NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F088928

Metagenome / Metatranscriptome Family F088928

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088928
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 57 residues
Representative Sequence MTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREV
Number of Associated Samples 97
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 73.39 %
% of genes near scaffold ends (potentially truncated) 41.28 %
% of genes from short scaffolds (< 2000 bps) 72.48 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (50.459 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(16.514 % of family members)
Environment Ontology (ENVO) Unclassified
(53.211 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.156 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 73.21%    β-sheet: 0.00%    Coil/Unstructured: 26.79%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF01726LexA_DNA_bind 11.01
PF11171DUF2958 0.92
PF14528LAGLIDADG_3 0.92
PF13385Laminin_G_3 0.92



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.97 %
UnclassifiedrootN/A33.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10094266All Organisms → Viruses → Predicted Viral1269Open in IMG/M
3300000116|DelMOSpr2010_c10082529All Organisms → Viruses → Predicted Viral1267Open in IMG/M
3300000117|DelMOWin2010_c10063664All Organisms → Viruses → Predicted Viral1529Open in IMG/M
3300000149|LPaug09P1610mDRAFT_c1028972Not Available668Open in IMG/M
3300000149|LPaug09P1610mDRAFT_c1029405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197663Open in IMG/M
3300001450|JGI24006J15134_10137726Not Available818Open in IMG/M
3300001450|JGI24006J15134_10246243Not Available516Open in IMG/M
3300001472|JGI24004J15324_10131866Not Available599Open in IMG/M
3300006026|Ga0075478_10019922All Organisms → Viruses → Predicted Viral2264Open in IMG/M
3300006027|Ga0075462_10056059All Organisms → Viruses → Predicted Viral1248Open in IMG/M
3300006403|Ga0075514_1674781All Organisms → Viruses → Predicted Viral1054Open in IMG/M
3300006735|Ga0098038_1113990Not Available923Open in IMG/M
3300006749|Ga0098042_1023778All Organisms → Viruses → Predicted Viral1781Open in IMG/M
3300006867|Ga0075476_10329578Not Available531Open in IMG/M
3300006869|Ga0075477_10019473All Organisms → Viruses → Predicted Viral3154Open in IMG/M
3300006919|Ga0070746_10526368Not Available516Open in IMG/M
3300007276|Ga0070747_1270801Not Available587Open in IMG/M
3300007555|Ga0102817_1110609Not Available606Open in IMG/M
3300007623|Ga0102948_1069033All Organisms → Viruses → Predicted Viral1106Open in IMG/M
3300007725|Ga0102951_1006700All Organisms → Viruses → Predicted Viral3994Open in IMG/M
3300007778|Ga0102954_1008314All Organisms → Viruses → Predicted Viral2943Open in IMG/M
3300007956|Ga0105741_1172910Not Available531Open in IMG/M
3300007973|Ga0105746_1127083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197850Open in IMG/M
3300008999|Ga0102816_1016084All Organisms → Viruses → Predicted Viral2139Open in IMG/M
3300009000|Ga0102960_1048564All Organisms → Viruses → Predicted Viral1564Open in IMG/M
3300009000|Ga0102960_1267730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197604Open in IMG/M
3300009000|Ga0102960_1295552Not Available572Open in IMG/M
3300009001|Ga0102963_1439362Not Available512Open in IMG/M
3300009027|Ga0102957_1329637Not Available562Open in IMG/M
3300009124|Ga0118687_10070519All Organisms → Viruses → Predicted Viral1183Open in IMG/M
3300009426|Ga0115547_1205335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197620Open in IMG/M
3300009445|Ga0115553_1239345Not Available713Open in IMG/M
3300010149|Ga0098049_1260008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197527Open in IMG/M
3300011128|Ga0151669_124246All Organisms → Viruses → Predicted Viral2436Open in IMG/M
3300017717|Ga0181404_1087630Not Available767Open in IMG/M
3300017721|Ga0181373_1022741All Organisms → Viruses → Predicted Viral1167Open in IMG/M
3300017724|Ga0181388_1013265All Organisms → Viruses → Predicted Viral2110Open in IMG/M
