| Basic Information | |
|---|---|
| Family ID | F088967 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 50 residues |
| Representative Sequence | YDNPYGLMAIMGVNVQLHLRAGLLLLAAYAIVLVLGAVAPSVPLFLG |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.92 % |
| % of genes near scaffold ends (potentially truncated) | 97.25 % |
| % of genes from short scaffolds (< 2000 bps) | 95.41 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.991 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.596 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.028 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.872 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.00% β-sheet: 0.00% Coil/Unstructured: 52.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF09844 | DUF2071 | 13.76 |
| PF00012 | HSP70 | 13.76 |
| PF02254 | TrkA_N | 11.93 |
| PF13560 | HTH_31 | 11.01 |
| PF02080 | TrkA_C | 9.17 |
| PF00296 | Bac_luciferase | 9.17 |
| PF08241 | Methyltransf_11 | 1.83 |
| PF01381 | HTH_3 | 1.83 |
| PF01025 | GrpE | 0.92 |
| PF14026 | DUF4242 | 0.92 |
| PF02386 | TrkH | 0.92 |
| PF12680 | SnoaL_2 | 0.92 |
| PF02355 | SecD_SecF | 0.92 |
| PF00211 | Guanylate_cyc | 0.92 |
| PF00082 | Peptidase_S8 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 13.76 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 9.17 |
| COG0168 | Trk-type K+ transport system, membrane component | Inorganic ion transport and metabolism [P] | 0.92 |
| COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 0.92 |
| COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.92 |
| COG0576 | Molecular chaperone GrpE (heat shock protein HSP-70) | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.99 % |
| Unclassified | root | N/A | 11.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725004|GPKC_F5V46DG03FRCJD | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
| 2124908041|P3_CLC_ConsensusfromContig47864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1588 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_13022858 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_14031261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 752 | Open in IMG/M |
| 3300000890|JGI11643J12802_11412302 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300000956|JGI10216J12902_112053708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1203 | Open in IMG/M |
| 3300003987|Ga0055471_10040405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia | 1229 | Open in IMG/M |
| 3300003996|Ga0055467_10201634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 614 | Open in IMG/M |
| 3300004114|Ga0062593_100504036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1123 | Open in IMG/M |
| 3300004114|Ga0062593_101980094 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300004156|Ga0062589_100796177 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300004157|Ga0062590_101459915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 684 | Open in IMG/M |
| 3300004463|Ga0063356_102658881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 769 | Open in IMG/M |
| 3300004463|Ga0063356_103948423 | Not Available | 638 | Open in IMG/M |
| 3300004479|Ga0062595_101043767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 708 | Open in IMG/M |
| 3300004480|Ga0062592_100260589 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300005093|Ga0062594_101465424 | Not Available | 698 | Open in IMG/M |
| 3300005093|Ga0062594_102752773 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005335|Ga0070666_11004034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 619 | Open in IMG/M |
