Basic Information | |
---|---|
Family ID | F088875 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 109 |
Average Sequence Length | 43 residues |
Representative Sequence | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWC |
Number of Associated Samples | 70 |
Number of Associated Scaffolds | 109 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 51.38 % |
% of genes near scaffold ends (potentially truncated) | 99.08 % |
% of genes from short scaffolds (< 2000 bps) | 86.24 % |
Associated GOLD sequencing projects | 66 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (56.881 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (34.862 % of family members) |
Environment Ontology (ENVO) | Unclassified (60.550 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (69.725 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.23% β-sheet: 0.00% Coil/Unstructured: 69.77% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 109 Family Scaffolds |
---|---|---|
PF03406 | Phage_fiber_2 | 3.67 |
PF16778 | Phage_tail_APC | 0.92 |
PF13884 | Peptidase_S74 | 0.92 |
PF13385 | Laminin_G_3 | 0.92 |
PF09636 | XkdW | 0.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 56.88 % |
All Organisms | root | All Organisms | 43.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_109522141 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300002835|B570J40625_100111771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3305 | Open in IMG/M |
3300002835|B570J40625_100396377 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
3300002835|B570J40625_100546408 | Not Available | 1075 | Open in IMG/M |
3300002835|B570J40625_100600338 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300002835|B570J40625_100975868 | Not Available | 726 | Open in IMG/M |
3300002835|B570J40625_101141528 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300003497|JGI25925J51416_10056437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
3300004054|Ga0063232_10086457 | Not Available | 869 | Open in IMG/M |
3300004096|Ga0066177_10221264 | Not Available | 783 | Open in IMG/M |
3300004096|Ga0066177_10517648 | Not Available | 529 | Open in IMG/M |
3300004124|Ga0066178_10199363 | Not Available | 574 | Open in IMG/M |
3300004126|Ga0066179_10031413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1158 | Open in IMG/M |
3300004126|Ga0066179_10039610 | Not Available | 1062 | Open in IMG/M |
3300004126|Ga0066179_10133103 | Not Available | 662 | Open in IMG/M |
3300004481|Ga0069718_15817475 | Not Available | 551 | Open in IMG/M |
3300005517|Ga0070374_10040957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2405 | Open in IMG/M |
3300005527|Ga0068876_10366352 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300005581|Ga0049081_10297391 | Not Available | 557 | Open in IMG/M |
3300006484|Ga0070744_10148815 | Not Available | 672 | Open in IMG/M |
3300007516|Ga0105050_10252950 | Not Available | 1087 | Open in IMG/M |
3300007516|Ga0105050_10283859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1014 | Open in IMG/M |
3300007516|Ga0105050_10305756 | Not Available | 970 | Open in IMG/M |
3300007523|Ga0105052_11030858 | Not Available | 510 | Open in IMG/M |
3300007551|Ga0102881_1238827 | Not Available | 503 | Open in IMG/M |
3300007722|Ga0105051_10422960 | Not Available | 993 | Open in IMG/M |
3300007722|Ga0105051_10798979 | Not Available | 684 | Open in IMG/M |
3300007722|Ga0105051_10999390 | Not Available | 599 | Open in IMG/M |
3300008261|Ga0114336_1211722 | Not Available | 805 | Open in IMG/M |
3300008267|Ga0114364_1006668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5698 | Open in IMG/M |