3300017726|Ga0181381_1041591All Organisms → Viruses → Predicted Viral1018Open in IMG/M
3300017727|Ga0181401_1142532Not Available588Open in IMG/M
3300017728|Ga0181419_1006181All Organisms → Viruses → Predicted Viral3673Open in IMG/M
3300017740|Ga0181418_1128143Not Available612Open in IMG/M
3300017741|Ga0181421_1019036All Organisms → Viruses → Predicted Viral1877Open in IMG/M
3300017742|Ga0181399_1017650All Organisms → Viruses → Predicted Viral2014Open in IMG/M
3300017742|Ga0181399_1072531Not Available873Open in IMG/M
3300017748|Ga0181393_1100790Not Available744Open in IMG/M
3300017763|Ga0181410_1196748Not Available553Open in IMG/M
3300017765|Ga0181413_1257898Not Available513Open in IMG/M
3300017776|Ga0181394_1171390Not Available668Open in IMG/M
3300017782|Ga0181380_1103154Not Available988Open in IMG/M
3300017783|Ga0181379_1180160Not Available745Open in IMG/M
3300017824|Ga0181552_10017437All Organisms → Viruses → Predicted Viral4554Open in IMG/M
3300017950|Ga0181607_10461839Not Available683Open in IMG/M
3300017950|Ga0181607_10589001Not Available586Open in IMG/M
3300018416|Ga0181553_10317227Not Available864Open in IMG/M
3300018876|Ga0181564_10035700All Organisms → Viruses → Predicted Viral3526Open in IMG/M
3300019459|Ga0181562_10125471All Organisms → Viruses → Predicted Viral1424Open in IMG/M
3300019751|Ga0194029_1022509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197969Open in IMG/M
3300019756|Ga0194023_1116265Not Available544Open in IMG/M
3300020177|Ga0181596_10139008All Organisms → Viruses → Predicted Viral1145Open in IMG/M
3300020191|Ga0181604_10051979All Organisms → Viruses → Predicted Viral2394Open in IMG/M
3300020191|Ga0181604_10185345All Organisms → Viruses → Predicted Viral1022Open in IMG/M
3300020194|Ga0181597_10068428All Organisms → Viruses → Predicted Viral2106Open in IMG/M
3300020194|Ga0181597_10413878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197562Open in IMG/M
3300020347|Ga0211504_1099107Not Available657Open in IMG/M
3300020379|Ga0211652_10136341Not Available745Open in IMG/M
3300020428|Ga0211521_10177961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197982Open in IMG/M
3300020438|Ga0211576_10060320All Organisms → Viruses → Predicted Viral2148Open in IMG/M
3300020469|Ga0211577_10143893All Organisms → Viruses → Predicted Viral1612Open in IMG/M
3300021364|Ga0213859_10478557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197543Open in IMG/M
3300021365|Ga0206123_10101190All Organisms → Viruses → Predicted Viral1377Open in IMG/M
3300021373|Ga0213865_10093775All Organisms → Viruses → Predicted Viral1609Open in IMG/M
3300021957|Ga0222717_10000428Not Available36309Open in IMG/M
3300022062|Ga0224901_100817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197742Open in IMG/M
3300022074|Ga0224906_1021863All Organisms → Viruses → Predicted Viral2281Open in IMG/M
3300022167|Ga0212020_1019850All Organisms → Viruses → Predicted Viral1079Open in IMG/M
3300022909|Ga0255755_1253566Not Available638Open in IMG/M
3300022926|Ga0255753_1155329All Organisms → Viruses → Predicted Viral1024Open in IMG/M
3300022929|Ga0255752_10034173All Organisms → Viruses → Predicted Viral3421Open in IMG/M
3300023273|Ga0255763_1029736All Organisms → Viruses → Predicted Viral3034Open in IMG/M
3300023273|Ga0255763_1049290All Organisms → Viruses → Predicted Viral2159Open in IMG/M
3300024180|Ga0228668_1007075All Organisms → Viruses → Predicted Viral2929Open in IMG/M
3300024185|Ga0228669_1014388All Organisms → Viruses → Predicted Viral1945Open in IMG/M
3300024230|Ga0228638_1086072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197785Open in IMG/M
3300024267|Ga0228623_1008717All Organisms → Viruses → Predicted Viral2380Open in IMG/M
3300024297|Ga0228658_1009327All Organisms → Viruses → Predicted Viral2578Open in IMG/M
3300024314|Ga0228657_1007889All Organisms → Viruses → Predicted Viral2732Open in IMG/M
3300024314|Ga0228657_1014491All Organisms → Viruses → Predicted Viral1912Open in IMG/M
3300024334|Ga0228671_1044705All Organisms → Viruses → Predicted Viral1189Open in IMG/M
3300024420|Ga0228632_1109008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197647Open in IMG/M
