NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F088967

Metagenome Family F088967

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088967
Family Type Metagenome
Number of Sequences 109
Average Sequence Length 50 residues
Representative Sequence YDNPYGLMAIMGVNVQLHLRAGLLLLAAYAIVLVLGAVAPSVPLFLG
Number of Associated Samples 99
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.92 %
% of genes near scaffold ends (potentially truncated) 97.25 %
% of genes from short scaffolds (< 2000 bps) 95.41 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.991 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.596 % of family members)
Environment Ontology (ENVO) Unclassified
(33.028 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.872 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 48.00%    β-sheet: 0.00%    Coil/Unstructured: 52.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF09844DUF2071 13.76
PF00012HSP70 13.76
PF02254TrkA_N 11.93
PF13560HTH_31 11.01
PF02080TrkA_C 9.17
PF00296Bac_luciferase 9.17
PF08241Methyltransf_11 1.83
PF01381HTH_3 1.83
PF01025GrpE 0.92
PF14026DUF4242 0.92
PF02386TrkH 0.92
PF12680SnoaL_2 0.92
PF02355SecD_SecF 0.92
PF00211Guanylate_cyc 0.92
PF00082Peptidase_S8 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 13.76
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 9.17
COG0168Trk-type K+ transport system, membrane componentInorganic ion transport and metabolism [P] 0.92
COG0341Preprotein translocase subunit SecFIntracellular trafficking, secretion, and vesicular transport [U] 0.92
COG0342Preprotein translocase subunit SecDIntracellular trafficking, secretion, and vesicular transport [U] 0.92
COG0576Molecular chaperone GrpE (heat shock protein HSP-70)Posttranslational modification, protein turnover, chaperones [O] 0.92
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.99 %
UnclassifiedrootN/A11.01 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725004|GPKC_F5V46DG03FRCJDAll Organisms → cellular organisms → Bacteria → Terrabacteria group503Open in IMG/M
2124908041|P3_CLC_ConsensusfromContig47864All Organisms → cellular organisms → Bacteria → Terrabacteria group1588Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_13022858All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_14031261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi752Open in IMG/M
3300000890|JGI11643J12802_11412302All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300000956|JGI10216J12902_112053708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1203Open in IMG/M
3300003987|Ga0055471_10040405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia1229Open in IMG/M
3300003996|Ga0055467_10201634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi614Open in IMG/M
3300004114|Ga0062593_100504036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1123Open in IMG/M
3300004114|Ga0062593_101980094All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300004156|Ga0062589_100796177All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300004157|Ga0062590_101459915All Organisms → cellular organisms → Bacteria → Terrabacteria group684Open in IMG/M
3300004463|Ga0063356_102658881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium769Open in IMG/M
3300004463|Ga0063356_103948423Not Available638Open in IMG/M
3300004479|Ga0062595_101043767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium708Open in IMG/M