| 3300005336|Ga0070680_100408988 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300005354|Ga0070675_101541837 | Not Available | 613 | Open in IMG/M |
| 3300005355|Ga0070671_100662659 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300005366|Ga0070659_101581166 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005406|Ga0070703_10191246 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300005456|Ga0070678_101769959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
| 3300005467|Ga0070706_100746579 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005518|Ga0070699_100207681 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300005536|Ga0070697_100654320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 925 | Open in IMG/M |
| 3300005544|Ga0070686_100811833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 755 | Open in IMG/M |
| 3300005546|Ga0070696_101075572 | Not Available | 675 | Open in IMG/M |
| 3300005549|Ga0070704_101653792 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005598|Ga0066706_11181753 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005713|Ga0066905_101314358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 651 | Open in IMG/M |
| 3300006046|Ga0066652_100446892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1189 | Open in IMG/M |
| 3300006358|Ga0068871_100622877 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300006358|Ga0068871_101463555 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300006854|Ga0075425_102769835 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006881|Ga0068865_101663656 | Not Available | 575 | Open in IMG/M |
| 3300006972|Ga0075518_1132160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 512 | Open in IMG/M |
| 3300009011|Ga0105251_10248231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 802 | Open in IMG/M |
| 3300009094|Ga0111539_10688510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1190 | Open in IMG/M |
| 3300009137|Ga0066709_102072607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 787 | Open in IMG/M |
| 3300009147|Ga0114129_10291034 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
| 3300009176|Ga0105242_10742851 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300010029|Ga0105074_1092905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 565 | Open in IMG/M |
| 3300010039|Ga0126309_10988189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
| 3300010336|Ga0134071_10626055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 564 | Open in IMG/M |
| 3300010362|Ga0126377_12729583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
| 3300010401|Ga0134121_11520762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 685 | Open in IMG/M |
| 3300010401|Ga0134121_13064689 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300011119|Ga0105246_11314459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 671 | Open in IMG/M |
| 3300012045|Ga0136623_10006043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4772 | Open in IMG/M |
| 3300012501|Ga0157351_1069597 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012684|Ga0136614_10451729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 932 | Open in IMG/M |
| 3300012911|Ga0157301_10132388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 773 | Open in IMG/M |
| 3300012984|Ga0164309_10821118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
| 3300012985|Ga0164308_11991508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
