| Basic Information | |
|---|---|
| Family ID | F089131 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MLCEQCHTLMIERPVTREMEDAHHEQAIVLECPQCGHTEYQPVIASFWRRLAA |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 58.72 % |
| % of genes near scaffold ends (potentially truncated) | 33.03 % |
| % of genes from short scaffolds (< 2000 bps) | 74.31 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.725 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.431 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.936 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.706 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.64% β-sheet: 18.52% Coil/Unstructured: 72.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF04945 | YHS | 33.03 |
| PF00072 | Response_reg | 6.42 |
| PF00076 | RRM_1 | 3.67 |
| PF00196 | GerE | 1.83 |
| PF12732 | YtxH | 1.83 |
| PF00561 | Abhydrolase_1 | 0.92 |
| PF00702 | Hydrolase | 0.92 |
| PF13628 | DUF4142 | 0.92 |
| PF03641 | Lysine_decarbox | 0.92 |
| PF07366 | SnoaL | 0.92 |
| PF12710 | HAD | 0.92 |
| PF02148 | zf-UBP | 0.92 |
| PF13442 | Cytochrome_CBB3 | 0.92 |
| PF00753 | Lactamase_B | 0.92 |
| PF04679 | DNA_ligase_A_C | 0.92 |
| PF07719 | TPR_2 | 0.92 |
| PF11345 | DUF3147 | 0.92 |
| PF13414 | TPR_11 | 0.92 |
| PF00128 | Alpha-amylase | 0.92 |
| PF07992 | Pyr_redox_2 | 0.92 |
| PF00582 | Usp | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.92 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.92 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.92 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.92 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.92 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.92 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.72 % |
| Unclassified | root | N/A | 30.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01DEKRL | Not Available | 581 | Open in IMG/M |
| 3300000559|F14TC_101573446 | All Organisms → cellular organisms → Bacteria | 3526 | Open in IMG/M |
| 3300000787|JGI11643J11755_11659686 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300000787|JGI11643J11755_11660137 | Not Available | 1173 | Open in IMG/M |
| 3300000881|JGI10215J12807_1098848 | All Organisms → cellular organisms → Bacteria | 3741 | Open in IMG/M |
| 3300000891|JGI10214J12806_10481860 | All Organisms → cellular organisms → Bacteria | 3694 | Open in IMG/M |
| 3300000953|JGI11615J12901_11993581 | Not Available | 764 | Open in IMG/M |
| 3300001989|JGI24739J22299_10036119 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1671 | Open in IMG/M |
| 3300001990|JGI24737J22298_10058282 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1165 | Open in IMG/M |
| 3300003319|soilL2_10025278 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300003321|soilH1_10209202 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2039 | Open in IMG/M |
| 3300003347|JGI26128J50194_1002911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1128 | Open in IMG/M |
| 3300003383|JGI26140J50224_100462 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1784 | Open in IMG/M |
| 3300004156|Ga0062589_100021568 | All Organisms → cellular organisms → Bacteria | 3062 | Open in IMG/M |
| 3300004156|Ga0062589_102830086 | Not Available | 506 | Open in IMG/M |
| 3300004479|Ga0062595_100200291 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1234 | Open in IMG/M |
| 3300004633|Ga0066395_10332770 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300004643|Ga0062591_100159065 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300004643|Ga0062591_101203522 | Not Available | 738 | Open in IMG/M |
