERWAELVAQAGYCHHP |
Ga0184625_101876893 | 3300018081 | Groundwater Sediment | VTEPVRVGELLPGVIGEVVDRAGHGYDRWMELVAQAGYCHHPIRL |
Ga0184625_102034842 | 3300018081 | Groundwater Sediment | MTEPVRVGELLPDVLGELVERAGHGYERWAELVAQAGYCH |
Ga0190268_117535861 | 3300018466 | Soil | MSEPMAVGELLPGVLQEVIDRAGAGYERWAEQVAATGYCAHPVRLRGR |
Ga0193739_11743512 | 3300020003 | Soil | MTEPIQVGELLPGVVAEAIARAGPGYDRWMEQVAATGYCTHPVRLRG |
Ga0209574_103634162 | 3300027809 | Agave | VSEPVRVGELLPGVVGELVERAGHGYERWAELVAQAGYCHHP |
Ga0207428_101942101 | 3300027907 | Populus Rhizosphere | MTEPVRVGELLPGVLAEVVDRAGHGYSRWAELVAQAGYC |
Ga0209382_115738591 | 3300027909 | Populus Rhizosphere | MSEPVLVGELLPGVLQEVIERAGPGYERWAEQVAATGYCAH |
Ga0247818_103917341 | 3300028589 | Soil | MTEPTRVGELLPGVLGEVIDRAGHGYERWATSSAHRS |
Ga0247821_103455221 | 3300028596 | Soil | MTEPVRVGELLPGVLGEVVDRAGHGYDRWAELVAQA |
Ga0307291_10040041 | 3300028707 | Soil | MSEPARVGELLPGVLGEVVDRAGHGYDRWAELVAQAGYC |
Ga0307295_101141892 | 3300028708 | Soil | MTDPVRVGELLPGVLAEVVDRAGHSYDRWAEQVAATGYCTH |
Ga0307301_101540831 | 3300028719 | Soil | VTDPARVGELLPGVLGEVVDRAGQGYDRWAELVAQAGYC |
Ga0307301_103046311 | 3300028719 | Soil | MSDPVRVGELVPGVLGEVVERAGHGYDRWAELVAQAGYCH |
Ga0307315_103120421 | 3300028721 | Soil | MTDPVRVGELLPGVLAEVVDRAGHSYDRWAEQVAATGYCTHP |
Ga0307319_101446242 | 3300028722 | Soil | MIEPVRVGEVLPGVLAEVVERAGRGYDRWAELVAQAGY |
Ga0307319_102056462 | 3300028722 | Soil | MTEPVRVGELLPDVLGELVERAGHGYERWAELVAQAGYCHHPIRLAG |
Ga0307318_102344901 | 3300028744 | Soil | MEPIQVGELLPGVLQEVIDRAGPGYERWAEQVAATGYCAHPVRLR |
Ga0307297_103063542 | 3300028754 | Soil | VTEPTRVGELLPGVLGEVVDRAGHGYDRWAELVAQA |
Ga0307320_101504401 | 3300028771 | Soil | MTDPVRVGELLPGVLAEVVDRAGHGYDRWAEQVAATGYCTHPVRLRG |
Ga0307290_102652231 | 3300028791 | Soil | MSEPVGVGELLPGVLGEVVDRAGPGYDRWMELVAQ |
Ga0307287_100778322 | 3300028796 | Soil | MTDPVRVGELLPGVLAEVVDRAGHSYDRWAEQVAATGY |
Ga0307287_100898431 | 3300028796 | Soil | MTEPVQVGELLPGVLGEVVERAGHGYERWAELVAQAGY |
Ga0307287_101102302 | 3300028796 | Soil | MTEPVRVGELLPGVLGEVVDRAGHGYDRWAELVAQAGYCHHPIRLA |
Ga0307284_102525682 | 3300028799 | Soil | MTDPVRVGELLPGVLAEVVDRAGHSYDRWAEQVAATG |