| 3300014267|Ga0075313_1226907 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300014310|Ga0075331_1177257 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300014325|Ga0163163_10240002 | Not Available | 1862 | Open in IMG/M |
| 3300014326|Ga0157380_10668544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1039 | Open in IMG/M |
| 3300014745|Ga0157377_11324214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 564 | Open in IMG/M |
| 3300014969|Ga0157376_13073621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
| 3300015201|Ga0173478_10078691 | Not Available | 1161 | Open in IMG/M |
| 3300015371|Ga0132258_13079885 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300015372|Ga0132256_100395760 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300018027|Ga0184605_10303896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 722 | Open in IMG/M |
| 3300018052|Ga0184638_1075334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1236 | Open in IMG/M |
| 3300018061|Ga0184619_10102425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1287 | Open in IMG/M |
| 3300018429|Ga0190272_11509716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 683 | Open in IMG/M |
| 3300018432|Ga0190275_10850611 | Not Available | 978 | Open in IMG/M |
| 3300018432|Ga0190275_13333383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 520 | Open in IMG/M |
| 3300018465|Ga0190269_11090366 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300018469|Ga0190270_12161014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 616 | Open in IMG/M |
| 3300018476|Ga0190274_13902111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 505 | Open in IMG/M |
| 3300019356|Ga0173481_10707094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
| 3300021080|Ga0210382_10029385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2056 | Open in IMG/M |
| 3300025885|Ga0207653_10144955 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300025912|Ga0207707_11593030 | Not Available | 514 | Open in IMG/M |
| 3300025931|Ga0207644_11045864 | Not Available | 686 | Open in IMG/M |
| 3300025932|Ga0207690_11769262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300025934|Ga0207686_11252701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 608 | Open in IMG/M |
| 3300025938|Ga0207704_10836071 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300025945|Ga0207679_11089031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 733 | Open in IMG/M |
| 3300025945|Ga0207679_11593454 | Not Available | 598 | Open in IMG/M |
| 3300026032|Ga0208419_1030448 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300026067|Ga0207678_11497564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 596 | Open in IMG/M |
| 3300026116|Ga0207674_11384503 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300026116|Ga0207674_11560674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 629 | Open in IMG/M |
| 3300026121|Ga0207683_11414732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 643 | Open in IMG/M |
| 3300026304|Ga0209240_1201266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300026535|Ga0256867_10225523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 680 | Open in IMG/M |
| 3300027577|Ga0209874_1143023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
| 3300027876|Ga0209974_10023001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia | 2063 | Open in IMG/M |
| 3300028652|Ga0302166_10146920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
