| Basic Information | |
|---|---|
| Family ID | F088895 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 47 residues |
| Representative Sequence | LKEELSKAKHDRDRKAIRRIIADARKLNKTLKEMRNANTKLCPHCGEKL |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.74 % |
| % of genes near scaffold ends (potentially truncated) | 94.50 % |
| % of genes from short scaffolds (< 2000 bps) | 86.24 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (42.202 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.266 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.716 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.972 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.75% β-sheet: 2.60% Coil/Unstructured: 50.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF10276 | zf-CHCC | 4.59 |
| PF00768 | Peptidase_S11 | 3.67 |
| PF06941 | NT5C | 2.75 |
| PF03819 | MazG | 1.83 |
| PF07460 | NUMOD3 | 0.92 |
| PF01258 | zf-dskA_traR | 0.92 |
| PF00149 | Metallophos | 0.92 |
| PF01145 | Band_7 | 0.92 |
| PF01068 | DNA_ligase_A_M | 0.92 |
| PF02796 | HTH_7 | 0.92 |
| PF04055 | Radical_SAM | 0.92 |
| PF00012 | HSP70 | 0.92 |
| PF02634 | FdhD-NarQ | 0.92 |
| PF11416 | Syntaxin-5_N | 0.92 |
| PF11750 | DUF3307 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 3.67 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 2.75 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.92 |
| COG1526 | Formate dehydrogenase assembly factor FdhD, a sulfurtransferase | Energy production and conversion [C] | 0.92 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.92 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.80 % |
| Unclassified | root | N/A | 42.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10148497 | Not Available | 582 | Open in IMG/M |
| 3300002161|JGI24766J26685_10039175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1099 | Open in IMG/M |
| 3300002408|B570J29032_109673991 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300002835|B570J40625_101367550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300003393|JGI25909J50240_1017439 | All Organisms → Viruses → Predicted Viral | 1679 | Open in IMG/M |
| 3300003393|JGI25909J50240_1048589 | Not Available | 886 | Open in IMG/M |
| 3300003412|JGI25912J50252_10131660 | Not Available | 583 | Open in IMG/M |
| 3300003497|JGI25925J51416_10072404 | Not Available | 864 | Open in IMG/M |
| 3300004096|Ga0066177_10035319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1703 | Open in IMG/M |
| 3300004123|Ga0066181_10108766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300004126|Ga0066179_10196765 | Not Available | 562 | Open in IMG/M |
| 3300005517|Ga0070374_10195064 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300005580|Ga0049083_10286748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300005581|Ga0049081_10249674 | Not Available | 623 | Open in IMG/M |
| 3300005584|Ga0049082_10020576 | All Organisms → Viruses → Predicted Viral | 2286 | Open in IMG/M |
| 3300005662|Ga0078894_11372411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300005941|Ga0070743_10122749 | Not Available | 869 | Open in IMG/M |
| 3300006484|Ga0070744_10035045 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
| 3300006484|Ga0070744_10235240 | Not Available | 519 | Open in IMG/M |
| 3300007549|Ga0102879_1150289 | Not Available | 712 | Open in IMG/M |