3300004480|Ga0062592_100260589All Organisms → cellular organisms → Bacteria1280Open in IMG/M
3300005093|Ga0062594_101465424Not Available698Open in IMG/M
3300005093|Ga0062594_102752773All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005335|Ga0070666_11004034All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales619Open in IMG/M
3300005336|Ga0070680_100408988All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300005354|Ga0070675_101541837Not Available613Open in IMG/M
3300005355|Ga0070671_100662659All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300005366|Ga0070659_101581166All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005406|Ga0070703_10191246All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300005456|Ga0070678_101769959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia582Open in IMG/M
3300005467|Ga0070706_100746579All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300005518|Ga0070699_100207681All Organisms → cellular organisms → Bacteria1742Open in IMG/M
3300005536|Ga0070697_100654320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium925Open in IMG/M
3300005544|Ga0070686_100811833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi755Open in IMG/M
3300005546|Ga0070696_101075572Not Available675Open in IMG/M
3300005549|Ga0070704_101653792All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005598|Ga0066706_11181753All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005713|Ga0066905_101314358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi651Open in IMG/M
3300006046|Ga0066652_100446892All Organisms → cellular organisms → Bacteria → Terrabacteria group1189Open in IMG/M
3300006358|Ga0068871_100622877All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300006358|Ga0068871_101463555All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300006854|Ga0075425_102769835All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300006881|Ga0068865_101663656Not Available575Open in IMG/M
3300006972|Ga0075518_1132160All Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300009011|Ga0105251_10248231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium802Open in IMG/M
3300009094|Ga0111539_10688510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1190Open in IMG/M
3300009137|Ga0066709_102072607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium787Open in IMG/M
3300009147|Ga0114129_10291034All Organisms → cellular organisms → Bacteria2180Open in IMG/M
3300009176|Ga0105242_10742851All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300010029|Ga0105074_1092905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium565Open in IMG/M
3300010039|Ga0126309_10988189All Organisms → cellular organisms → Bacteria → Terrabacteria group564Open in IMG/M
3300010336|Ga0134071_10626055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi564Open in IMG/M
3300010362|Ga0126377_12729583All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300010401|Ga0134121_11520762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi685Open in IMG/M
3300010401|Ga0134121_13064689All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300011119|Ga0105246_11314459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium671Open in IMG/M
3300012045|Ga0136623_10006043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi4772Open in IMG/M
3300012501|Ga0157351_1069597All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300012684|Ga0136614_10451729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium932Open in IMG/M