| 3300005168|Ga0066809_10205027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300005328|Ga0070676_10148072 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1500 | Open in IMG/M |
| 3300005332|Ga0066388_100082164 | All Organisms → cellular organisms → Bacteria | 3600 | Open in IMG/M |
| 3300005332|Ga0066388_100359025 | Not Available | 2104 | Open in IMG/M |
| 3300005335|Ga0070666_11512066 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 502 | Open in IMG/M |
| 3300005337|Ga0070682_100205461 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1392 | Open in IMG/M |
| 3300005340|Ga0070689_100005649 | All Organisms → cellular organisms → Bacteria | 8569 | Open in IMG/M |
| 3300005340|Ga0070689_100560710 | Not Available | 985 | Open in IMG/M |
| 3300005340|Ga0070689_101839769 | Not Available | 552 | Open in IMG/M |
| 3300005439|Ga0070711_100576595 | Not Available | 936 | Open in IMG/M |
| 3300005713|Ga0066905_100052723 | All Organisms → cellular organisms → Bacteria | 2502 | Open in IMG/M |
| 3300005718|Ga0068866_10305765 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 995 | Open in IMG/M |
| 3300005764|Ga0066903_100333720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2434 | Open in IMG/M |
| 3300005937|Ga0081455_10000923 | All Organisms → cellular organisms → Bacteria | 37627 | Open in IMG/M |
| 3300006196|Ga0075422_10236329 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300006237|Ga0097621_101670449 | Not Available | 606 | Open in IMG/M |
| 3300006844|Ga0075428_100223560 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 2033 | Open in IMG/M |
| 3300006845|Ga0075421_100016985 | All Organisms → cellular organisms → Bacteria | 9101 | Open in IMG/M |
| 3300006846|Ga0075430_100355335 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira japonica | 1210 | Open in IMG/M |
| 3300006852|Ga0075433_10431821 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300006871|Ga0075434_100902038 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300006871|Ga0075434_102271861 | Not Available | 546 | Open in IMG/M |
| 3300006894|Ga0079215_10741849 | Not Available | 673 | Open in IMG/M |
| 3300006894|Ga0079215_11578261 | Not Available | 521 | Open in IMG/M |
| 3300006903|Ga0075426_10045984 | All Organisms → cellular organisms → Bacteria | 3119 | Open in IMG/M |
| 3300006904|Ga0075424_100718370 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300006904|Ga0075424_101409611 | Not Available | 740 | Open in IMG/M |
| 3300006954|Ga0079219_10661155 | Not Available | 783 | Open in IMG/M |
| 3300006954|Ga0079219_11088931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300007004|Ga0079218_10091354 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira japonica | 2059 | Open in IMG/M |
| 3300009094|Ga0111539_10867471 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300009100|Ga0075418_10951996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
| 3300009147|Ga0114129_10007602 | All Organisms → cellular organisms → Bacteria | 15425 | Open in IMG/M |
| 3300009147|Ga0114129_10129538 | All Organisms → cellular organisms → Bacteria | 3467 | Open in IMG/M |
| 3300009147|Ga0114129_12196608 | Not Available | 664 | Open in IMG/M |
| 3300009156|Ga0111538_13569271 | Not Available | 539 | Open in IMG/M |
| 3300009800|Ga0105069_1007428 | Not Available | 874 | Open in IMG/M |
| 3300010043|Ga0126380_10066590 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → unclassified Nitrospirales → Nitrospirales bacterium | 2023 | Open in IMG/M |