3300008448|Ga0114876_1201029 | Not Available | 672 | Open in IMG/M |
3300008448|Ga0114876_1230917 | Not Available | 594 | Open in IMG/M |
3300008450|Ga0114880_1185653 | Not Available | 713 | Open in IMG/M |
3300009159|Ga0114978_10331780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
3300009159|Ga0114978_10499761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300009169|Ga0105097_10053948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2167 | Open in IMG/M |
3300009180|Ga0114979_10346555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
3300009181|Ga0114969_10197921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1235 | Open in IMG/M |
3300009183|Ga0114974_10290512 | Not Available | 965 | Open in IMG/M |
3300010885|Ga0133913_12469020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1268 | Open in IMG/M |
3300010965|Ga0138308_136112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2159 | Open in IMG/M |
3300012726|Ga0157597_1047798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1702 | Open in IMG/M |
3300013372|Ga0177922_10424444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
3300013372|Ga0177922_10589788 | Not Available | 558 | Open in IMG/M |
3300013372|Ga0177922_10839925 | Not Available | 750 | Open in IMG/M |
3300013372|Ga0177922_11187974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1386 | Open in IMG/M |
3300017707|Ga0181363_1028618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1059 | Open in IMG/M |
3300017716|Ga0181350_1045846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1172 | Open in IMG/M |
3300017716|Ga0181350_1161112 | Not Available | 520 | Open in IMG/M |
3300017722|Ga0181347_1066749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
3300017722|Ga0181347_1143537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300017774|Ga0181358_1072484 | Not Available | 1269 | Open in IMG/M |
3300017774|Ga0181358_1083095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1167 | Open in IMG/M |
3300017778|Ga0181349_1304974 | Not Available | 515 | Open in IMG/M |
3300017778|Ga0181349_1307810 | Not Available | 512 | Open in IMG/M |
3300017780|Ga0181346_1040094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1919 | Open in IMG/M |
3300017780|Ga0181346_1051452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1666 | Open in IMG/M |
3300017780|Ga0181346_1059043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1540 | Open in IMG/M |
3300017780|Ga0181346_1135673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
3300017780|Ga0181346_1186924 | Not Available | 755 | Open in IMG/M |
3300017784|Ga0181348_1064332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1480 | Open in IMG/M |
3300017784|Ga0181348_1256664 | Not Available | 602 | Open in IMG/M |
3300017785|Ga0181355_1042034 | All Organisms → Viruses → Predicted Viral | 1956 | Open in IMG/M |
3300017785|Ga0181355_1083371 | Not Available | 1334 | Open in IMG/M |
3300017785|Ga0181355_1256005 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 670 | Open in IMG/M |
3300017785|Ga0181355_1291623 | Not Available | 615 | Open in IMG/M |
3300019784|Ga0181359_1107476 | Not Available | 1015 | Open in IMG/M |
3300020172|Ga0211729_10124028 | Not Available | 638 | Open in IMG/M |
3300020172|Ga0211729_11340296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2277 | Open in IMG/M |
3300020205|Ga0211731_10458240 | Not Available | 577 | Open in IMG/M |
3300020205|Ga0211731_11351696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3056 | Open in IMG/M |