3300012911|Ga0157301_10132388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium773Open in IMG/M
3300012984|Ga0164309_10821118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300012985|Ga0164308_11991508All Organisms → cellular organisms → Bacteria → Terrabacteria group541Open in IMG/M
3300014267|Ga0075313_1226907All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300014310|Ga0075331_1177257All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300014325|Ga0163163_10240002Not Available1862Open in IMG/M
3300014326|Ga0157380_10668544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1039Open in IMG/M
3300014745|Ga0157377_11324214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium564Open in IMG/M
3300014969|Ga0157376_13073621All Organisms → cellular organisms → Bacteria → Terrabacteria group505Open in IMG/M
3300015201|Ga0173478_10078691Not Available1161Open in IMG/M
3300015371|Ga0132258_13079885All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300015372|Ga0132256_100395760All Organisms → cellular organisms → Bacteria1483Open in IMG/M
3300018027|Ga0184605_10303896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi722Open in IMG/M
3300018052|Ga0184638_1075334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1236Open in IMG/M
3300018061|Ga0184619_10102425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1287Open in IMG/M
3300018429|Ga0190272_11509716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium683Open in IMG/M
3300018432|Ga0190275_10850611Not Available978Open in IMG/M
3300018432|Ga0190275_13333383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium520Open in IMG/M
3300018465|Ga0190269_11090366All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300018469|Ga0190270_12161014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi616Open in IMG/M
3300018476|Ga0190274_13902111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium505Open in IMG/M
3300019356|Ga0173481_10707094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300021080|Ga0210382_10029385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2056Open in IMG/M
3300025885|Ga0207653_10144955All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300025912|Ga0207707_11593030Not Available514Open in IMG/M
3300025931|Ga0207644_11045864Not Available686Open in IMG/M
3300025932|Ga0207690_11769262All Organisms → cellular organisms → Bacteria → Terrabacteria group516Open in IMG/M
3300025934|Ga0207686_11252701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium608Open in IMG/M
3300025938|Ga0207704_10836071All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300025945|Ga0207679_11089031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi733Open in IMG/M
3300025945|Ga0207679_11593454Not Available598Open in IMG/M
3300026032|Ga0208419_1030448All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300026067|Ga0207678_11497564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium596Open in IMG/M
3300026116|Ga0207674_11384503All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300026116|Ga0207674_11560674All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales629Open in IMG/M
3300026121|Ga0207683_11414732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium643Open in IMG/M
3300026304|Ga0209240_1201266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300026535|Ga0256867_10225523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi680Open in IMG/M