| 3300028771|Ga0307320_10448130 | Not Available | 520 | Open in IMG/M |
| 3300028784|Ga0307282_10021183 | All Organisms → cellular organisms → Bacteria | 2733 | Open in IMG/M |
| 3300028796|Ga0307287_10168430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
| 3300028875|Ga0307289_10448489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 530 | Open in IMG/M |
| 3300028884|Ga0307308_10429136 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300030000|Ga0311337_10344595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1253 | Open in IMG/M |
| 3300030002|Ga0311350_12076383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300030336|Ga0247826_11544682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 539 | Open in IMG/M |
| 3300030838|Ga0311335_11034447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 586 | Open in IMG/M |
| 3300031228|Ga0299914_10675795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 874 | Open in IMG/M |
| 3300032002|Ga0307416_100334984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → Thermomicrobiaceae → Thermomicrobium → Thermomicrobium roseum | 1523 | Open in IMG/M |
| 3300032002|Ga0307416_103553429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 522 | Open in IMG/M |
| 3300032180|Ga0307471_102913636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 607 | Open in IMG/M |
| 3300033812|Ga0364926_018361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1237 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 7.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.59% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.75% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.75% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.83% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.83% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.92% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.92% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.92% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.92% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006972 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026032 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKC_05533650 | 2067725004 | Soil | GLMAIMGLNVQLHLRAGLLLLAAYSAVLVLGAVAPTLDLFLG |
| P3_CLC_02451890 | 2124908041 | Soil | YDNPYGLMAIMGVNVQLHLRAGLLLLAAYAIVLVLGAVAPSVPLFLG |
| ICChiseqgaiiFebDRAFT_130228582 | 3300000363 | Soil | GLMAIMGVNIRLHLVAGVALVAAYLVVLVLQAVAPSVPLFVR* |
| ICChiseqgaiiFebDRAFT_140312611 | 3300000363 | Soil | NYDNPYGLMSIMAVNINVHLYAGLLLLLAYVVVLIAGAVAPSVDLFVG* |
| JGI11643J12802_114123022 | 3300000890 | Soil | GLEPNYDNPYGLMAIMGVNIQLHLAAGVALVVAYVAVLVIHAVAPGVPLFLG* |
| JGI10216J12902_1120537081 | 3300000956 | Soil | PYGLMAIMGTNVQLHLIAGLLLLAGYIVVLVAGVVAPGVDLYLG* |
| Ga0055471_100404053 | 3300003987 | Natural And Restored Wetlands | YGLMAIMGVNIQLHLVAGVALVVAYLVVLVIRAVAPSVPLFVR* |
| Ga0055467_102016341 | 3300003996 | Natural And Restored Wetlands | DNPYGLMAIMGVNIQVHLVAGVALVVAYVAVLVIHAVAPGVPLFLR* |
| Ga0062593_1005040361 | 3300004114 | Soil | VSRGLRPNYENPYGLMAIMGTNVQLHLRAGLLLLGAYLIVLVVGAVAPSVSLFIG* |
| Ga0062593_1019800941 | 3300004114 | Soil | NYDNPYGLMAVMGVNVKVHLYAGVLLLAGYLLVLIAARLAPSVSLFLGR* |
| Ga0062589_1007961771 | 3300004156 | Soil | SRGLEPNYDNPYGLMAVMGVNVKVHLYAGLLLLAGYAVVLILGAVAPSVSLFVGR* |
| Ga0062590_1014599152 | 3300004157 | Soil | SRGLGPNYENPYGLMAIMGLNVQLHLRAGLLLLAAYAAVLVLGAVAPTLDLFLG* |
| Ga0063356_1026588811 | 3300004463 | Arabidopsis Thaliana Rhizosphere | APNYDNPYGLMAIMGTNVQLHLMAGLLLLAGYVVVLVAGVVAPGVDLFLG* |