| 3300007559|Ga0102828_1097441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300007600|Ga0102920_1318221 | Not Available | 502 | Open in IMG/M |
| 3300007603|Ga0102921_1263711 | Not Available | 616 | Open in IMG/M |
| 3300007622|Ga0102863_1122367 | Not Available | 765 | Open in IMG/M |
| 3300007644|Ga0102902_1242040 | Not Available | 530 | Open in IMG/M |
| 3300008110|Ga0114343_1160831 | Not Available | 702 | Open in IMG/M |
| 3300008110|Ga0114343_1231979 | Not Available | 508 | Open in IMG/M |
| 3300008111|Ga0114344_1139427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
| 3300008111|Ga0114344_1158765 | Not Available | 1218 | Open in IMG/M |
| 3300008120|Ga0114355_1066939 | Not Available | 2742 | Open in IMG/M |
| 3300008261|Ga0114336_1000310 | Not Available | 41953 | Open in IMG/M |
| 3300009086|Ga0102812_10570449 | Not Available | 620 | Open in IMG/M |
| 3300009151|Ga0114962_10686605 | Not Available | 524 | Open in IMG/M |
| 3300009159|Ga0114978_10731604 | Not Available | 562 | Open in IMG/M |
| 3300009161|Ga0114966_10587635 | Not Available | 623 | Open in IMG/M |
| 3300010157|Ga0114964_10047373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2269 | Open in IMG/M |
| 3300010354|Ga0129333_11536571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300012000|Ga0119951_1073491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
| 3300012663|Ga0157203_1001536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5620 | Open in IMG/M |
| 3300012663|Ga0157203_1045785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300012663|Ga0157203_1048398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300012665|Ga0157210_1062310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300013372|Ga0177922_10331922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 601 | Open in IMG/M |
| 3300013372|Ga0177922_11255053 | Not Available | 759 | Open in IMG/M |
| 3300017722|Ga0181347_1075874 | Not Available | 986 | Open in IMG/M |
| 3300017723|Ga0181362_1083579 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300017761|Ga0181356_1159306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300017774|Ga0181358_1074011 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300017777|Ga0181357_1171589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300017780|Ga0181346_1281919 | Not Available | 569 | Open in IMG/M |
| 3300017784|Ga0181348_1112137 | All Organisms → Viruses → Predicted Viral | 1055 | Open in IMG/M |
| 3300017784|Ga0181348_1135207 | Not Available | 935 | Open in IMG/M |
| 3300017784|Ga0181348_1304859 | All Organisms → Viruses | 532 | Open in IMG/M |
| 3300020160|Ga0211733_10909448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1218 | Open in IMG/M |
| 3300020161|Ga0211726_11014560 | Not Available | 966 | Open in IMG/M |
| 3300020172|Ga0211729_11192725 | Not Available | 1104 | Open in IMG/M |
| 3300020172|Ga0211729_11314398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300020172|Ga0211729_11318139 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 953 | Open in IMG/M |
| 3300020172|Ga0211729_11354553 | Not Available | 570 | Open in IMG/M |
| 3300020205|Ga0211731_10015875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1314 | Open in IMG/M |
| 3300020205|Ga0211731_10063857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300020205|Ga0211731_11583852 | Not Available | 515 | Open in IMG/M |