3300027577|Ga0209874_1143023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium543Open in IMG/M
3300027876|Ga0209974_10023001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia2063Open in IMG/M
3300028652|Ga0302166_10146920All Organisms → cellular organisms → Bacteria → Terrabacteria group547Open in IMG/M
3300028771|Ga0307320_10448130Not Available520Open in IMG/M
3300028784|Ga0307282_10021183All Organisms → cellular organisms → Bacteria2733Open in IMG/M
3300028796|Ga0307287_10168430All Organisms → cellular organisms → Bacteria → Proteobacteria833Open in IMG/M
3300028875|Ga0307289_10448489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium530Open in IMG/M
3300028884|Ga0307308_10429136All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300030000|Ga0311337_10344595All Organisms → cellular organisms → Bacteria → Terrabacteria group1253Open in IMG/M
3300030002|Ga0311350_12076383All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300030336|Ga0247826_11544682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium539Open in IMG/M
3300030838|Ga0311335_11034447All Organisms → cellular organisms → Bacteria → Terrabacteria group586Open in IMG/M
3300031228|Ga0299914_10675795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi874Open in IMG/M
3300032002|Ga0307416_100334984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → Thermomicrobiaceae → Thermomicrobium → Thermomicrobium roseum1523Open in IMG/M
3300032002|Ga0307416_103553429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium522Open in IMG/M
3300032180|Ga0307471_102913636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium607Open in IMG/M
3300033812|Ga0364926_018361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1237Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil7.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.59%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.75%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.75%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.75%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.83%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.83%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.83%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.92%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.92%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.92%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.92%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725004Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
2124908041Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006972Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-AEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014310Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026032Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028652Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033812Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKC_055336502067725004SoilGLMAIMGLNVQLHLRAGLLLLAAYSAVLVLGAVAPTLDLFLG
P3_CLC_024518902124908041SoilYDNPYGLMAIMGVNVQLHLRAGLLLLAAYAIVLVLGAVAPSVPLFLG
ICChiseqgaiiFebDRAFT_1302285823300000363SoilGLMAIMGVNIRLHLVAGVALVAAYLVVLVLQAVAPSVPLFVR*
ICChiseqgaiiFebDRAFT_1403126113300000363SoilNYDNPYGLMSIMAVNINVHLYAGLLLLLAYVVVLIAGAVAPSVDLFVG*
JGI11643J12802_1141230223300000890SoilGLEPNYDNPYGLMAIMGVNIQLHLAAGVALVVAYVAVLVIHAVAPGVPLFLG*