| Ga0063356_1039484231 | 3300004463 | Arabidopsis Thaliana Rhizosphere | NPYALMSVMATNINLHAAAGVLLLGAYVLVLIAGAVAPSLPLFIR* |
| Ga0062595_1010437671 | 3300004479 | Soil | YGLMAVMGVNVKVHLYAGVLLLAGYLLVLIAARLAPSVSLFLGR* |
| Ga0062592_1002605891 | 3300004480 | Soil | NPYGLMAIMGINVQLHLRAGLLLLGAYLIVLIVGAVAPAVNLFLR* |
| Ga0062594_1014654241 | 3300005093 | Soil | PYGLMAVMGINVRLHLAAGLALLAGYAIVLIAGAVAPTVSLFVR* |
| Ga0062594_1027527731 | 3300005093 | Soil | PNYDNPYGLMAVMGVNVKVHLYAGLLLLAGYAVVLILGAVAPSVSLFVGR* |
| Ga0070666_110040342 | 3300005335 | Switchgrass Rhizosphere | PTYRWTLMAIMGVNIKVHLYVGLLLIAAYLIVLVSGALAPSVDLFVG* |
| Ga0070680_1004089883 | 3300005336 | Corn Rhizosphere | YDNPYALMAVMGVNVKLHLVAGVLLLAGYLVALVAGALAPSVSLFIGK* |
| Ga0070675_1015418372 | 3300005354 | Miscanthus Rhizosphere | LEPNYDNPYGLMAIMGVNIQLHLVAGLALVAAYLVVLAVHAVAPSVPLFLG* |
| Ga0070671_1006626592 | 3300005355 | Switchgrass Rhizosphere | LEPNYDNPYGLMAIMGVNIKVHLYAGLLLIAAYLVVLVSGAIVPSVDLFLG* |
| Ga0070659_1015811661 | 3300005366 | Corn Rhizosphere | ALKVSRGLAPNYENPYGLMAIMGINVQLHLRAGLLLLGAYLIVLIVGAVAPAVNLFLR* |
| Ga0070703_101912461 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LRVSAGLEPNYDNPYGLMAIMGVNIQLHLVAGLALVAAYLVVLAVHAVAPSVPLFLG* |
| Ga0070678_1017699591 | 3300005456 | Miscanthus Rhizosphere | GLMSIMGVNVQLHLRAGLLLAAAYAIVLIVGAVAPEVSLFI* |
| Ga0070706_1007465793 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LEPNYDNPYGLMAVMGVNVKVHLYAGLLLFAAYLLALIAASLAPSVSLFVGR* |
| Ga0070699_1002076814 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DGLSPNYDNPYGLMAVMGVNIKVHLYAGVLLLVAYLVVLVAGALAPSVNLFLR* |
| Ga0070697_1006543202 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LEPNYDNPYALMAVMGVNVKVHLYAGLLLLAGYALVLVLGAIAPSVSLFVAR* |
| Ga0070686_1008118331 | 3300005544 | Switchgrass Rhizosphere | DNPYALMAYMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT* |
| Ga0070696_1010755721 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | FMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT* |
| Ga0070704_1016537922 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PNYDNPYGLMAIMGVNIKLHLVAGLALVAAYLVVLVLQAVAPSVPLFLG* |
| Ga0066706_111817533 | 3300005598 | Soil | DNPYGLMAVMGVNVKVHLYAGLLLLAGYLVVLVAGALAPSVNLFVH* |
| Ga0066905_1013143581 | 3300005713 | Tropical Forest Soil | APNYDNPYGLMAIMGVNIKVHLYAGLLLVAAYLAVLAAAALAPSVDLFV* |
| Ga0066652_1004468922 | 3300006046 | Soil | LAFRVSRGLGPNYENPYGLMAIMGVNVQLHLRAGLLLLLAYALVLLAGIVTPTLDLFVG* |
| Ga0068871_1006228771 | 3300006358 | Miscanthus Rhizosphere | NYDNPYGLMAIMGVNIKVHLYAGLLLIAAYLVVLVSGAIVPSVNLFLG* |
| Ga0068871_1014635551 | 3300006358 | Miscanthus Rhizosphere | TIPLALKVSRGLRPNYENPYGLMAIMGINVQLHLRAGLLLLGAYLIVLIVGAVAPSVNLFIG* |
| Ga0075425_1027698352 | 3300006854 | Populus Rhizosphere | LALQVSRGLEPNYDNPYGLMAIMGVNIKVHLYVGLLLIAAYLIVLVSGALAPSVDLFVG* |
| Ga0068865_1016636561 | 3300006881 | Miscanthus Rhizosphere | YGLMAVMGINVRLHLAAGLALLAGYAIVLIAGAVAPTVSLFVR* |
| Ga0075518_11321601 | 3300006972 | Arctic Peat Soil | TNVKLHMRAGLLLLAAYAIVLVMGAVAPTVRLFLG* |
| Ga0105251_102482312 | 3300009011 | Switchgrass Rhizosphere | SRGLEPNYDNPYGLMAVMGVNVKVHLYAGLLLLAGYAVVLVLGALAPSVSLFVGR* |
| Ga0111539_106885101 | 3300009094 | Populus Rhizosphere | YDNPYGLMAFMGVNVKLHLFAGLLLLAAYVVVIGAMAVAPGVDLFIG* |
| Ga0066709_1020726071 | 3300009137 | Grasslands Soil | VSRGLAPNYDNPYGLMAVMGVNVKVHLYAGLLLLAGYLVVLVAGALAPSVNLFVH* |
| Ga0114129_102910341 | 3300009147 | Populus Rhizosphere | RVSNGLAPNYDNPYGLMAFMGVNVRLHLAAGALLLVAYLIVLAAGAVAPGVDLFLG* |
| Ga0105242_107428511 | 3300009176 | Miscanthus Rhizosphere | ALMAFMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT* |