| 3300020572|Ga0207909_1020555 | All Organisms → Viruses → Predicted Viral | 1191 | Open in IMG/M |
| 3300022555|Ga0212088_10636661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300024346|Ga0244775_10102634 | All Organisms → Viruses → Predicted Viral | 2431 | Open in IMG/M |
| 3300024348|Ga0244776_10705094 | Not Available | 623 | Open in IMG/M |
| 3300025162|Ga0209083_1271042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300027146|Ga0255104_1009726 | All Organisms → Viruses → Predicted Viral | 1955 | Open in IMG/M |
| 3300027148|Ga0255115_1076688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300027212|Ga0208554_1044672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 704 | Open in IMG/M |
| 3300027333|Ga0255138_1067749 | Not Available | 596 | Open in IMG/M |
| 3300027586|Ga0208966_1065588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1021 | Open in IMG/M |
| 3300027596|Ga0255119_1066568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300027608|Ga0208974_1054055 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
| 3300027631|Ga0208133_1025212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1513 | Open in IMG/M |
| 3300027631|Ga0208133_1097256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300027707|Ga0209443_1168874 | Not Available | 786 | Open in IMG/M |
| 3300027769|Ga0209770_10263191 | Not Available | 665 | Open in IMG/M |
| 3300027769|Ga0209770_10373748 | Not Available | 531 | Open in IMG/M |
| 3300027797|Ga0209107_10041030 | All Organisms → Viruses → Predicted Viral | 2635 | Open in IMG/M |
| 3300027797|Ga0209107_10154466 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300027797|Ga0209107_10258388 | Not Available | 835 | Open in IMG/M |
| 3300027797|Ga0209107_10426624 | Not Available | 600 | Open in IMG/M |
| 3300027805|Ga0209229_10340209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300027836|Ga0209230_10693497 | Not Available | 562 | Open in IMG/M |
| 3300027836|Ga0209230_10716093 | Not Available | 550 | Open in IMG/M |
| 3300028394|Ga0304730_1294601 | Not Available | 562 | Open in IMG/M |
| 3300031784|Ga0315899_11305649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300031857|Ga0315909_10422449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 947 | Open in IMG/M |
| 3300032050|Ga0315906_10479805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1058 | Open in IMG/M |
| 3300032093|Ga0315902_10114215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2893 | Open in IMG/M |
| 3300033993|Ga0334994_0400254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Lake Baikal phage Baikal-20-5m-C28 | 664 | Open in IMG/M |
| 3300034062|Ga0334995_0737024 | Not Available | 549 | Open in IMG/M |
| 3300034064|Ga0335001_0407173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
| 3300034066|Ga0335019_0406942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Lake Baikal phage Baikal-20-5m-C28 | 831 | Open in IMG/M |
| 3300034071|Ga0335028_0569767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300034082|Ga0335020_0001115 | Not Available | 19278 | Open in IMG/M |
| 3300034082|Ga0335020_0277606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300034093|Ga0335012_0002320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11935 | Open in IMG/M |
| 3300034101|Ga0335027_0904371 | Not Available | 501 | Open in IMG/M |