JGI10216J12902_11205370813300000956SoilPYGLMAIMGTNVQLHLIAGLLLLAGYIVVLVAGVVAPGVDLYLG*
Ga0055471_1004040533300003987Natural And Restored WetlandsYGLMAIMGVNIQLHLVAGVALVVAYLVVLVIRAVAPSVPLFVR*
Ga0055467_1020163413300003996Natural And Restored WetlandsDNPYGLMAIMGVNIQVHLVAGVALVVAYVAVLVIHAVAPGVPLFLR*
Ga0062593_10050403613300004114SoilVSRGLRPNYENPYGLMAIMGTNVQLHLRAGLLLLGAYLIVLVVGAVAPSVSLFIG*
Ga0062593_10198009413300004114SoilNYDNPYGLMAVMGVNVKVHLYAGVLLLAGYLLVLIAARLAPSVSLFLGR*
Ga0062589_10079617713300004156SoilSRGLEPNYDNPYGLMAVMGVNVKVHLYAGLLLLAGYAVVLILGAVAPSVSLFVGR*
Ga0062590_10145991523300004157SoilSRGLGPNYENPYGLMAIMGLNVQLHLRAGLLLLAAYAAVLVLGAVAPTLDLFLG*
Ga0063356_10265888113300004463Arabidopsis Thaliana RhizosphereAPNYDNPYGLMAIMGTNVQLHLMAGLLLLAGYVVVLVAGVVAPGVDLFLG*
Ga0063356_10394842313300004463Arabidopsis Thaliana RhizosphereNPYALMSVMATNINLHAAAGVLLLGAYVLVLIAGAVAPSLPLFIR*
Ga0062595_10104376713300004479SoilYGLMAVMGVNVKVHLYAGVLLLAGYLLVLIAARLAPSVSLFLGR*
Ga0062592_10026058913300004480SoilNPYGLMAIMGINVQLHLRAGLLLLGAYLIVLIVGAVAPAVNLFLR*
Ga0062594_10146542413300005093SoilPYGLMAVMGINVRLHLAAGLALLAGYAIVLIAGAVAPTVSLFVR*
Ga0062594_10275277313300005093SoilPNYDNPYGLMAVMGVNVKVHLYAGLLLLAGYAVVLILGAVAPSVSLFVGR*
Ga0070666_1100403423300005335Switchgrass RhizospherePTYRWTLMAIMGVNIKVHLYVGLLLIAAYLIVLVSGALAPSVDLFVG*
Ga0070680_10040898833300005336Corn RhizosphereYDNPYALMAVMGVNVKLHLVAGVLLLAGYLVALVAGALAPSVSLFIGK*
Ga0070675_10154183723300005354Miscanthus RhizosphereLEPNYDNPYGLMAIMGVNIQLHLVAGLALVAAYLVVLAVHAVAPSVPLFLG*
Ga0070671_10066265923300005355Switchgrass RhizosphereLEPNYDNPYGLMAIMGVNIKVHLYAGLLLIAAYLVVLVSGAIVPSVDLFLG*
Ga0070659_10158116613300005366Corn RhizosphereALKVSRGLAPNYENPYGLMAIMGINVQLHLRAGLLLLGAYLIVLIVGAVAPAVNLFLR*
Ga0070703_1019124613300005406Corn, Switchgrass And Miscanthus RhizosphereLRVSAGLEPNYDNPYGLMAIMGVNIQLHLVAGLALVAAYLVVLAVHAVAPSVPLFLG*
Ga0070678_10176995913300005456Miscanthus RhizosphereGLMSIMGVNVQLHLRAGLLLAAAYAIVLIVGAVAPEVSLFI*
Ga0070706_10074657933300005467Corn, Switchgrass And Miscanthus RhizosphereLEPNYDNPYGLMAVMGVNVKVHLYAGLLLFAAYLLALIAASLAPSVSLFVGR*
Ga0070699_10020768143300005518Corn, Switchgrass And Miscanthus RhizosphereDGLSPNYDNPYGLMAVMGVNIKVHLYAGVLLLVAYLVVLVAGALAPSVNLFLR*
Ga0070697_10065432023300005536Corn, Switchgrass And Miscanthus RhizosphereLEPNYDNPYALMAVMGVNVKVHLYAGLLLLAGYALVLVLGAIAPSVSLFVAR*
Ga0070686_10081183313300005544Switchgrass RhizosphereDNPYALMAYMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT*
Ga0070696_10107557213300005546Corn, Switchgrass And Miscanthus RhizosphereFMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT*
Ga0070704_10165379223300005549Corn, Switchgrass And Miscanthus RhizospherePNYDNPYGLMAIMGVNIKLHLVAGLALVAAYLVVLVLQAVAPSVPLFLG*
Ga0066706_1118175333300005598SoilDNPYGLMAVMGVNVKVHLYAGLLLLAGYLVVLVAGALAPSVNLFVH*
Ga0066905_10131435813300005713Tropical Forest SoilAPNYDNPYGLMAIMGVNIKVHLYAGLLLVAAYLAVLAAAALAPSVDLFV*
Ga0066652_10044689223300006046SoilLAFRVSRGLGPNYENPYGLMAIMGVNVQLHLRAGLLLLLAYALVLLAGIVTPTLDLFVG*
Ga0068871_10062287713300006358Miscanthus RhizosphereNYDNPYGLMAIMGVNIKVHLYAGLLLIAAYLVVLVSGAIVPSVNLFLG*
Ga0068871_10146355513300006358Miscanthus RhizosphereTIPLALKVSRGLRPNYENPYGLMAIMGINVQLHLRAGLLLLGAYLIVLIVGAVAPSVNLFIG*
Ga0075425_10276983523300006854Populus RhizosphereLALQVSRGLEPNYDNPYGLMAIMGVNIKVHLYVGLLLIAAYLIVLVSGALAPSVDLFVG*
Ga0068865_10166365613300006881Miscanthus RhizosphereYGLMAVMGINVRLHLAAGLALLAGYAIVLIAGAVAPTVSLFVR*