| 3300010046|Ga0126384_10049074 | All Organisms → cellular organisms → Bacteria | 2901 | Open in IMG/M |
| 3300010046|Ga0126384_10055274 | All Organisms → cellular organisms → Bacteria | 2758 | Open in IMG/M |
| 3300010358|Ga0126370_10123096 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300010358|Ga0126370_11578773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300010359|Ga0126376_12636369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium | 551 | Open in IMG/M |
| 3300010362|Ga0126377_10059426 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 3361 | Open in IMG/M |
| 3300010362|Ga0126377_10690877 | Not Available | 1072 | Open in IMG/M |
| 3300012884|Ga0157300_1071203 | Not Available | 590 | Open in IMG/M |
| 3300012896|Ga0157303_10011169 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300012916|Ga0157310_10000063 | All Organisms → cellular organisms → Bacteria | 12846 | Open in IMG/M |
| 3300012941|Ga0162652_100104855 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012948|Ga0126375_10330330 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → unclassified Nitrospirales → Nitrospirales bacterium | 1072 | Open in IMG/M |
| 3300012951|Ga0164300_10051964 | Not Available | 1624 | Open in IMG/M |
| 3300012957|Ga0164303_10299332 | Not Available | 947 | Open in IMG/M |
| 3300012958|Ga0164299_10205647 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300012958|Ga0164299_11523807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300012960|Ga0164301_10054499 | Not Available | 2081 | Open in IMG/M |
| 3300012961|Ga0164302_10071937 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300012986|Ga0164304_10351876 | Not Available | 1029 | Open in IMG/M |
| 3300012987|Ga0164307_10486081 | Not Available | 930 | Open in IMG/M |
| 3300012987|Ga0164307_11618298 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012988|Ga0164306_10809157 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. KM1 | 755 | Open in IMG/M |
| 3300012989|Ga0164305_10830825 | Not Available | 769 | Open in IMG/M |
| 3300015371|Ga0132258_11250339 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300015373|Ga0132257_101904825 | Not Available | 765 | Open in IMG/M |
| 3300018466|Ga0190268_10072700 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira japonica | 1478 | Open in IMG/M |
| 3300019356|Ga0173481_10000065 | All Organisms → cellular organisms → Bacteria | 16094 | Open in IMG/M |
| 3300019361|Ga0173482_10000681 | All Organisms → cellular organisms → Bacteria | 6369 | Open in IMG/M |
| 3300023057|Ga0247797_1010775 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1088 | Open in IMG/M |
| 3300025907|Ga0207645_10527457 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300025915|Ga0207693_11317060 | Not Available | 540 | Open in IMG/M |
| 3300025920|Ga0207649_10454914 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 967 | Open in IMG/M |
| 3300025925|Ga0207650_10495053 | Not Available | 1021 | Open in IMG/M |
| 3300025940|Ga0207691_10198033 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1749 | Open in IMG/M |
| 3300026118|Ga0207675_100199092 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300027526|Ga0209968_1002366 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2854 | Open in IMG/M |
| 3300028380|Ga0268265_10784850 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300028587|Ga0247828_10666082 | Not Available | 643 | Open in IMG/M |
| 3300031538|Ga0310888_10193037 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300031547|Ga0310887_10086693 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1516 | Open in IMG/M |