3300025048|Ga0207905_1025433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197974Open in IMG/M
3300025086|Ga0208157_1101666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197690Open in IMG/M
3300025101|Ga0208159_1037094All Organisms → Viruses → Predicted Viral1072Open in IMG/M
3300025102|Ga0208666_1062006All Organisms → Viruses → Predicted Viral1011Open in IMG/M
3300025120|Ga0209535_1117765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197911Open in IMG/M
3300025120|Ga0209535_1188936Not Available596Open in IMG/M
3300025137|Ga0209336_10171772Not Available556Open in IMG/M
3300025138|Ga0209634_1081606All Organisms → Viruses → Predicted Viral1484Open in IMG/M
3300025671|Ga0208898_1155903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197610Open in IMG/M
3300025815|Ga0208785_1052593All Organisms → Viruses → Predicted Viral1134Open in IMG/M
3300026125|Ga0209962_1029263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197972Open in IMG/M
3300026479|Ga0228622_1010458All Organisms → Viruses → Predicted Viral2947Open in IMG/M
(restricted) 3300027837|Ga0255041_10390045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197512Open in IMG/M
3300028115|Ga0233450_10058763All Organisms → Viruses → Predicted Viral2249Open in IMG/M
3300028197|Ga0257110_1003179Not Available7588Open in IMG/M
3300028418|Ga0228615_1015563All Organisms → Viruses → Predicted Viral2723Open in IMG/M
3300028419|Ga0228625_1025435All Organisms → Viruses → Predicted Viral1435Open in IMG/M
3300029448|Ga0183755_1001374Not Available13868Open in IMG/M
3300029448|Ga0183755_1009821All Organisms → Viruses → Predicted Viral3848Open in IMG/M
3300032277|Ga0316202_10015307All Organisms → Viruses → Predicted Viral3839Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater16.51%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh15.60%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine13.76%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater12.84%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.17%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.42%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water4.59%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water3.67%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.75%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.83%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine1.83%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.83%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.83%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.83%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.92%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.92%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.92%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.92%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.92%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.92%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000149Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10mEnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300011128Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300020177Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020191Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020194Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022062Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300022909Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaGEnvironmentalOpen in IMG/M
3300022926Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaGEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023273Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaGEnvironmentalOpen in IMG/M
3300024180Seawater microbial communities from Monterey Bay, California, United States - 82DEnvironmentalOpen in IMG/M
3300024185Seawater microbial communities from Monterey Bay, California, United States - 84DEnvironmentalOpen in IMG/M
3300024230Seawater microbial communities from Monterey Bay, California, United States - 48DEnvironmentalOpen in IMG/M