| 3300034102|Ga0335029_0090256 | All Organisms → Viruses → Predicted Viral | 2177 | Open in IMG/M |
| 3300034105|Ga0335035_0039400 | All Organisms → Viruses → Predicted Viral | 3137 | Open in IMG/M |
| 3300034117|Ga0335033_0048989 | All Organisms → Viruses → Predicted Viral | 2587 | Open in IMG/M |
| 3300034117|Ga0335033_0477800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300034119|Ga0335054_0325057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 897 | Open in IMG/M |
| 3300034356|Ga0335048_0110367 | All Organisms → Viruses → Predicted Viral | 1637 | Open in IMG/M |
| 3300034356|Ga0335048_0441790 | Not Available | 636 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.84% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.26% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.50% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.50% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.50% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.59% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 4.59% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 3.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.67% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.92% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.92% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025162 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027146 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027148 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027333 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027596 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_101484971 | 3300000756 | Freshwater And Sediment | KHERDRKIIKSHLTDARKLNKTLKEMRKVNTKLCPHCGEKL* |
| JGI24766J26685_100391755 | 3300002161 | Freshwater And Sediment | AIRRIISDARKLNKTLKEMRNATTKLCPHCGEKL* |
| B570J29032_1096739911 | 3300002408 | Freshwater | RDRKSIRRIIADSRKLNKTLKEMRNATTKLCPHCGEKL* |
| B570J40625_1013675501 | 3300002835 | Freshwater | HLKEELSKAKGERDRKSIRRIIADARKLNKTLKGMRNANTKLCPHCGEKL* |
| JGI25909J50240_10174396 | 3300003393 | Freshwater Lake | AELSKDKHERNRKWLKIQLRDAKALGKTVKEMRTANTKLCPHCGEKL* |
| JGI25909J50240_10485893 | 3300003393 | Freshwater Lake | QKMKLHIKEELDKVKSDRDRKSIRRITSDARKLNKTLKEMRHASAKKCPHCGEKL* |
| JGI25912J50252_101316603 | 3300003412 | Freshwater Lake | KMKLHLKAELSKDKHDRNRKWIKIQLSDARKLNKTLKEMRSVTTKLCPHCGEKL* |
| JGI25925J51416_100724044 | 3300003497 | Freshwater Lake | SKTKHDRDRKAIRKITADARKLNKTLKEMRNATTKLCPHCGEKL* |
| Ga0066177_100353196 | 3300004096 | Freshwater Lake | GRLTKMKLHLKEELSKAKGERNRKLIKSQLADAKKLNRTLKEMRNANTKLCPHCGEKL* |
| Ga0066181_101087664 | 3300004123 | Freshwater Lake | GRLTKMKLHLKAELSKDKHERNRKWLKIQLRDAKALGKTVKEMRTANTKLCPHCGEKL* |
| Ga0066179_101967653 | 3300004126 | Freshwater Lake | GRLNKMKLHLKEELGKAKHDRDRKAIRRITTDARKLNKTLKEMRNANTKLCPHCGEKL* |
| Ga0070374_101950641 | 3300005517 | Freshwater Lake | RKAIRRLTADARKLAKTLKEMRNASAKNCPHCGEKL* |
| Ga0049083_102867481 | 3300005580 | Freshwater Lentic | KEELSKAKGERDRKAIRRITADAKKLNKTLKDMRTANTRLCPHCGEKL* |
| Ga0049081_102496744 | 3300005581 | Freshwater Lentic | KMKLHIKEELDKVKSDRDRKSIRRITADARKLNKTLKEMRNASAKKCPHCGEKL* |
| Ga0049082_100205761 | 3300005584 | Freshwater Lentic | HLKAELSKDKHERNRKWLKSQLRETKALGKTVKEMRNANTKLCPHCGEKLI* |
| Ga0078894_113724112 | 3300005662 | Freshwater Lake | HLKEELTKAKSDRDRKSIRRITADARKLNKSLKEMRSATTRLCPHCGEKL* |