| Ga0105074_10929051 | 3300010029 | Groundwater Sand | PNYDNPYGLMAIMGVNIRLHMLAGALLFIAYVVVLVAGAVAPGVPLFIR* |
| Ga0126309_109881891 | 3300010039 | Serpentine Soil | VNVQLHLRAGLLLLAAYAVVLVLGILAPTVDLFLG* |
| Ga0134071_106260551 | 3300010336 | Grasslands Soil | NYDNPYGLMAFMAVNVRLHLAAGALLLVAYLIVLAVGALAPGVDLFLG* |
| Ga0126377_127295832 | 3300010362 | Tropical Forest Soil | EPNYDNPYGLMAVMGVNIKVHLFAGLLLIAAYLAVLAVSAVAPTIDLFVG* |
| Ga0134121_115207621 | 3300010401 | Terrestrial Soil | PYGLMSVMGINVKVHLYAGVLLLAGYLLVLIAATLAPSVSLFLGR* |
| Ga0134121_130646892 | 3300010401 | Terrestrial Soil | ARQVSRGLAPNYDNPYGLMAIMGVNIKVHLYVGLLLIAAYLIVLVSGALAPSVDLFVG* |
| Ga0105246_113144592 | 3300011119 | Miscanthus Rhizosphere | YDNPYGLMAVMGVNIKLHLYAGVLLFAAYLIVLVLGAVAPSVPVFVSVIG* |
| Ga0136623_100060431 | 3300012045 | Polar Desert Sand | PNYDNPYGLMAIMGINIQLHLFVGLALLAAYAIVLVVAAVAPGVPLFLGS* |
| Ga0157351_10695971 | 3300012501 | Unplanted Soil | NPYGLMAIMGVNIKVQLYVGLILIAAYLIVLVSGALAPSVDLFVG* |
| Ga0136614_104517292 | 3300012684 | Polar Desert Sand | GLVPNYDNPYGLMAVMGVNIKLHLFAGLLLLGAYVAVLVMGAIAPQVPLFIR* |
| Ga0157301_101323881 | 3300012911 | Soil | NPYGLMAIMGTNVQLHMREGLLLLSAYGIVLIAGALAPSVDLFLG* |
| Ga0164309_108211182 | 3300012984 | Soil | VNVQLHLRAGLLLLGAYLIVLVVGAVAPAVNLFLR* |
| Ga0164308_119915081 | 3300012985 | Soil | PYGLMAIMGVNVQLHLRAGLLLLAGYAIVLVVGAVAPTVSLFLR* |
| Ga0075313_12269072 | 3300014267 | Natural And Restored Wetlands | IPLALRVSNGLEPNYDNPYGLMAIMGVNIQLHLVAGVALVVAYLVVLVIRAVAPSVPLFVR* |
| Ga0075331_11772572 | 3300014310 | Natural And Restored Wetlands | AIPLALRVSNGLEPNYDNPYGLMAIMGVNIQVHLVAGVALVVAYVAVLVIHAVAPGVPLFLR* |
| Ga0163163_102400023 | 3300014325 | Switchgrass Rhizosphere | RQVSAGLMPNYDNPYGLMAFMGVNVKLHLFAGLLLFAAYVVVIGVMAVAPGVDLFIG* |
| Ga0157380_106685441 | 3300014326 | Switchgrass Rhizosphere | IKLHMFAGGLLLLAYLVVLIVGAVAPDAGLFLPI* |
| Ga0157377_113242142 | 3300014745 | Miscanthus Rhizosphere | ALKVSRGLAPNYENPYGLMAIMGINVQLHLRAGLLLLGAYLIVLIVGAVAPSVNLFIG* |
| Ga0157376_130736212 | 3300014969 | Miscanthus Rhizosphere | MAIMGVNVQLHLRAGLLLLLAYALVLVIGVVAPTLDLFVG* |
| Ga0173478_100786911 | 3300015201 | Soil | PNYENPYGLMAIMGINVQLHLRAGLLLLGAYVIVLIVGAVAPSVNLFIG* |
| Ga0132258_130798853 | 3300015371 | Arabidopsis Rhizosphere | VSRGLEPNYDNPYGLMAIMGVNIKVHLYVGLLLIAAYLIVLVSGALAPSVDLFVG* |
| Ga0132256_1003957603 | 3300015372 | Arabidopsis Rhizosphere | VPLALQVSRGLEPNYDNPYGLMAIMGVNIKVHLYVGLLLIAAYLIVLVSGALAPSVDLFVG* |
| Ga0184605_103038961 | 3300018027 | Groundwater Sediment | VERGLEPNYDNPYGLMAIMGVNIQLHLYVGLALLAAYAIVLIVAAVAPGVPLFLGG |
| Ga0184638_10753343 | 3300018052 | Groundwater Sediment | PNYDNPYGLMSIMAVNINVHLYAGLLLLLAYVVVLIAGAVAPSVDLFVG |
| Ga0184619_101024253 | 3300018061 | Groundwater Sediment | IPLALRVERGLEPNYDNPYGLMAIMGVNIQLHLYVGLALLAAYAIVLIVAAVAPGVPLFLGR |
| Ga0190272_115097162 | 3300018429 | Soil | YDNPYGLMAIMGANVQLHLMAGLLLLAAYAIVLVTGAVAPGVDLFLG |
| Ga0190275_108506113 | 3300018432 | Soil | ALQVSRGLEPNYDNPYGLMAIMGVNVQLHLRAGLLLLAAYMVVLILGAVAPGVPLFIG |
| Ga0190275_133333831 | 3300018432 | Soil | QVSRGLEPNYDNPYGLMAIMGVNIKVHLYAGALLLLAYAVVLIVGAVAPSVDLFIG |
| Ga0190269_110903661 | 3300018465 | Soil | EPNYDNPYGLMAVMGVNIQLHLVVGMALLAAYLVVLVVQAFAPSVPLFVR |
| Ga0190270_121610142 | 3300018469 | Soil | IMGTNVQLHLRAGLLLLGAYLIVLIVGAVAPSVSLFIG |
| Ga0190274_139021113 | 3300018476 | Soil | AIMGTNVQLHLRAGLLLLGAYLIVLIVGAVAPTVNLFIG |
| Ga0173481_107070942 | 3300019356 | Soil | GINVQLHLRAGLLLLGAYLIVLIVGAVAPAVNLFLR |
| Ga0210382_100293854 | 3300021080 | Groundwater Sediment | GLAPNYDNPYGLMAVMGVNVKVHLYAGLLLLAGYLVVLIAGALAPSVNLFLR |