| 3300031548|Ga0307408_100080105 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300031548|Ga0307408_100340717 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300031548|Ga0307408_100639092 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira japonica | 950 | Open in IMG/M |
| 3300031562|Ga0310886_10697803 | Not Available | 631 | Open in IMG/M |
| 3300031716|Ga0310813_10011430 | All Organisms → cellular organisms → Bacteria | 5752 | Open in IMG/M |
| 3300031716|Ga0310813_10794763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
| 3300031847|Ga0310907_10219296 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 919 | Open in IMG/M |
| 3300031903|Ga0307407_11675430 | Not Available | 506 | Open in IMG/M |
| 3300031913|Ga0310891_10113130 | Not Available | 847 | Open in IMG/M |
| 3300031940|Ga0310901_10108544 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1013 | Open in IMG/M |
| 3300032013|Ga0310906_10192527 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira japonica | 1230 | Open in IMG/M |
| 3300032174|Ga0307470_10909326 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.59% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.75% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.92% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.92% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.92% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.92% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Host-Associated | Open in IMG/M |
| 3300003383 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM | Host-Associated | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009800 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_03261910 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MLCEQCHTLMIERPVTRKMEDNQDEQAIVLECPQCGQTEYQPVIASFWRRLAA |
| F14TC_1015734465 | 3300000559 | Soil | MLCEQCHTLMIERPITREMEDAHDEKAIVLECPQCGHTEYQPVIASFWRRLAA* |
| JGI11643J11755_116596863 | 3300000787 | Soil | MLCEQCHTLMIERPVTRKMEDNHDEQAIVLECPQCGQTEYQPVIASFWRRL |
| JGI11643J11755_116601371 | 3300000787 | Soil | MLCEQCHTLMIERPVTRKMEDNQDEQAIVLECPQCGQTEYQPVIASFWRRL |
| JGI10215J12807_10988481 | 3300000881 | Soil | EGAMLCEQCHTLMIERPVTRKTEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA* |
| JGI10214J12806_104818601 | 3300000891 | Soil | PVTRKTEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA* |
| JGI11615J12901_119935812 | 3300000953 | Soil | MIERPVTRKMEDNHDEQAIVLECPKCGQTEYQPVIASFWRRLAA* |
| JGI24739J22299_100361191 | 3300001989 | Corn Rhizosphere | RKTEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA* |
| JGI24737J22298_100582821 | 3300001990 | Corn Rhizosphere | GAMLCEQCHTLMIERPVTRKTEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA* |
| soilL2_100252781 | 3300003319 | Sugarcane Root And Bulk Soil | IERPPTREVEDVDNEKLIVLQCPQCGRTESQPVIASFWRRLAA* |
| soilH1_102092021 | 3300003321 | Sugarcane Root And Bulk Soil | LRKKAAMICEQCDALMLEKLPTRQREEAGEEKAILFECPQCGHTEYQRLIASFWRRLAA* |
| JGI26128J50194_10029111 | 3300003347 | Arabidopsis Thaliana Rhizosphere | MLCEQCHTLMIERPVTRKTEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA* |
| JGI26140J50224_1004626 | 3300003383 | Arabidopsis Thaliana Rhizosphere | MLCEQCHTLMXERPVTRKTEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA* |
| Ga0062589_1000215683 | 3300004156 | Soil | MICEQCHAPMMEKPAIRQREDADEEQVIVLECRQCGHTEERPLIASFWRRLAA* |
| Ga0062589_1028300861 | 3300004156 | Soil | IERPATRQMEDGGEEQVIVLECRQCGYTEDRPLIASFWRRLAA* |