| Ga0070743_101227491 | 3300005941 | Estuarine | LNKMKLHLKEELTKAKDDRDRKAIRRIIADARKLNKTLKEMRNANTKLCPHCGEKL* |
| Ga0070744_100350451 | 3300006484 | Estuarine | KAKGDRDRRTIRRITADARKLNRTLKEMRSATTRLCPHCGEKL* |
| Ga0070744_102352401 | 3300006484 | Estuarine | GKVKSERNRKMIKNHLSDARKLNRTLKEMRQANTRLCPHCGEKL* |
| Ga0102879_11502891 | 3300007549 | Estuarine | LKAELSKAKHERDKQAIKRIVVDARKLNRTLKEMRKANTRLCPHCGEKM* |
| Ga0102828_10974414 | 3300007559 | Estuarine | FEGRLNKMKLHLKEELSKAKGERDRKAIRRITADAKKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0102920_13182211 | 3300007600 | Estuarine | KAIRRTVTDARKLNKTLKEMRNANTKLCPHCGEKL* |
| Ga0102921_12637111 | 3300007603 | Estuarine | ERDKKAIRRTVTDARKLNKTLKEMRNANTKLCPHCGEKL* |
| Ga0102863_11223671 | 3300007622 | Estuarine | KEELGKAKSDRDRKSIRRSIADARKLNKTLKEMRNAATKLCPHCGEKL* |
| Ga0102902_12420402 | 3300007644 | Estuarine | KQAIKRIVVDARKLNRTLKEMRKANTRLCPHCGEKL* |
| Ga0114343_11608311 | 3300008110 | Freshwater, Plankton | KEELTKAKSDRDRKSIRRSIADARKLNKTLKEMRNANTKLCPHCGEKL* |
| Ga0114343_12319792 | 3300008110 | Freshwater, Plankton | KSIRRITTDARKLNKTLKEMRNAATKLCPHCGEKL* |
| Ga0114344_11394271 | 3300008111 | Freshwater, Plankton | ELDKAKSERDRRAIRRITADARKLNKTLKEMRNASATKCPHCGEKL* |
| Ga0114344_11587651 | 3300008111 | Freshwater, Plankton | RDRKSIRRLTADARKLNKTLKEMRNAAVKKCPHCGEKL* |
| Ga0114355_10669399 | 3300008120 | Freshwater, Plankton | RKSIRRSIADARKLNKTLKEMRNADTKLCPHCGEKL* |
| Ga0114336_10003106 | 3300008261 | Freshwater, Plankton | MKLHLKEELAKAKHERDRKSIRRLTADARKLNKTLKEMRNAAVKKCPHCGEKL* |
| Ga0102812_105704493 | 3300009086 | Estuarine | HLKAELGKAKHERDRKIIKRHLFDARRLNKTLKEMRNANTKLCPHCGEKL* |
| Ga0114962_106866051 | 3300009151 | Freshwater Lake | NKAKSDRDRKNMRRLTADARKLNKTLKEMRTASAKRCPHCGEKL* |
| Ga0114978_107316041 | 3300009159 | Freshwater Lake | DRKIIKSHLTDARKLNKTLKEMRKANTKLCPHCGEKL* |
| Ga0114966_105876351 | 3300009161 | Freshwater Lake | MKLHLKAELSKAKHERDKQAIKRIVVDARKLNRTLKEMRKANTRLCPHCGEKL* |
| Ga0114975_104622191 | 3300009164 | Freshwater Lake | RDRKNMRSLLSYARKLNRTLKEMRNVSAKKCPHCGERL* |
| Ga0114964_100473731 | 3300010157 | Freshwater Lake | RDRNMIKRQLSDARKLNRTLKEMRNTNTKRCPHCGEKL* |
| Ga0129333_115365713 | 3300010354 | Freshwater To Marine Saline Gradient | KAKHERDKKAIRRIVYDARKLNKTLKEMRNSAAKKCPHCGEKI* |
| Ga0119951_10734911 | 3300012000 | Freshwater | QKMKLHLKGELAKAKHERDKKAIRRIVYDARKLNKTLKEMRNVAAKRCPHCGEKL* |
| Ga0157203_100153615 | 3300012663 | Freshwater | RLNKMKLHLKEELSKAKHDRDRKAIRRIITDARKLNKTLKEMRNANTKLCPHCGEKL* |
| Ga0157203_10457852 | 3300012663 | Freshwater | AKHDRDRKSIRRITADARKLNKTLKEMRNAATKLCPHCGEKL* |
| Ga0157203_10483981 | 3300012663 | Freshwater | GRLNKMKLHLKEELGKAKHDRDRKAIRRITADARKLNRTLKEMRNSTAKLCPHCGEKL* |
| Ga0157210_10623102 | 3300012665 | Freshwater | KGERDRKAIRRIIADARKLNKTLKEMRNANTKMCPHCGEKL* |
| Ga0177922_103319222 | 3300013372 | Freshwater | LNKMKLHLKAELSKVKHERDKKTIKRIVADARKLNKTLKEMRQVATKLCPHCGEKI* |
| Ga0177922_112550531 | 3300013372 | Freshwater | KGERDRKAIRRIIADARKLNKTLKEMRNANTKLCPHCGEKL* |
| Ga0181347_10758744 | 3300017722 | Freshwater Lake | KMKLHIKEELDKVKSDRDRKSIRRITADARKLNKTLKEMRNASAKKCPHCGEKL |
| Ga0181362_10835791 | 3300017723 | Freshwater Lake | LSKAKSDRNRKAIRRLTADARKLAKTLKEMRNASAKNCPHCGEKL |
| Ga0181356_11593061 | 3300017761 | Freshwater Lake | RLNKMKLHLKEELSKAKGERDRKAIRRITADAKKLNKTLKDMRTANTRLCPHCGEKL |