3300020556|Ga0208486_1033643 | Not Available | 768 | Open in IMG/M |
3300022190|Ga0181354_1022848 | Not Available | 2001 | Open in IMG/M |
3300022190|Ga0181354_1191059 | Not Available | 616 | Open in IMG/M |
3300022407|Ga0181351_1042641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1913 | Open in IMG/M |
3300022407|Ga0181351_1073461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1379 | Open in IMG/M |
3300027621|Ga0208951_1134653 | Not Available | 653 | Open in IMG/M |
3300027631|Ga0208133_1099348 | Not Available | 680 | Open in IMG/M |
3300027707|Ga0209443_1244139 | Not Available | 616 | Open in IMG/M |
3300027785|Ga0209246_10006809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4223 | Open in IMG/M |
3300027816|Ga0209990_10250142 | Not Available | 807 | Open in IMG/M |
3300027969|Ga0209191_1062809 | Not Available | 1663 | Open in IMG/M |
3300031746|Ga0315293_10169286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1814 | Open in IMG/M |
3300031772|Ga0315288_10416443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1355 | Open in IMG/M |
3300031951|Ga0315904_10047847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4798 | Open in IMG/M |
3300031997|Ga0315278_11771534 | Not Available | 585 | Open in IMG/M |
3300031999|Ga0315274_10179642 | Not Available | 2649 | Open in IMG/M |
3300031999|Ga0315274_10949813 | Not Available | 887 | Open in IMG/M |
3300031999|Ga0315274_11278759 | Not Available | 718 | Open in IMG/M |
3300031999|Ga0315274_11750609 | Not Available | 573 | Open in IMG/M |
3300031999|Ga0315274_11991848 | Not Available | 522 | Open in IMG/M |
3300032046|Ga0315289_10509133 | Not Available | 1154 | Open in IMG/M |
3300032046|Ga0315289_10678153 | Not Available | 939 | Open in IMG/M |
3300032046|Ga0315289_10769394 | Not Available | 855 | Open in IMG/M |
3300032053|Ga0315284_11503440 | Not Available | 715 | Open in IMG/M |
3300032164|Ga0315283_11555952 | Not Available | 675 | Open in IMG/M |
3300032173|Ga0315268_11515185 | Not Available | 682 | Open in IMG/M |
3300032401|Ga0315275_10525477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1325 | Open in IMG/M |
3300032516|Ga0315273_11814253 | Not Available | 733 | Open in IMG/M |
3300033816|Ga0334980_0414670 | Not Available | 509 | Open in IMG/M |
3300033993|Ga0334994_0045774 | Not Available | 2756 | Open in IMG/M |
3300033996|Ga0334979_0553779 | Not Available | 616 | Open in IMG/M |
3300034012|Ga0334986_0070455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2159 | Open in IMG/M |
3300034050|Ga0335023_0169758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1233 | Open in IMG/M |
3300034068|Ga0334990_0154823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
3300034092|Ga0335010_0056677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2786 | Open in IMG/M |
3300034101|Ga0335027_0080971 | Not Available | 2526 | Open in IMG/M |
3300034104|Ga0335031_0788818 | Not Available | 533 | Open in IMG/M |
3300034280|Ga0334997_0172789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1430 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 34.86% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 14.68% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.09% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.34% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.42% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 6.42% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.50% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.75% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.83% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.83% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.83% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.83% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.92% |
Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.92% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.92% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1095221413 | 3300002408 | Freshwater | VTFPQGTLPRLIQVALAEVGTAETGNNETKYGKFMKADKLAWCG |
B570J40625_1001117715 | 3300002835 | Freshwater | VTFPQGTLPRLIQVALAEVGTAETGNNETKYGKFMKADKL |
B570J40625_1003963773 | 3300002835 | Freshwater | VTFPQGTLPRLIQIALAEVGTAETGNNETKYGKHMKADKLPWCGSF |
B570J40625_1005464081 | 3300002835 | Freshwater | VEHLTKMFPQGTLPRLIQIALAEVGTAETGNNETKYGKHMKA |
B570J40625_1006003381 | 3300002835 | Freshwater | VSSFPQGTLPRLIQIALAEVGTAETGNNETKYGKHMKADKLPWCGS |
B570J40625_1009758683 | 3300002835 | Freshwater | VTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKL |
B570J40625_1011415283 | 3300002835 | Freshwater | MFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWCGSF |
JGI25925J51416_100564371 | 3300003497 | Freshwater Lake | MSSFPQGTLPRLIQVALAEVGTAETGNNETXXGKHMXADKLPWCGSXINWCADQAGVD |
Ga0063232_100864571 | 3300004054 | Freshwater Lake | VTFPQGTLSRLIEVALAEVGTAEIGNNETKYGKHMKADKLPWCG |
Ga0066177_102212641 | 3300004096 | Freshwater Lake | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWCG |
Ga0066177_105176483 | 3300004096 | Freshwater Lake | VTFPQGTLPRLIQVALAEVGTAEIGNNETKYGKHMKADKLPWC |
Ga0066178_101993633 | 3300004124 | Freshwater Lake | VTFAQGTLPRLIQVALAEVGVAETGNNETKYGKHMKADKLPWCGS |
Ga0066179_100314131 | 3300004126 | Freshwater Lake | VTFAQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWCGSF |
Ga0066179_100396103 | 3300004126 | Freshwater Lake | MTFPQGTLPRLIQVALAEVGTAETGDNETKYGKHMKADKL |
Ga0066179_101331033 | 3300004126 | Freshwater Lake | VTFPQGTLSRLIEVALAEVGTAEIGNNETKYGKHMNADKL |
Ga0069718_158174751 | 3300004481 | Sediment | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWCGS |
Ga0070374_100409574 | 3300005517 | Freshwater Lake | VTFPQGTLSRLIEVALAEVGTAEIGNNETKYGKHMKADKL |
Ga0068876_103663523 | 3300005527 | Freshwater Lake | MSSFPQGTLPRLIQVALAEVGTAETGNNETKYGKYMKADKLPWCGS |
Ga0049081_102973911 | 3300005581 | Freshwater Lentic | MSNFPQGTLPRLIQIALAEVGTAETGNNETKYGKHM |
Ga0070744_101488153 | 3300006484 | Estuarine | VTFPQGTLPRLIQVALAEVGVAETGNNETKYGKHMKADKLPWCGS |
Ga0105050_102529503 | 3300007516 | Freshwater | MIYPQGTSAAMIEVALAEVGTVETGENLTKYGKHMKANGLPWCGSFLNWC |
Ga0105050_102838591 | 3300007516 | Freshwater | MIYPQGTSAALIAVALAEVGTVETGENLTKYGKHMKANGLPWCGSFL |
Ga0105050_103057561 | 3300007516 | Freshwater | MIYPQGTRAALVEVALAEVGTVETGENLTKYGKHMKANGLPWC |
Ga0105052_110308581 | 3300007523 | Freshwater | MIYPQGTRAAMIEVALAEVGTVETGENWTKYGKHMKANGLPWCGSFLNWCAD |
Ga0102881_12388273 | 3300007551 | Estuarine | MTFPQGTLSRLIEVALAEVGTAETGNNETKYGKHMKADKL |
Ga0105051_104229601 | 3300007722 | Freshwater | MIYPQGTRAAMVEVALAEVGTVETGENLTKYGKHMKANGLPWCG |
Ga0105051_107989791 | 3300007722 | Freshwater | MIYPQGTSAAMVEVALAEVGTVETGENLTKYGKHMKANGLPWCGSFLN |
Ga0105051_109993903 | 3300007722 | Freshwater | MIYPQGTSAAMIEVALAEVGTVETGENLTKYGKHMKANGLPWCGSFL |
Ga0114336_12117223 | 3300008261 | Freshwater, Plankton | MSNFPQGTLPRLIQIALAEVGTAETGNNETKYGKHMKAD |
Ga0114364_10066689 | 3300008267 | Freshwater, Plankton | MSNFPQGTLPRLIQIALAEVGTAETGNNETKYGKHMKA |
Ga0114876_12010293 | 3300008448 | Freshwater Lake | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHM |
Ga0114876_12309173 | 3300008448 | Freshwater Lake | MSFPQGTLPRLIQVALAEVGTAETGNNETKYGKFMKADKLPW |
Ga0114880_11856531 | 3300008450 | Freshwater Lake | MSNFPQGTLPRLIQIALAEVGTAETGNNETKYGKHMKADK |