| Ga0062595_1002002913 | 3300004479 | Soil | MLCEQCHTLMIERPVTRKMEDNQDEQAIVLECPQCGQTEYQPVIASFWRRLAA* |
| Ga0066395_103327702 | 3300004633 | Tropical Forest Soil | MRCEKCHALMIERPHIGHKEENDKEQAIVFECPKCGHIEYQPLITSFWRRLAA* |
| Ga0062591_1001590651 | 3300004643 | Soil | MIEKLPPQDREDAHEEQAIALECPQCGHTEYQPLITSFWRRLAA* |
| Ga0062591_1012035221 | 3300004643 | Soil | MLCEQCHTLMIERPVTRKMEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA* |
| Ga0066809_102050272 | 3300005168 | Soil | MLCEQCHTLMIERPVTREMEDAHHEQAIVLECPQCGRTEYQPVIASFWRRLAA* |
| Ga0070676_101480722 | 3300005328 | Miscanthus Rhizosphere | MRCERCHAQMIEKLPPQDREDAHEEQAIVLECPQCGHTEYQPLITSFWRRLAA* |
| Ga0066388_1000821642 | 3300005332 | Tropical Forest Soil | MRCEKCHALMIEKPHIGHEEETDKEQAIVFECPKCGHTEYQPLITSFWRRLAA* |
| Ga0066388_1003590251 | 3300005332 | Tropical Forest Soil | MRCEKCHALMIERPHIGHKEENDKEQAIVFECPKCGHIEYQPLIRSFWRRLAA* |
| Ga0070666_115120661 | 3300005335 | Switchgrass Rhizosphere | MIEKLPPQDREDAHEEQAIVLECPQCGHTEYQPLITSFWRRLAA* |
| Ga0070682_1002054611 | 3300005337 | Corn Rhizosphere | CEQCHAPMIERPATRQMEDGGEEQVIVLECRQCGYTEDRPLIASFWRRLAA* |
| Ga0070689_1000056497 | 3300005340 | Switchgrass Rhizosphere | MLCEQCHTLMIERPVTLKTEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA* |
| Ga0070689_1005607102 | 3300005340 | Switchgrass Rhizosphere | MICEQCHAPMMEKPATRQREDSDEEQVIVLECRQCGHTEERPLIASFWRRLAA* |
| Ga0070689_1018397691 | 3300005340 | Switchgrass Rhizosphere | MICEQCHAPMIERPATRQMEDGGEEQVIVLECRQCGYTEDRPLIASFWRRLAA* |
| Ga0070711_1005765952 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLCEQCHALMIERPVTREMEDTDNKQAIVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0066905_1000527233 | 3300005713 | Tropical Forest Soil | MRCEKCHALMIEKPHIGHEEETDKEQAIVFECSKCGHTEYQPLITSFWRRLAA* |
| Ga0068866_103057653 | 3300005718 | Miscanthus Rhizosphere | RPVTRKTEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA* |
| Ga0066903_1003337205 | 3300005764 | Tropical Forest Soil | MRCEKCHALMIERPHVGHEEGTDKEQAIVFECPKCGHTEYQPLITSFWRRLAA* |
| Ga0081455_1000092336 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRCEKCQALMIERPPIQKMEDPDEEQAIVLECPQCGHTEYQPLITSFWRRLAA* |
| Ga0075422_102363292 | 3300006196 | Populus Rhizosphere | MRCEQCHAEMIERPQMKDIDEERAIVLECPKCGHTEYQPLITSFWRKWGLH* |
| Ga0097621_1016704492 | 3300006237 | Miscanthus Rhizosphere | MVGLPISMEAAMRCEQCHAELIERPLIRQMKHTDEERAIVLECQKCGHTEYQPLITSFWRRLAA* |
| Ga0075428_1002235601 | 3300006844 | Populus Rhizosphere | MTCEQCHAIMIERCPAPENEAADGEQAIVLECPQCGHTEH |
| Ga0075421_1000169856 | 3300006845 | Populus Rhizosphere | MTCEQCHAIMIERCPAPENEAADGEQAIVLECPQCGHTEHQPLITSFWRRLAA* |
| Ga0075430_1003553352 | 3300006846 | Populus Rhizosphere | MMCEQCHVLMIERLPARENQGSDKEQAVVLECPQCGHTEYQPLITSFWRRLAA* |
| Ga0075433_104318213 | 3300006852 | Populus Rhizosphere | MLCEQCHTLMIERPVTRKMEDNHDEQAIVLECPQCGQTEYQPVISSFWRRLAA* |
| Ga0075434_1009020381 | 3300006871 | Populus Rhizosphere | LISREGAMLCEQCHTLMIERPITREMEGAHDEKAIVLECPQCGHTEYQPVIASFWRRLAA |
| Ga0075434_1022718612 | 3300006871 | Populus Rhizosphere | MEAAMICEKCHGLMIERPLIRGMDDAEEKQAVIAKCIECGHIEYQPIVASFWRRLAA* |
| Ga0079215_107418491 | 3300006894 | Agricultural Soil | MMCEQCHALMIERLPARENEDSNKEQAVVLECTRCGHTEYQPLITSFWRRLAA* |
| Ga0079215_115782611 | 3300006894 | Agricultural Soil | MMCEQCHAFMIERLPARENEEANNKQAIVLECPQCGHTEYQPLITSFWRRLAA* |
| Ga0075426_100459845 | 3300006903 | Populus Rhizosphere | MLCEQCHTLMIERPVTREMEDNHNEQAIVLECPQCGQTEYQPVIASFWR |