3300024267Seawater microbial communities from Monterey Bay, California, United States - 28DEnvironmentalOpen in IMG/M
3300024297Seawater microbial communities from Monterey Bay, California, United States - 71DEnvironmentalOpen in IMG/M
3300024314Seawater microbial communities from Monterey Bay, California, United States - 70DEnvironmentalOpen in IMG/M
3300024334Seawater microbial communities from Monterey Bay, California, United States - 89DEnvironmentalOpen in IMG/M
3300024420Seawater microbial communities from Monterey Bay, California, United States - 40DEnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026125Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026479Seawater microbial communities from Monterey Bay, California, United States - 26DEnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300028115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly)EnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300028418Seawater microbial communities from Monterey Bay, California, United States - 16DEnvironmentalOpen in IMG/M
3300028419Seawater microbial communities from Monterey Bay, California, United States - 30DEnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1009426623300000101MarineMTKLPWHFELIDKNKAKAHEDRQEMKRELNKFIDKCNSYELVRMYSEYKRLKREL*
DelMOSpr2010_1008252933300000116MarineMTELTXKHFEVIDKNKAXAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREV*
DelMOWin2010_1006366453300000117MarineMTELTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYSEFKRLRREV*
LPaug09P1610mDRAFT_102897233300000149MarineMTELTLKHLEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQKIYSEFKRLRREV*
LPaug09P1610mDRAFT_102940543300000149MarineMTELTPKHFEVIDKNKAKAYEDRQEMKREINKFIAKCNSYELVRIYCEVKRLKREL*
JGI24006J15134_1013772613300001450MarinePKHFEVIDKNKAKAYEDRQEMKREINKFIAKCNSYELVRIYCEVKRLKREL*
JGI24006J15134_1024624323300001450MarineMTELTLKHLEVIDKNKAKAYEDRQEMKREINKFIDKCNSYELQRMYSEFKRLRREI*
JGI24004J15324_1013186623300001472MarineMTELTPKHFEVIDKNKAKAYEDRXEMKREXNKFIXKCNSYELVXXYSEFKRLRREV*
Ga0075478_1001992273300006026AqueousMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREV*
Ga0075462_1005605933300006027AqueousMTELTLKHFEVIDKNKAKAYEDRKEMKKELKEFINKCNSYELQRMYSEFKRLRREV*
Ga0075514_167478163300006403AqueousMTELTLKHFEVIDKNKAKAYEDRKEMKKELKEFINKCNSYELQRMYSEFKRLRREV*K
Ga0098038_111399023300006735MarineMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYSEFKRLRRGV*
Ga0098042_102377873300006749MarineMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYSEFKRLRRGV*KNKQKQLMLR*
Ga0075476_1032957823300006867AqueousMTELTLKHFEVIDKNKAKAYEDRKEMKKELKEFINKCNSYELQRMYSEFKRLRREA*
Ga0075477_1001947333300006869AqueousMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREV*KRKK*
Ga0070746_1052636823300006919AqueousMTELTLKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYSEFKRLRREV*
Ga0070747_127080123300007276AqueousHFEVIDKNKAKAHEDRKEMKKELTEFIDKCNAYELQRMYSEFKRLRREV*
Ga0102817_111060923300007555EstuarineMTELTPKHFEVIDKNKAKAYEDRQEMKREINKFIDKCNSYELQRMYSEFKRLRREI*
Ga0102948_106903363300007623WaterMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYAEFKRLRREV*
Ga0102951_100670073300007725WaterMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYSEFKRLRREV*
Ga0102954_100831493300007778WaterMTTLTPTHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYAEFKRLRREV*
Ga0105741_117291033300007956Estuary WaterVIDKNKAKAYEDRQEMKREINKFIDKCNSYELQRMYSEFKRLRREI*
Ga0105746_112708353300007973Estuary WaterMTELTPKHFEVIDENKAKAQEDRKQMRDEVAFFIFNCNSYELQRMYSEYKRLRREV*
Ga0102816_101608433300008999EstuarineMTELTPKHFEVIGKNKAKAYEDRQEMKREINKFIDKCNSYELQRMYSEFKRLRREV*
Ga0102960_104856413300009000Pond WaterGGVTNMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKRNAYELQRMYSEFKRLRREV*
Ga0102960_126773033300009000Pond WaterMTTLTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFKRLRREV*
Ga0102960_129555233300009000Pond WaterGGVTNMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYAEFKRLRREV*
Ga0102963_143936233300009001Pond WaterPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYAEFKRLRREV*
Ga0102957_132963713300009027Pond WaterPTHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYAEFKRLRREV*