Ga0307305_105410962 | 3300028807 | Soil | MTEPTRVGELVLGVLGEVVERAGHGYERWAELVAQAGYCHHPIR |
Ga0307294_102849041 | 3300028810 | Soil | MTDPVGVGELLPGVLAEVVDRAGHGYQRWAELVAQAGY |
Ga0307302_100228984 | 3300028814 | Soil | MSEPVLVGELLPEVVAEAIARAGPGYDRWMEQVTAT |
Ga0307310_106616621 | 3300028824 | Soil | VTEPTRVGELLPGVLGEVVDRAGHGYDRWAELVAQAGYCHHPIRLAG |
Ga0307300_101917052 | 3300028880 | Soil | MSEPARVGELLPGVPGEVVERAGHGYERWAELVAQA |
Ga0307277_104154141 | 3300028881 | Soil | MTEPVRVGELLPGVLGEVVDRAGHGYERWAELVAQVGYCH |
Ga0307304_102390272 | 3300028885 | Soil | MTDPVRVGELLPGVLAEVVDRAGHGYDRWAEQVAATGYCTHPVGLRG |
Ga0247827_109567171 | 3300028889 | Soil | VTEPVRVGELLPGVIGEVVDRAGHGYERWTELVAQAGYCHHPI |
Ga0268259_101028881 | 3300030499 | Agave | MTEPIRVGEALPGVLAEVVDRAGHGYERWAELVAQAG |
Ga0268259_101951122 | 3300030499 | Agave | VSEPIQVGELLPGVLQEVIDRAGPDYDRWAEQVAATGYCAHPVR |
Ga0268253_102653111 | 3300030514 | Agave | VSEPVRVGELLPGVVGELVERAGHGYERWAELVAQAGYCHHPIRL |
Ga0307408_1020397041 | 3300031548 | Rhizosphere | MTEPVRVGELLPGVLGELVDRAGHGYERWAELVAQAG |
Ga0307405_102365301 | 3300031731 | Rhizosphere | VTEPVQVGELLPGVLGEVVDRAGHGYERWAELVAQAGYCHHP |
Ga0307405_103977291 | 3300031731 | Rhizosphere | MTEPARVGEMLPGVLAEVVDRAGHGYDRWAELVAQAGYCHH |
Ga0307405_113359662 | 3300031731 | Rhizosphere | MSQPVQVGELLPEVLAEVIQRAGNRYDRWAEQVAAT |
Ga0307413_104949601 | 3300031824 | Rhizosphere | MSEPMPVGAVLPGVLAEVVDRAGAGYDRWMELVAQAGFCHHPIR |
Ga0307413_108774671 | 3300031824 | Rhizosphere | VTEPVQVGELLPGVLGEVVDRAGVGYDRWAELVAQAGYCHHPI |
Ga0307413_116081261 | 3300031824 | Rhizosphere | MTEPVLVGDVLPGVVAEAIARAGPGYDRWAEQVAATGYCVH |
Ga0307413_121179561 | 3300031824 | Rhizosphere | MTDPVRVGELLPDVLAEVIDRAGHGYERWAELVAQAGYCH |
Ga0307410_104035081 | 3300031852 | Rhizosphere | MSEPIQVGELVPGVLGELVDRAGAGYARWAELVAQAGYCHHPIRLA |
Ga0307406_105629092 | 3300031901 | Rhizosphere | MTEPSLVGELLPGVLQEVIDRAGPSYERWAEQVAATGYCAH |
Ga0307406_117018321 | 3300031901 | Rhizosphere | MTEPARVGELLPEVLQEVVQRAGHGYDRWAELVAQAGYCHH |
Ga0307407_101046911 | 3300031903 | Rhizosphere | MTEPVLVGDVLPGVVAEAIARAGPGYDRWAEQVAATGY |