| Ga0075424_1007183703 | 3300006904 | Populus Rhizosphere | MLCEQCHTLMIERPITREMEGAHDEKAIVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0075424_1014096112 | 3300006904 | Populus Rhizosphere | AGVSLFRLKSFIKREAIMLCEQCHALMIERPVTREMEDADNKQAIVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0079219_106611551 | 3300006954 | Agricultural Soil | MRCEQCHALIDDASHIQYKEETDEEKAIVFQCPQCGHTEYQPLIESFWRRLAA* |
| Ga0079219_110889313 | 3300006954 | Agricultural Soil | MLCEQCHTLMIERPVTRKMEDNHDEQAIVLECPKCGQTEYQPVIASFWRRLAA* |
| Ga0079218_100913543 | 3300007004 | Agricultural Soil | MCEQCHALMIERLPARENEDSNKEQAVVLECTRCGHTEYQPLITSFWRRLAA* |
| Ga0111539_108674711 | 3300009094 | Populus Rhizosphere | MIERPVTREMEDNHNEQAIVLECPQCGQTEYQPVIASFWRRL |
| Ga0075418_109519962 | 3300009100 | Populus Rhizosphere | MIERPVTREMEDNHNEQAIVLECPQCGQTEYQPVIASFWRRLAA* |
| Ga0114129_100076023 | 3300009147 | Populus Rhizosphere | MICEQCHVQMIERVPSREMDDADEGQVILLECSQCGRTEYQALITSFWRRLAA* |
| Ga0114129_101295385 | 3300009147 | Populus Rhizosphere | MICEQCHALMIERPPIRQIEDADEEQAIVLECPQCGHSEYQPLIVSFWRRLAA* |
| Ga0114129_121966081 | 3300009147 | Populus Rhizosphere | LPSMVGLPIYMEAAMRCEQCHAEMIERPQMKDIDEERAIVLECPKCGHTEYQPLITSFWRKWGLH* |
| Ga0111538_135692711 | 3300009156 | Populus Rhizosphere | EMEGAHDEKAIVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0105069_10074281 | 3300009800 | Groundwater Sand | MIERPVTREMEDAHDEQAIVLECPQCGQTEYQPVI |
| Ga0126380_100665906 | 3300010043 | Tropical Forest Soil | MIEKPHIGHEEETDKEQAIVFECSKCGHTEYQPLITSFWRRLAA* |
| Ga0126384_100490748 | 3300010046 | Tropical Forest Soil | MIEKPHIGYEEETDKEQAIVFECPKCGHTEYQPLITSFWRRLAA* |
| Ga0126384_100552744 | 3300010046 | Tropical Forest Soil | MKCEKCHALMIEKPHIGYDEETDKEQAIVFECSKCGHTEYQPLITSFWRRLAA* |
| Ga0126370_101230964 | 3300010358 | Tropical Forest Soil | MIEKPHIGHEEETDKEQAIVFECPKCGHTEYQPLITSFWRRLAA* |
| Ga0126370_115787733 | 3300010358 | Tropical Forest Soil | MRCEKCHALMIERPHVGHEEGTDKEQAIVFECPKCGHTEYQPLIT |
| Ga0126376_126363692 | 3300010359 | Tropical Forest Soil | MRCEQCHALIDDASHIQYKEEADEEKAIVFECPHCGHTEYQPLIASFWRRLAA* |
| Ga0126377_100594267 | 3300010362 | Tropical Forest Soil | MRCEKCHALMIEKPHIGHEEETDKERAIVFECPKCGHTEYQPLITSFWRRLAA* |
| Ga0126377_106908772 | 3300010362 | Tropical Forest Soil | ALMIEKPHIGHEEETDKEQAIVFECPKCGHTEYQPLITSFWRRLAA* |
| Ga0157300_10712031 | 3300012884 | Soil | HTLMIERPVTRKTEDNHDEQAIVLECPQCGQTEYQPVISSFWRRLAA* |
| Ga0157303_100111692 | 3300012896 | Soil | MIERPVTRKTEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA* |
| Ga0157310_1000006311 | 3300012916 | Soil | MLCEQCHTLMIERPVTRKTEDNHDEQAIVLECPQCGQTEYQPVISSFWRRLAA* |
| Ga0162652_1001048552 | 3300012941 | Soil | MIERPVTREMEDAHDEKAIVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0126375_103303304 | 3300012948 | Tropical Forest Soil | MIEKPHIGHDEEADKEQAIVFECSKCGHTEYQPLITSFWRRLAA* |
| Ga0164300_100519644 | 3300012951 | Soil | MIERPVTREMEDAHHEQAIVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0164303_102993322 | 3300012957 | Soil | MQCEKCHALMIERPVTQEMKDADDKQAIVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0164299_102056473 | 3300012958 | Soil | MQCEKCHALMIERPVTREMKDADDKQAVVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0164299_115238071 | 3300012958 | Soil | MIERPITREMEGAHDEKAIVLECPQCGHTEYQPVIASF |
| Ga0164301_100544993 | 3300012960 | Soil | MLCEQCHTLMIERPVTREMEDAHHEQAIVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0164302_100719373 | 3300012961 | Soil | MQCEKCHALMIERPVTREMKDADDKQAIVLECTQCGHTEYQPVIASFWRRLAA* |
| Ga0164304_103518761 | 3300012986 | Soil | MLCEQCHTLMIERPVTREMKDADDKQAVVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0164307_104860811 | 3300012987 | Soil | VEILISREGAMLCEQCHTLMIERPITREMEGAHDEKAIVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0164307_116182981 | 3300012987 | Soil | MIERPVTQEMKDADDKQAIVLECPQCGHTEYQPVI |