Ga0114978_103317804 | 3300009159 | Freshwater Lake | MSSFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADK |
Ga0114978_104997613 | 3300009159 | Freshwater Lake | MSNFSQGTLPRLIQVALAEVGTAETGNNETKYGKHM |
Ga0105097_100539484 | 3300009169 | Freshwater Sediment | MSNFPQGTLPRLIQIALAEVGTIETGNNETKYGKFMKADKLP |
Ga0114979_103465551 | 3300009180 | Freshwater Lake | LSNFPQGTLPRLIQVALAEVGTAETGDNETKYGKHMKADK |
Ga0114969_101979211 | 3300009181 | Freshwater Lake | MTINFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWC |
Ga0114974_102905121 | 3300009183 | Freshwater Lake | MSFPQGTLPRLIQVALAEVGVAETGNNETKYGKHMKADKLPW |
Ga0133913_124690201 | 3300010885 | Freshwater Lake | VTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWCGSF |
Ga0138308_1361124 | 3300010965 | Lake Chemocline | VTNFPQGTLPRLIQVALAEVGTAETGQNETKYGKHMKADKLPWC |
Ga0157597_10477984 | 3300012726 | Freshwater | MSNFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKAD |
Ga0177922_104244443 | 3300013372 | Freshwater | MFPQSTLPRLIEVALAEVGTAETGNNETKYGKHMKADKLPWCG |
Ga0177922_105897883 | 3300013372 | Freshwater | VTFPQGTLPRLIQVALAEVGTAETGENETKYGKHMK |
Ga0177922_108399251 | 3300013372 | Freshwater | VSQYPEGTLPRLIQIALAEVGTAETGNNETKYGKHMKADKLPWCGSFLNWC |
Ga0177922_111879743 | 3300013372 | Freshwater | MFPQGTLPRLIQIALAEVGTAETGNNETKYGKHMKADKLPWCG |
Ga0181363_10286181 | 3300017707 | Freshwater Lake | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWCGSF |
Ga0181350_10458463 | 3300017716 | Freshwater Lake | MANFPQGTLPRLIQVALAEVGVAETGNNETKYGKHMNA |
Ga0181350_11611123 | 3300017716 | Freshwater Lake | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMK |
Ga0181347_10667493 | 3300017722 | Freshwater Lake | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWC |
Ga0181347_11435371 | 3300017722 | Freshwater Lake | MTFPQGTLSRLIEVALAEVGTAETGNNETKYGKHMKADKLPWCGS |
Ga0181358_10724843 | 3300017774 | Freshwater Lake | VTFPQGTLPRLIQVALAEVGTAEIGNNETKYGKHMKADKLPWCGSF |
Ga0181358_10830951 | 3300017774 | Freshwater Lake | MFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKL |
Ga0181349_13049741 | 3300017778 | Freshwater Lake | MFPQGTLPRLIQIALAEVGTAETGNNETKYGKHMKADKLPWC |
Ga0181349_13078103 | 3300017778 | Freshwater Lake | MTFPQGTLPRLIQVALAEVGVAETGNNETKYGKHMKADK |
Ga0181346_10400944 | 3300017780 | Freshwater Lake | MTFPQGTLPRLIQVALAEVGTAETGDNETKYGKHM |
Ga0181346_10514524 | 3300017780 | Freshwater Lake | MYPDGTAARIIEVALAEVGTAETGNNETKYGKHMKADKLPWCG |
Ga0181346_10590431 | 3300017780 | Freshwater Lake | VTFPQGTLSRLIEVALAEVGTAEIGNNETKYGKHMKADKLPWC |
Ga0181346_11356733 | 3300017780 | Freshwater Lake | MTFEQGTLPRLIQVALAEVGTAETGENETKYGKHMKADKLPWCGSFLN |
Ga0181346_11869241 | 3300017780 | Freshwater Lake | VTFAQGTLPRLIQIALAEVGTAETGNNETKYGKHMKADKLP |
Ga0181348_10643324 | 3300017784 | Freshwater Lake | VTFAQGTLPRLIQVALAEIGTAETGNNETKYGKHMKADK |
Ga0181348_12566643 | 3300017784 | Freshwater Lake | LSNFAQGTLPRFIQVALAEVGTAETGNNETKYGKHMKADKLPWCGS |
Ga0181355_10420341 | 3300017785 | Freshwater Lake | MTFPQGTLPRLIQVALAEVGTAETGDNETKYGKHMKADKLPWCGSFL |
Ga0181355_10833711 | 3300017785 | Freshwater Lake | VTFPQGTLPRLIQVALAEVGTAEIGNNETKYGKHMKADK |
Ga0181355_12560051 | 3300017785 | Freshwater Lake | MSNFAQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKL |
Ga0181355_12916231 | 3300017785 | Freshwater Lake | VTFPQGTLPRLIQIALAEVGTAETGQNETKYGKHMKADKLPWCGSFL |
Ga0181359_11074763 | 3300019784 | Freshwater Lake | MTFPQGTLPRLIQVALAEVGTAETGDNETKYGKHMKADKLPWCGSFLNC |
Ga0211729_101240281 | 3300020172 | Freshwater | MTFPQGTLARMIQVALAENGVAETGNNETKYGKHMKADKLPWCGSFLN |