| Ga0181358_10740113 | 3300017774 | Freshwater Lake | FEGRLTKMKLHLKAELSKAKSDRNRKAIRRLTADARKLAKTLKEMRNASAKNCPHCGEKL |
| Ga0181357_11715894 | 3300017777 | Freshwater Lake | LHLKEELGKAKSDRDRKNMRRLISDARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0181346_12819191 | 3300017780 | Freshwater Lake | IFEGRLQKMKLHIKEELDKVKSDRDRKSIRRITADARKLNRTLKEMRNASAKKCPHCGEK |
| Ga0181348_11121371 | 3300017784 | Freshwater Lake | ELSKAKGERNRKLIKSQLADAKKLNRTLKEMRNANTKLCPHCGEKL |
| Ga0181348_11352071 | 3300017784 | Freshwater Lake | IKEELDKVKSDRDRKSIRRITADARKLNKTLKEMRNASAKKCPHCGEKL |
| Ga0181348_13048591 | 3300017784 | Freshwater Lake | SKAKHQRDKTSIRRQLVAARKLNKTLKEARKVNVKRCPHCGEKL |
| Ga0211733_109094481 | 3300020160 | Freshwater | DRKAIRRIIADARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0211726_110145601 | 3300020161 | Freshwater | KEELGKAKHDRDRKAIRRITADARKLNRTLKEMRNVNTKLCPHCGEKL |
| Ga0211729_111927254 | 3300020172 | Freshwater | GRLQKMKLHLKEELGKAKSDRDRKSIRRITADARKLNRTLKEMRNAAAKKCPHCGEKL |
| Ga0211729_113143981 | 3300020172 | Freshwater | LHLKEELGKAKHDRDRKSIRRITADARKLNRTLKEMRNVSVKLCPHCGERL |
| Ga0211729_113181391 | 3300020172 | Freshwater | MKLHLKAELSKAKHERNRKLIKSQLSDAKKLNRTLKEMRNANTRLCPHCGEKL |
| Ga0211729_113545533 | 3300020172 | Freshwater | EELSKVKSDRDRKAIKRITADARKLNKTLKEMRNASAKKCPHCGEKL |
| Ga0211731_100158751 | 3300020205 | Freshwater | HLKEELSKAKHDRDRKAIRRFTADARKLNRTLKEMRNASAKKCPHCGEKL |
| Ga0211731_100638571 | 3300020205 | Freshwater | KSKHERNRKMIKSQLSDARKLNKTLKEMRNANTKRCPHCGEKL |
| Ga0211731_114417351 | 3300020205 | Freshwater | RDRKSIRRILYDARKLNKTIKEMRNVSTKKCPHCGEKI |
| Ga0211731_115838521 | 3300020205 | Freshwater | KEELGKAKHERDRKWIKHQLSDAKKLNRTLKEMRNASAKKCPHCGERL |
| Ga0207909_10205551 | 3300020572 | Freshwater | GRLNKMKLHLKEELGKAKGERNRRLIKSQLADAKKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0212088_106366613 | 3300022555 | Freshwater Lake Hypolimnion | MKSHLKKELEKSKHERDRKAIRHQLNDARKLNRTLKEMRSLTTKHCPHCGEKI |
| Ga0244775_1010263410 | 3300024346 | Estuarine | KAIRRITADARKLNKTLKEMRNASVKKCPHCGEKL |
| Ga0244776_107050943 | 3300024348 | Estuarine | LGKAKHERDRKKIKNQLSDARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0209083_12710421 | 3300025162 | Freshwater | KHERDRKAIRHQLNDARKLNRTLKEMRSLTTKHCPHCGEKI |
| Ga0255104_10097266 | 3300027146 | Freshwater | LKEELTKAKSDRDRKSIRRITADARKLNKSLKEMRNATTKLCPHCGEKL |
| Ga0255115_10766883 | 3300027148 | Freshwater | DRKAISRIIADARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0208554_10446722 | 3300027212 | Estuarine | KMKLHLKAELSKVKHERDKKTIKRIVADARKLNKTLKEMRQVATKLCPHCGEKI |
| Ga0255138_10677491 | 3300027333 | Freshwater | RDRKAIRRIIADARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0208966_10655881 | 3300027586 | Freshwater Lentic | HERNRKWLKSQLRETKALNKTLKEMRNANTKLCPHCGEKL |
| Ga0255119_10665681 | 3300027596 | Freshwater | LKEELSKAKHDRDRKAIRRIIADARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0208974_10540554 | 3300027608 | Freshwater Lentic | DRDRKAIRRIISDARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0208133_10252126 | 3300027631 | Estuarine | FEGRLNKMKLHLKEELSKAKGERDRKAIRRITADARKLNKTLKEMRSVTTKLCPHCGEKL |
| Ga0208133_10972561 | 3300027631 | Estuarine | FEGRLNKMKLHLKEELGKAKSDRNRKLIKSQLADAKKLNRTLKEMRNANTKLCPHCGEKL |
| Ga0209443_11688741 | 3300027707 | Freshwater Lake | RLNKMKLHLKEELGKAKHDRDRKAIRRITTDARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0209770_102631913 | 3300027769 | Freshwater Lake | EELGKAKHDRNRKWIKIQLADARKLNKTLKEMRNASAKKCPHCGEKL |