| Ga0164306_108091572 | 3300012988 | Soil | EILISREGAMLCEQCHTLMIERPITREMEGAHDEKAIVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0164305_108308251 | 3300012989 | Soil | NREGAMLCEQCHTLMIERPVTREMEDAHHEQAIVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0132258_112503393 | 3300015371 | Arabidopsis Rhizosphere | MIERPITREMEGAHDEKAIVLECPQCGHTEYQPVIASFWRRLAA* |
| Ga0132257_1019048251 | 3300015373 | Arabidopsis Rhizosphere | MICEQCHGLMIERPPILKLDDAEVEQVVVLECTECGHIQYQPLITSFWRRL |
| Ga0190268_100727001 | 3300018466 | Soil | MTCEQCHALMIERLPARENEDSDKEQAVVLECPQCGHTEHQPLITSFWRRLAA |
| Ga0173481_100000656 | 3300019356 | Soil | MLCEQCHTLMIERPVTRKTEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA |
| Ga0173482_100006817 | 3300019361 | Soil | MLCEQCHTLMIEQPVTRKMEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA |
| Ga0247797_10107751 | 3300023057 | Soil | GAMLCEQCHTLMIERPVTRKTEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA |
| Ga0207645_105274572 | 3300025907 | Miscanthus Rhizosphere | MIEKLPPQDREDAHEEQAIVLECPQCGHTEYQPLITSFWRRLAA |
| Ga0207693_113170601 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLCEQCHALMIERPVTREMEDTDNKQAIVLECPQCGHTEYQPVIAS |
| Ga0207649_104549143 | 3300025920 | Corn Rhizosphere | IERPATRQMEDGGEEQVIVLECRQCGYTEDRPLIASFWRRLAA |
| Ga0207650_104950532 | 3300025925 | Switchgrass Rhizosphere | MICEQCHAPMIERPATRQMEDGGEEQVIVLECRQCGYTEDRPLIASFWRRLAA |
| Ga0207691_101980331 | 3300025940 | Miscanthus Rhizosphere | QCHAPMIERPATRQMEDGGEEQVIVLECRQCGYTEDRPLIASFWRRLAA |
| Ga0207675_1001990923 | 3300026118 | Switchgrass Rhizosphere | MLCEQCHTLMIERPVTLKTEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA |
| Ga0209968_10023664 | 3300027526 | Arabidopsis Thaliana Rhizosphere | MLCEQCHTLMIERPVTRKTEDNHDEQAIVLECPQCGQTEYQPVISSFWRRLAA |
| Ga0268265_107848502 | 3300028380 | Switchgrass Rhizosphere | MLCEQCHTLMIERPVTRKMEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA |
| Ga0247828_106660821 | 3300028587 | Soil | KEGAMLCEQCHTLMIERPVTRKMEDNHDEQAIVLECPQCGQTEYQPVIASFWRRLAA |
| Ga0310888_101930371 | 3300031538 | Soil | MLCEQCHTLMIERPITREMEGAHDEKAIVLECPQCGHTEYQPVIASFWRRLAA |
| Ga0310887_100866935 | 3300031547 | Soil | MLCEQCHTLMIERPITREMEDAHDEKAIVLECPQCGHTEYQPVIASFWRRLAA |
| Ga0307408_1000801053 | 3300031548 | Rhizosphere | MTCEQCHALMIERLPARENQDSDKEQAVVLECPQCGHTEYQPLITSFWRRLAA |
| Ga0307408_1003407173 | 3300031548 | Rhizosphere | MIETPRIKELEGDAKRPAMVLECPRCGHTEYQPLIASFWRRLAA |
| Ga0307408_1006390922 | 3300031548 | Rhizosphere | MTCEQCHALMIERLPARENQDSDKEQAIVLECPQCGHTEYQPLITSFWRRLAA |
| Ga0310886_106978031 | 3300031562 | Soil | MIERPATRQMEDGGEEQVIVLECRQCGYTEDRPLIASFWRRLAA |
| Ga0310813_100114309 | 3300031716 | Soil | MRCEQCHALIDDSSPIQYKEEVDDEKAVIFHCPHCGHTEYQPLIASFWRRLAA |
| Ga0310813_107947632 | 3300031716 | Soil | MLCEQCHTLMIERPVTREMEDNHNEQAIVLECPQCGQTEYQPVIASFWRRLAA |
| Ga0310907_102192963 | 3300031847 | Soil | PATRQMEDGGEEQVIVLECRQCGYTEDRPLIASFWRRLAA |
| Ga0307407_116754301 | 3300031903 | Rhizosphere | MTCEQCHAFMIERLPAREDQDSDKEQAIVLECPQCGHTEYQPLITSFWRRLAA |
| Ga0310891_101131302 | 3300031913 | Soil | MIERPITREMEDAHDEKAIVLECPQCGHTEYQPVIASFWRRLAA |
| Ga0310901_101085443 | 3300031940 | Soil | ALTVEILISREGAMLCEQCHTLMIERPITREMEGAHDEKAIVLECPQCGHTEYQPVIASFWRRLAA |
| Ga0310906_101925273 | 3300032013 | Soil | MTCEQCHAIMIERCPAPENEAADGEQAIVLECPQCGHTEHQPLITSFWRRLAA |
| Ga0307470_109093262 | 3300032174 | Hardwood Forest Soil | MLCEQCHTLMIERPVTREVEDAPHEQAIVLECPQCGHTEYQPVIASFWRRLAA |
| ⦗Top⦘ |