Ga0307407_102033303 | 3300031903 | Rhizosphere | MSEPALVAELLPGVLQEVIDRAGPGYERWAEQVAATGYCTHPVR |
Ga0307407_107391143 | 3300031903 | Rhizosphere | MTDPTRVGELLPSVLGEVVERAGHGYERWAELVAQAGY |
Ga0307407_117001331 | 3300031903 | Rhizosphere | MTDPVLIGELLPEVVAEAIARAGPGYDRWAEQVAATG |
Ga0308175_1028324882 | 3300031938 | Soil | MSEPARVGEVVPGVLAEVIGRAGHGYARWAELVAQAGY |
Ga0307409_1002058593 | 3300031995 | Rhizosphere | MSEPAQVGDVLPGVLAEVIDRAGHGYARWAELVAQA |
Ga0307409_1012389971 | 3300031995 | Rhizosphere | MTDPARVGDVLPGVLAEVVDRAGHGYDRWAELVAQAG |
Ga0307416_1002249243 | 3300032002 | Rhizosphere | MSEPARVGELLPGVLGEVVDRAGHGYERWAELVAQAGYCHHPI |
Ga0307416_1006064981 | 3300032002 | Rhizosphere | MTDPVRVGELLPGVLAEVVDRAGHGYERWAELVAQAGYCHHPIRLA |
Ga0307416_1008631821 | 3300032002 | Rhizosphere | MTEPVRVGELLPGVVAELVERAEHGYDRWAELVAQAGYCHHPIR |
Ga0307416_1013969112 | 3300032002 | Rhizosphere | MSQPVQVGELLPGVVAEAIARAGPGYDRWAEQVAATGY |
Ga0307416_1015065532 | 3300032002 | Rhizosphere | MTQPTRVGELLPGVLGEVVDRAGHGYQRWAELVAQAGYCHHPIR |
Ga0307416_1028052941 | 3300032002 | Rhizosphere | VSGPVLVGELLPKVLAEVVQRGGPGYGRWAELVAQAGYCHHPI |
Ga0307416_1028056121 | 3300032002 | Rhizosphere | MTEPVRVGEVLPEVIAEAIARAGPGYARWMELVAQTGYCTH |
Ga0307416_1033647942 | 3300032002 | Rhizosphere | VTEPTRVRELLPGVLEEVVDRAAHSYDRWAELVAQ |
Ga0307415_1000806214 | 3300032126 | Rhizosphere | MSEPAQVGDVLPGVLAEVIDRAGHGYARWADLVAQAG |
Ga0307415_1012543861 | 3300032126 | Rhizosphere | MSDPALVGDVLPGVVAEAIARAGPGYDRWMEQVAATGYCTH |
Ga0307415_1018165482 | 3300032126 | Rhizosphere | MSEPVAVGELLPGVLQEVIDRAGPGYDRWAEQVAATG |
Ga0307415_1021964471 | 3300032126 | Rhizosphere | VTGPVRVGELLPGVVAELVERAGHGYDRWAELVAQAGYCHHPIRLAG |
Ga0268251_102708661 | 3300032159 | Agave | MSAPALVAELLPGVLQEVIDRAGPGYDRWAEQIAAT |
Ga0247829_103728342 | 3300033550 | Soil | MNEPTRVGDVLPGVLAEVVDRAGRGYDRWAALALPS |
Ga0334913_063829_671_775 | 3300034172 | Sub-Biocrust Soil | MTEPTRVGELLPGVLQEVIDRAGPGYDRWAEQVAA |
Ga0334932_015393_2_139 | 3300034174 | Sub-Biocrust Soil | VREPIQVGELLPGVLQEVIDRAGPGYEQWAEQVAATGYCAHPVRLR |
Ga0334932_051131_2_112 | 3300034174 | Sub-Biocrust Soil | MTDPVRVGELLPGVLAEVVDRAGYGYDRWAELVAQAG |
⦗Top⦘ |