| Ga0209770_103737482 | 3300027769 | Freshwater Lake | KAKHDRDRKAIRRITTDARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0209107_100410306 | 3300027797 | Freshwater And Sediment | HERDKQAIKRIVVDARKLNKTLKEMRNANTRLCPHCGEKL |
| Ga0209107_101544662 | 3300027797 | Freshwater And Sediment | KLHLKAELGKAKHDRDRKMIKSQLADAKKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0209107_102583881 | 3300027797 | Freshwater And Sediment | LNLKEELTKAKHDRDRKALRRIISDARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0209107_104266243 | 3300027797 | Freshwater And Sediment | HDRDRKAIRKITADARKLNKTLKEMRNATTKLCPHCGEKL |
| Ga0209229_103402094 | 3300027805 | Freshwater And Sediment | KLHLKEELTKTKHDRDRKAIRRIISDARKLNKTLKEMRNATTKLCPHCGEKL |
| Ga0209230_106934971 | 3300027836 | Freshwater And Sediment | FEGRLNKMKLHLKEELGKAKHDRDRKSIRRITADARKLNKTLKEMRNASAKKCPHCGERL |
| Ga0209230_107160932 | 3300027836 | Freshwater And Sediment | KHERDKKTIKRIVADARKLNKTLKEMRQVATKLCPHCGEKI |
| Ga0304730_12946011 | 3300028394 | Freshwater Lake | LKAELGKAKHERDRKIIKSHLTDAKKLNRTLKEMRKANTRLCPHCGEKL |
| Ga0315899_113056491 | 3300031784 | Freshwater | LKEELGKAKHDRDRKAIRRIIADARKLNKTLKEMRNADTKLCPHCGEKL |
| Ga0315909_104224492 | 3300031857 | Freshwater | RDRKLIKSQLADAKKLNKTLKEMRNANTRLCPHCGEKL |
| Ga0315906_104798051 | 3300032050 | Freshwater | KAIRRIVYDARKLNKTLKEMRSATAKRCPHCGERL |
| Ga0315902_101142157 | 3300032093 | Freshwater | LHIKEELTKAKHDRDRKAISRIIADARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0334994_0400254_4_165 | 3300033993 | Freshwater | MKLHLKEELTKAKSDRDRKSIRRITTDARKLNKTLKEMRNAATKLCPHCGEKL |
| Ga0334995_0737024_2_139 | 3300034062 | Freshwater | LGKAKSDRDRKAIRRITTDARKLNKTLKEMRNAAAKQCPHCGEKL |
| Ga0335001_0407173_606_728 | 3300034064 | Freshwater | HDRDRKSIRRIIADARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0335019_0406942_669_830 | 3300034066 | Freshwater | MKLHLKEELTKSKSDRDRKAIRRITTDARKLNKTLKEMRNAATKLCPHCGEKL |
| Ga0335028_0569767_70_231 | 3300034071 | Freshwater | MKLHLKEELGKAKHDRDRKAIRRITADARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0335020_0001115_19124_19276 | 3300034082 | Freshwater | HLKEELGKAKHDRDRKSIRRIIADSRKLNKTLKEMRNATTKLCPHCGEKL |
| Ga0335020_0277606_586_747 | 3300034082 | Freshwater | MKLHLKEELSKAKHERNRKMIKSHLSDARKLNRTLKEMRKANTKLCPHCGEKL |
| Ga0335012_0002320_2_136 | 3300034093 | Freshwater | GKAKHDRDRKSIRRIIADSRKLNKTLKEMRNATTKLCPHCGEKL |
| Ga0335027_0904371_352_501 | 3300034101 | Freshwater | LKEELGKAKSDRDRKSIRRITTDARKLNKTLKEMRNAAAKQCPHCGETL |
| Ga0335029_0090256_2_133 | 3300034102 | Freshwater | KAKHERDRKKIKNQLSDARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0335035_0039400_1_147 | 3300034105 | Freshwater | KEELTKAKHDRDRKAIRRIISDARKLNKTLKEMRNANIKLCPHCGEKL |
| Ga0335033_0048989_2437_2586 | 3300034117 | Freshwater | LKEELTKAKHDRDRKAIRRIISDARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0335033_0477800_56_217 | 3300034117 | Freshwater | MKLHLKEELSKAKGERDRKSIRRIIADARKLNKTLKEMRNANTKLCPHCGEKL |
| Ga0335054_0325057_771_896 | 3300034119 | Freshwater | KSDRDRKAIRRITTDARKLNKTLKEMRNAATKVCPHCGEKL |
| Ga0335048_0110367_2_151 | 3300034356 | Freshwater | LKEELGKAKHDRDRKSIRRIIADSRKLNKTLKEMRNATTKLCPHCGEKL |
| Ga0335048_0441790_467_634 | 3300034356 | Freshwater | NKMKLHLKEELGKAKYDRDRKAIRRITADARKLNKTLKEMRNAATRLCPHCGEKL |
| ⦗Top⦘ |