| Ga0207653_101449551 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | PLALRVSAGLEPNYDNPYGLMAIMGVNIQLHLVAGLALVAAYLVVLAVHAVAPSVPLFLG |
| Ga0207707_115930301 | 3300025912 | Corn Rhizosphere | ALMAYMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT |
| Ga0207644_110458641 | 3300025931 | Switchgrass Rhizosphere | LMAIMGINVQLHLRAGLLLLGAYLIVLIVGAVAPSVNLFIG |
| Ga0207690_117692621 | 3300025932 | Corn Rhizosphere | LEPNYDNPYGLMAIMGVNIKVHLYAGLLLIAAYLIVLLSAALAPSLNLFVG |
| Ga0207686_112527012 | 3300025934 | Miscanthus Rhizosphere | NPYALMAFMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT |
| Ga0207704_108360711 | 3300025938 | Miscanthus Rhizosphere | DNPYGLMAIMGVNIQLHLVAGLALVAAYLVVLAVHAVAPSVPLFLG |
| Ga0207679_110890312 | 3300025945 | Corn Rhizosphere | PNYDNPYGLMAFMGVNVKLHLFAGLLLLAAYVVVIGVMAVAPGVDLFIG |
| Ga0207679_115934541 | 3300025945 | Corn Rhizosphere | NPYGLMAIMGINVQLHLRAGLLLLGAYLIVLIVGAVAPSVNLFIG |
| Ga0208419_10304482 | 3300026032 | Natural And Restored Wetlands | RVSNGLEPNYDNPYGLMAIMGVNIQVHLVAGVALVVAYVAVLVIHAVAPGVPLFLR |
| Ga0207678_114975641 | 3300026067 | Corn Rhizosphere | LARQVSRGLLPNYDNPYALMAYMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT |
| Ga0207674_113845031 | 3300026116 | Corn Rhizosphere | YGLMAIMGVNIKLHLVAGLALVAAYLVVLVLQAVAPSVPLFLG |
| Ga0207674_115606741 | 3300026116 | Corn Rhizosphere | AMQVSRGLEPNYDNPYGLMAIMGVNIKVHLYAGLLLIAAYLIVLLSGALAPSLNLFVG |
| Ga0207683_114147321 | 3300026121 | Miscanthus Rhizosphere | SRGLLPNYDNPYALMAFMGVNVQLHLRAGLLLFAGYVIVLVLGAIAPSVPVFIGT |
| Ga0209240_12012661 | 3300026304 | Grasslands Soil | PYGLMAVMGVNVKVHLYAGLLLLAGYLVVLIAGAVAPSVNLFLR |
| Ga0256867_102255232 | 3300026535 | Soil | ALRVHRGLRPNYDNPYGLMAVMAVNIQVHLFAGILLVAAYAIVLVAGAVAPGVPLFIR |
| Ga0209874_11430231 | 3300027577 | Groundwater Sand | LARRVSAGLAPNYDNPYGLMAFMGVNVQLHLAAGVLLVVAYGIVIAAMAVAPGVDLFLG |
| Ga0209974_100230013 | 3300027876 | Arabidopsis Thaliana Rhizosphere | ALRVSAGLEPNYDNPYGLMAIMGVNIQLHLVAGLALVAAYLVVLAVHAVAPSVPLFLG |
| Ga0302166_101469202 | 3300028652 | Fen | PYGLMAIMGVNVQLHLRAGLLLLGAYALVLVLGAVAPSVHLFIR |
| Ga0307320_104481302 | 3300028771 | Soil | AIMATNVQLHLVAGVMLLVGYLIVLIVGAIAPSVDLFVG |
| Ga0307282_100211831 | 3300028784 | Soil | PYGLMAVMGVNVKVHLYAGLLLLAGYLVVLIAGALAPSVNLFLR |
| Ga0307287_101684302 | 3300028796 | Soil | FTIPLALRVSRGLEPNYENPYGLMAIMGVNIQLHLFAGLLLLLGYALVLVVGAVAPGVPLFVR |
| Ga0307289_104484892 | 3300028875 | Soil | PNYDNPYGLMAIMGENVQLHLIAGLLLLAGYAIVIVAGAIAPGVDLFLG |
| Ga0307308_104291361 | 3300028884 | Soil | ARRVSRGLEPNYDNPYGLMAVMGVNVKVHLYAGLLLLAGYAVVLILGAVAPSVSLFVGR |
| Ga0311337_103445952 | 3300030000 | Fen | GLMAIMGVNVQLHLRAGLLLLGAYALVLVLGAVAPSVHLFIR |
| Ga0311350_120763832 | 3300030002 | Fen | YDNPYGLMAIMGVNVQLHLRAGLLLLGAYVVVLVLGAVAPSLHLFLR |
| Ga0247826_115446821 | 3300030336 | Soil | GLAPNYDNPYGLMAVMGVNIKLHLYAGVLLFAAYLIVLVLGAVAPSVPVFVSVIG |
| Ga0311335_110344471 | 3300030838 | Fen | YGLMAIMGVNVQLHLRAGLLLLGAYVVVLVLGAVAPSLHLFLR |
| Ga0299914_106757951 | 3300031228 | Soil | LLTIPLALRVHRGLRPNYDNPYGLMAVMAVNIQVHLFAGILLVAAYAIVLVAGVVAPGVPLFIR |
| Ga0307416_1003349841 | 3300032002 | Rhizosphere | YGLMAIMGVNIQVHLVAGVALVVAYVAVLVIHAVAPGVPLFLR |
| Ga0307416_1035534291 | 3300032002 | Rhizosphere | GLAPNYDNPYGLMAIMGTNVQLHLMAGLLLLAGYVVVLVAGVIAPGVDLFVG |
| Ga0307471_1029136361 | 3300032180 | Hardwood Forest Soil | AGLRPNYDNPYGLMAFMGVNVQLHLRAGLLLLAAYAIVIVLGAFAPSVPVFIGG |
| Ga0364926_018361_1058_1210 | 3300033812 | Sediment | MPNYDNPYGLMAVMGRNIKVHAYAGLLLLAAYAAVLIAGAVAPSLDLFLG |
| ⦗Top⦘ |