Ga0075518_113216013300006972Arctic Peat SoilTNVKLHMRAGLLLLAAYAIVLVMGAVAPTVRLFLG*
Ga0105251_1024823123300009011Switchgrass RhizosphereSRGLEPNYDNPYGLMAVMGVNVKVHLYAGLLLLAGYAVVLVLGALAPSVSLFVGR*
Ga0111539_1068851013300009094Populus RhizosphereYDNPYGLMAFMGVNVKLHLFAGLLLLAAYVVVIGAMAVAPGVDLFIG*
Ga0066709_10207260713300009137Grasslands SoilVSRGLAPNYDNPYGLMAVMGVNVKVHLYAGLLLLAGYLVVLVAGALAPSVNLFVH*
Ga0114129_1029103413300009147Populus RhizosphereRVSNGLAPNYDNPYGLMAFMGVNVRLHLAAGALLLVAYLIVLAAGAVAPGVDLFLG*
Ga0105242_1074285113300009176Miscanthus RhizosphereALMAFMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT*
Ga0105074_109290513300010029Groundwater SandPNYDNPYGLMAIMGVNIRLHMLAGALLFIAYVVVLVAGAVAPGVPLFIR*
Ga0126309_1098818913300010039Serpentine SoilVNVQLHLRAGLLLLAAYAVVLVLGILAPTVDLFLG*
Ga0134071_1062605513300010336Grasslands SoilNYDNPYGLMAFMAVNVRLHLAAGALLLVAYLIVLAVGALAPGVDLFLG*
Ga0126377_1272958323300010362Tropical Forest SoilEPNYDNPYGLMAVMGVNIKVHLFAGLLLIAAYLAVLAVSAVAPTIDLFVG*
Ga0134121_1152076213300010401Terrestrial SoilPYGLMSVMGINVKVHLYAGVLLLAGYLLVLIAATLAPSVSLFLGR*
Ga0134121_1306468923300010401Terrestrial SoilARQVSRGLAPNYDNPYGLMAIMGVNIKVHLYVGLLLIAAYLIVLVSGALAPSVDLFVG*
Ga0105246_1131445923300011119Miscanthus RhizosphereYDNPYGLMAVMGVNIKLHLYAGVLLFAAYLIVLVLGAVAPSVPVFVSVIG*
Ga0136623_1000604313300012045Polar Desert SandPNYDNPYGLMAIMGINIQLHLFVGLALLAAYAIVLVVAAVAPGVPLFLGS*
Ga0157351_106959713300012501Unplanted SoilNPYGLMAIMGVNIKVQLYVGLILIAAYLIVLVSGALAPSVDLFVG*
Ga0136614_1045172923300012684Polar Desert SandGLVPNYDNPYGLMAVMGVNIKLHLFAGLLLLGAYVAVLVMGAIAPQVPLFIR*
Ga0157301_1013238813300012911SoilNPYGLMAIMGTNVQLHMREGLLLLSAYGIVLIAGALAPSVDLFLG*
Ga0164309_1082111823300012984SoilVNVQLHLRAGLLLLGAYLIVLVVGAVAPAVNLFLR*
Ga0164308_1199150813300012985SoilPYGLMAIMGVNVQLHLRAGLLLLAGYAIVLVVGAVAPTVSLFLR*
Ga0075313_122690723300014267Natural And Restored WetlandsIPLALRVSNGLEPNYDNPYGLMAIMGVNIQLHLVAGVALVVAYLVVLVIRAVAPSVPLFVR*
Ga0075331_117725723300014310Natural And Restored WetlandsAIPLALRVSNGLEPNYDNPYGLMAIMGVNIQVHLVAGVALVVAYVAVLVIHAVAPGVPLFLR*
Ga0163163_1024000233300014325Switchgrass RhizosphereRQVSAGLMPNYDNPYGLMAFMGVNVKLHLFAGLLLFAAYVVVIGVMAVAPGVDLFIG*
Ga0157380_1066854413300014326Switchgrass RhizosphereIKLHMFAGGLLLLAYLVVLIVGAVAPDAGLFLPI*
Ga0157377_1132421423300014745Miscanthus RhizosphereALKVSRGLAPNYENPYGLMAIMGINVQLHLRAGLLLLGAYLIVLIVGAVAPSVNLFIG*
Ga0157376_1307362123300014969Miscanthus RhizosphereMAIMGVNVQLHLRAGLLLLLAYALVLVIGVVAPTLDLFVG*
Ga0173478_1007869113300015201SoilPNYENPYGLMAIMGINVQLHLRAGLLLLGAYVIVLIVGAVAPSVNLFIG*
Ga0132258_1307988533300015371Arabidopsis RhizosphereVSRGLEPNYDNPYGLMAIMGVNIKVHLYVGLLLIAAYLIVLVSGALAPSVDLFVG*
Ga0132256_10039576033300015372Arabidopsis RhizosphereVPLALQVSRGLEPNYDNPYGLMAIMGVNIKVHLYVGLLLIAAYLIVLVSGALAPSVDLFVG*
Ga0184605_1030389613300018027Groundwater SedimentVERGLEPNYDNPYGLMAIMGVNIQLHLYVGLALLAAYAIVLIVAAVAPGVPLFLGG
Ga0184638_107533433300018052Groundwater SedimentPNYDNPYGLMSIMAVNINVHLYAGLLLLLAYVVVLIAGAVAPSVDLFVG
Ga0184619_1010242533300018061Groundwater SedimentIPLALRVERGLEPNYDNPYGLMAIMGVNIQLHLYVGLALLAAYAIVLIVAAVAPGVPLFLGR
Ga0190272_1150971623300018429SoilYDNPYGLMAIMGANVQLHLMAGLLLLAAYAIVLVTGAVAPGVDLFLG
Ga0190275_1085061133300018432SoilALQVSRGLEPNYDNPYGLMAIMGVNVQLHLRAGLLLLAAYMVVLILGAVAPGVPLFIG
Ga0190275_1333338313300018432SoilQVSRGLEPNYDNPYGLMAIMGVNIKVHLYAGALLLLAYAVVLIVGAVAPSVDLFIG
Ga0190269_1109036613300018465SoilEPNYDNPYGLMAVMGVNIQLHLVVGMALLAAYLVVLVVQAFAPSVPLFVR