Ga0118687_1007051923300009124SedimentMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYEIQRMYSEFKRLRREV*
Ga0115547_120533513300009426Pelagic MarineMTELTLKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREA*
Ga0115553_123934523300009445Pelagic MarineMTELTLKHFEVIDKNKAKAYEDRKEMKKELKKFIDECNAYELQKIYSECKRLRREV*
Ga0098049_126000813300010149MarineMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFKRLRREV*
Ga0151669_124246113300011128MarineMTELTLKHFEVIDKNKAKAYEDRKEMKKELKEFIDKCNAYELQKIYSEFKRLRREV*
Ga0181404_108763033300017717SeawaterIRDTRGVNNMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYSEFKRLRREV
Ga0181373_102274123300017721MarineMTELTPKHFEVIDKNKAKAYEDRQEMKREINKFIAKCNSYELVRIYCEVKRLKRELXKNKHKQLMLQ
Ga0181388_101326523300017724SeawaterMTTLTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYSEFKRLRREV
Ga0181381_104159143300017726SeawaterVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYAEFKRLRREV
Ga0181401_114253223300017727SeawaterMTTLTPKHFEVIDKNKAKAQEDRKQMRDEIAFFIFNCNSYELQRMYSEYKRLRREV
Ga0181419_100618113300017728SeawaterGVNNMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFKRLRREV
Ga0181418_112814313300017740SeawaterLLIRDTRGVNNMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYSEFKRLRREV
Ga0181421_101903653300017741SeawaterMTELTPKHFEVIDKNKAKAHEDKKEMKKELTEFIDKCNSYELQRMYAEFKRLRREV
Ga0181399_101765023300017742SeawaterMTELTPKHFEVIDKNKAKAQEDRKQMRDEVAFFIFNCNSYELQRMYSEYKRLRREV
Ga0181399_107253133300017742SeawaterMTTLTPKHFEVIDKNKAKAQEDRKQMRDEVAFFILNCNSYELQRMYSEFKRLRREV
Ga0181393_110079033300017748SeawaterMTTLTPKHFEVIDKNKAKAYEDKKEMKKELTEFIDKCNAYELQRMYAEFKRLRREV
Ga0181410_119674813300017763SeawaterMTELTPKHFEVIDKNKAKAYEDRQEMKREINKFVAKCNSYELVRIYCEVKRLKREL
Ga0181413_125789813300017765SeawaterDTRGVNNMTELTPKHFEVIDKNKAKAYEDRKEMKRELNKFIAKCNSYELVRIYCEVKRLKRELXKTPL
Ga0181394_117139033300017776SeawaterLIRDTRGVNNMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFKRLRREV
Ga0181380_110315413300017782SeawaterEVIDKNKAKAYEDRQEMKREINKFIAKCNSYELVRIYCEVKRLKREL
Ga0181379_118016033300017783SeawaterLIRDTRGVNNMTELTPKHFEVIDKNKAKAHEDRKQMRDEVASFILNCNSYELQRMYSEFKRLRREV
Ga0181552_1001743713300017824Salt MarshVNNMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREV
Ga0181607_1046183923300017950Salt MarshMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREV
Ga0181607_1058900123300017950Salt MarshMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYSEFKRLRREV
Ga0181553_1031722723300018416Salt MarshMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQKIYSEFKRLRREV
Ga0181564_1003570033300018876Salt MarshMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREVXKRK
Ga0181562_1012547123300019459Salt MarshMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQKIYSEFKRLRREVXVIVMTMN
Ga0194029_102250933300019751FreshwaterMTELTLKHFEVIDKNKAKAYEDRKEMKKELKEFINKCNSYELQRMYSEFKRLRREV
Ga0194023_111626533300019756FreshwaterMTELTLKHFEVIDKNKAKAYEDRKEMKKELKEFINKCNSYELQRIYSEFKRLRREV
Ga0181596_1013900863300020177Salt MarshMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREVXVIV
Ga0181604_1005197913300020191Salt MarshPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYSEFKRLRREV
Ga0181604_1018534513300020191Salt MarshMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREVXNIG
Ga0181597_1006842813300020194Salt MarshGVNNMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYSEFKRLRREV
Ga0181597_1041387833300020194Salt MarshMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRL
Ga0211504_109910733300020347MarineELTPKHFEVIDKNKAKAYEDRQEMKRELNKFIDKCNSYELVRMYSEFKRLKREV
Ga0211652_1013634113300020379MarineRSWMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYSEFKRLRRGV
Ga0211521_1017796153300020428MarineMTKLPWHFELIDRNKAKAHEDRQEMKRELNKFIDKCNSYELVRMYSEFKRLKREIXLKK
Ga0211576_1006032083300020438MarineMTTLTPKHFEVIDKNKAKAQEDRKQMRDEVAFFIFNCNSYELQRMYSEYKRLRREV
Ga0211577_1014389363300020469MarineMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYSEFKRLRREV
Ga0213859_1047855733300021364SeawaterMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSE
Ga0206123_1010119023300021365SeawaterMTELTLKHFEVIDKNKAKAYEDRKEMKKELKKFIDECNAYELQKIYSEFKRLRREV