Ga0190270_1216101423300018469SoilIMGTNVQLHLRAGLLLLGAYLIVLIVGAVAPSVSLFIG
Ga0190274_1390211133300018476SoilAIMGTNVQLHLRAGLLLLGAYLIVLIVGAVAPTVNLFIG
Ga0173481_1070709423300019356SoilGINVQLHLRAGLLLLGAYLIVLIVGAVAPAVNLFLR
Ga0210382_1002938543300021080Groundwater SedimentGLAPNYDNPYGLMAVMGVNVKVHLYAGLLLLAGYLVVLIAGALAPSVNLFLR
Ga0207653_1014495513300025885Corn, Switchgrass And Miscanthus RhizospherePLALRVSAGLEPNYDNPYGLMAIMGVNIQLHLVAGLALVAAYLVVLAVHAVAPSVPLFLG
Ga0207707_1159303013300025912Corn RhizosphereALMAYMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT
Ga0207644_1104586413300025931Switchgrass RhizosphereLMAIMGINVQLHLRAGLLLLGAYLIVLIVGAVAPSVNLFIG
Ga0207690_1176926213300025932Corn RhizosphereLEPNYDNPYGLMAIMGVNIKVHLYAGLLLIAAYLIVLLSAALAPSLNLFVG
Ga0207686_1125270123300025934Miscanthus RhizosphereNPYALMAFMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT
Ga0207704_1083607113300025938Miscanthus RhizosphereDNPYGLMAIMGVNIQLHLVAGLALVAAYLVVLAVHAVAPSVPLFLG
Ga0207679_1108903123300025945Corn RhizospherePNYDNPYGLMAFMGVNVKLHLFAGLLLLAAYVVVIGVMAVAPGVDLFIG
Ga0207679_1159345413300025945Corn RhizosphereNPYGLMAIMGINVQLHLRAGLLLLGAYLIVLIVGAVAPSVNLFIG
Ga0208419_103044823300026032Natural And Restored WetlandsRVSNGLEPNYDNPYGLMAIMGVNIQVHLVAGVALVVAYVAVLVIHAVAPGVPLFLR
Ga0207678_1149756413300026067Corn RhizosphereLARQVSRGLLPNYDNPYALMAYMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT
Ga0207674_1138450313300026116Corn RhizosphereYGLMAIMGVNIKLHLVAGLALVAAYLVVLVLQAVAPSVPLFLG
Ga0207674_1156067413300026116Corn RhizosphereAMQVSRGLEPNYDNPYGLMAIMGVNIKVHLYAGLLLIAAYLIVLLSGALAPSLNLFVG
Ga0207683_1141473213300026121Miscanthus RhizosphereSRGLLPNYDNPYALMAFMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT
Ga0209240_120126613300026304Grasslands SoilPYGLMAVMGVNVKVHLYAGLLLLAGYLVVLIAGAVAPSVNLFLR
Ga0256867_1022552323300026535SoilALRVHRGLRPNYDNPYGLMAVMAVNIQVHLFAGILLVAAYAIVLVAGAVAPGVPLFIR
Ga0209874_114302313300027577Groundwater SandLARRVSAGLAPNYDNPYGLMAFMGVNVQLHLAAGVLLVVAYGIVIAAMAVAPGVDLFLG
Ga0209974_1002300133300027876Arabidopsis Thaliana RhizosphereALRVSAGLEPNYDNPYGLMAIMGVNIQLHLVAGLALVAAYLVVLAVHAVAPSVPLFLG
Ga0302166_1014692023300028652FenPYGLMAIMGVNVQLHLRAGLLLLGAYALVLVLGAVAPSVHLFIR
Ga0307320_1044813023300028771SoilAIMATNVQLHLVAGVMLLVGYLIVLIVGAIAPSVDLFVG
Ga0307282_1002118313300028784SoilPYGLMAVMGVNVKVHLYAGLLLLAGYLVVLIAGALAPSVNLFLR
Ga0307287_1016843023300028796SoilFTIPLALRVSRGLEPNYENPYGLMAIMGVNIQLHLFAGLLLLLGYALVLVVGAVAPGVPLFVR
Ga0307289_1044848923300028875SoilPNYDNPYGLMAIMGENVQLHLIAGLLLLAGYAIVIVAGAIAPGVDLFLG
Ga0307308_1042913613300028884SoilARRVSRGLEPNYDNPYGLMAVMGVNVKVHLYAGLLLLAGYAVVLILGAVAPSVSLFVGR
Ga0311337_1034459523300030000FenGLMAIMGVNVQLHLRAGLLLLGAYALVLVLGAVAPSVHLFIR
Ga0311350_1207638323300030002FenYDNPYGLMAIMGVNVQLHLRAGLLLLGAYVVVLVLGAVAPSLHLFLR
Ga0247826_1154468213300030336SoilGLAPNYDNPYGLMAVMGVNIKLHLYAGVLLFAAYLIVLVLGAVAPSVPVFVSVIG
Ga0311335_1103444713300030838FenYGLMAIMGVNVQLHLRAGLLLLGAYVVVLVLGAVAPSLHLFLR
Ga0299914_1067579513300031228SoilLLTIPLALRVHRGLRPNYDNPYGLMAVMAVNIQVHLFAGILLVAAYAIVLVAGVVAPGVPLFIR
Ga0307416_10033498413300032002RhizosphereYGLMAIMGVNIQVHLVAGVALVVAYVAVLVIHAVAPGVPLFLR
Ga0307416_10355342913300032002RhizosphereGLAPNYDNPYGLMAIMGTNVQLHLMAGLLLLAGYVVVLVAGVIAPGVDLFVG
Ga0307471_10291363613300032180Hardwood Forest SoilAGLRPNYDNPYGLMAFMGVNVQLHLRAGLLLLAAYAIVIVLGAFAPSVPVFIGG
Ga0364926_018361_1058_12103300033812SedimentMPNYDNPYGLMAVMGRNIKVHAYAGLLLLAAYAAVLIAGAVAPSLDLFLG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.