Ga0213865_1009377533300021373SeawaterMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFVLNCNSYELQRMYSEFKRLRREA
Ga0222717_10000428423300021957Estuarine WaterMTELTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYSEFKRLRREV
Ga0224901_10081743300022062SeawaterMTELTPKHFEVIDKNKAKAHEDKKQMRDEVAFFTLNCNSYELQRMYAEFKRLR
Ga0224906_102186383300022074SeawaterMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFKRLRREV
Ga0212020_101985013300022167AqueousTLKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREV
Ga0255755_125356613300022909Salt MarshNNMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQKIYSEFKRLRREV
Ga0255753_115532943300022926Salt MarshKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREV
Ga0255752_1003417313300022929Salt MarshGVNNMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREV
Ga0255763_102973613300023273Salt MarshNMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLRREV
Ga0255763_104929013300023273Salt MarshMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNSYELQRMYSEFKRLR
Ga0228668_100707523300024180SeawaterMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFKRLRREVXKNKQKQLVLR
Ga0228669_101438883300024185SeawaterMTELTPKHFEVIDKNKAKAHEDRKQMRDEIAFFILNCNSYELQRMYAEFKRLRREVXKNKQKQLVLR
Ga0228638_108607213300024230SeawaterMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFKRLRRE
Ga0228623_100871713300024267SeawaterMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFKRLRREVXNIGCVNF
Ga0228658_1009327123300024297SeawaterMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFKRLRREVXLKK
Ga0228657_1007889103300024314SeawaterTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYSEFKRLRREV
Ga0228657_101449113300024314SeawaterMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFKRLRR
Ga0228671_104470513300024334SeawaterMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFKRLRREVXKNKQKQLV
Ga0228632_110900813300024420SeawaterMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFIFNCNSYELQRMYSEYKRLRREVXSIGCV
Ga0207905_102543343300025048MarineMTELTPKHFEVIDKNKAKAYEDRQEMKREINKFIAKCNSYELVRIYCEVKRLKREL
Ga0208157_110166633300025086MarineMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYSEYKRLRREV
Ga0208159_103709423300025101MarineMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYSEFKRLRRGVXKNKQKQLMLR
Ga0208666_106200613300025102MarineNMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYSEFKRLRRGV
Ga0209535_111776533300025120MarineMTELTPKHFEVIDKNKAKAYEDRQEMKREINKFIDKCNSYELQRMYSEFKRLRREI
Ga0209535_118893633300025120MarineMTELTLKHLEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQKIYSEFKRLRREV
Ga0209336_1017177233300025137MarineLIRDTRGVNNMTELTLKHLEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQKIYSEFKRLRREV
Ga0209634_108160663300025138MarineMTELTLKHLEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQKIYSEFKRLRREVXLKK
Ga0208898_115590323300025671AqueousMTELTLKHFEVIDKNKAKAYEDRKEMKKELKEFINKCNSYELQRMYSEFKRLRREA
Ga0208785_105259353300025815AqueousMTELTPKHFEVIDKNKAKAYEDRKEMKKELKEFIDKCNAYELQKIYSEFKRLRREV
Ga0209962_102926333300026125WaterMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQRMYAEFKRLRREV
Ga0228622_101045813300026479SeawaterMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFKRLRREVXKNK
(restricted) Ga0255041_1039004523300027837SeawaterMTTLTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFLRLRREV
Ga0233450_1005876313300028115Salt MarshGVNNMTTLTPKHFEVIDKNKAKAYEDRKEMKKELTEFIDKCNAYELQKIYSEFKRLRREV
Ga0257110_100317913300028197MarineMTELTLKHLEVIDKNKAKAYEDRQEMKREINKFIDKCNSYELQRMYSEFKRLRREIXNIGCVNFTNKMVSM
Ga0228615_101556313300028418SeawaterMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYAEFKRLRREVXN
Ga0228625_102543513300028419SeawaterMTELTPKHFEVIDKNKAKAHEDRKQMRDEVAFFILNCNSYELQRMYSEFKRLRREVXKRK
Ga0183755_1001374313300029448MarineMTKLPWHFELIDKNKAKAHEDRQEMKRELNKFIDKCNSYELVRMYSEFKRLKREI
Ga0183755_1009821143300029448MarineMTKLPWHFELIDRNKAKAHEDRQEMKRELNKFIDKCNSYELVRMYSEFKRLKRELXKTPL
Ga0316202_1001530773300032277Microbial MatMTKLPWHFELIDKNKAKAHEDRQEMKRELNKFIDKCNSYELVRMYSEYKRLKREI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.