Ga0211729_113402964 | 3300020172 | Freshwater | VTFAQGTLPRLIQVALAEVGVAETGNNETKYGKHMKA |
Ga0211731_104582401 | 3300020205 | Freshwater | VTNFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWCGSFI |
Ga0211731_113516965 | 3300020205 | Freshwater | MSNFPQGTLPRLIQIALAEVGTAETGNNETKYGKHMKADKLP |
Ga0208486_10336433 | 3300020556 | Freshwater | MFPQGTLPRLIQIALAEVGTAETGNNETKYGKHMKADKLPWCGSFL |
Ga0181354_10228481 | 3300022190 | Freshwater Lake | MTNFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLS |
Ga0181354_11910593 | 3300022190 | Freshwater Lake | MFPQGTLPQLIQVALAEVGTAETGNNETKYGKHMKADKLPWCGSFL |
Ga0181351_10426414 | 3300022407 | Freshwater Lake | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKAF |
Ga0181351_10734614 | 3300022407 | Freshwater Lake | MTFPQGTLPRLIQVALAEVGTAETGDNETKYGKHMKADKLPWCG |
Ga0208951_11346531 | 3300027621 | Freshwater Lentic | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWCGSFLNYC |
Ga0208133_10993481 | 3300027631 | Estuarine | VTFPQGTLPRLIQVALAEVGTAETENNETKYGKHMKADKLPWCGSFLN |
Ga0209443_12441391 | 3300027707 | Freshwater Lake | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWCGSFLN |
Ga0209246_100068091 | 3300027785 | Freshwater Lake | MSQFAQGTLPRLIQVALAEIGTAETGNNETKYGKHMKADKLPWC |
Ga0209990_102501421 | 3300027816 | Freshwater Lake | MSSFPQGTLPRLIQVALAEVGTAETGNNETKYGKYMKADKLPWCG |
Ga0209191_10628091 | 3300027969 | Freshwater Lake | MSNFSQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWCGSFL |
Ga0315293_101692861 | 3300031746 | Sediment | MTFPQGTLSRLIEVALAEVGTAETGNNETKYGKFMKADK |
Ga0315288_104164434 | 3300031772 | Sediment | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWCGSFL |
Ga0315904_100478471 | 3300031951 | Freshwater | VSNFPQGTLPRLIQVALAEVGTAETGNNETKYGKF |
Ga0315278_117715341 | 3300031997 | Sediment | MSFPQGTLSRLIEVALAEVGTAETGNNETKYGKHMKADKLPWCGSFL |
Ga0315274_101796425 | 3300031999 | Sediment | MTFPQGTLPRLIEVALSEVGTAETGNNETKYGKHMKADKLPWCGS |
Ga0315274_109498131 | 3300031999 | Sediment | MTSFPKGTLPRLIEVALAEVGTAETGENETKYGKHMKADKL |
Ga0315274_112787591 | 3300031999 | Sediment | MTFAQGTLPRMIQVALAEVGVAETGNNETKYGKHMKADKLPWCGSFLN |
Ga0315274_117506093 | 3300031999 | Sediment | MSSFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLPWCGSFLNWC |
Ga0315274_119918481 | 3300031999 | Sediment | VTFPQGTLSRLIEVALAEVGTAETGNNETKYGKHMKADNL |
Ga0315289_105091332 | 3300032046 | Sediment | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKL |
Ga0315289_106781533 | 3300032046 | Sediment | MTYPQGTLPRLIEVALAEVGTAETGNNETKYGKHMKADKLPW |
Ga0315289_107693943 | 3300032046 | Sediment | MDCSGVGMTFPQGTLPRLIEVALAEVGTAETGNNETKYGKHMKADKLPWCGSFLNW |
Ga0315284_115034403 | 3300032053 | Sediment | MTYPQGTLPRLIEVALAEVGTAETGNNETKYGKHMKADKLPWCGSFLNW |
Ga0315283_115559521 | 3300032164 | Sediment | VSIYPQGTLPRLIQVALAEVGVAETKENETKYGKHMKADK |
Ga0315268_115151851 | 3300032173 | Sediment | MTFPQGTLSRLIEIALAEVGTAETGNNETKYGKFMKADKLP |
Ga0315275_105254774 | 3300032401 | Sediment | VSSFPQGTLPRLIQVALAENGVAETGINETKYGKHMKADKLPWCGSY |
Ga0315273_118142533 | 3300032516 | Sediment | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADKLP |
Ga0334980_0414670_1_117 | 3300033816 | Freshwater | MTTFPQGTLPRLIQVALAEVGTTETGDNETKYGKFMKAD |
Ga0334994_0045774_3_113 | 3300033993 | Freshwater | MSNFPQGTLPRLIQVALAEVGTIETGNNETKYGKFMK |
Ga0334979_0553779_491_616 | 3300033996 | Freshwater | MSFPQGTLPRLIQVALAEVGVAETGDNETKYGKHMKADKLPW |
Ga0334986_0070455_2049_2159 | 3300034012 | Freshwater | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKA |
Ga0335023_0169758_3_152 | 3300034050 | Freshwater | MSNFPQGTLPRLIQIALAEVGTAEIGNNETKYGKHMKADKLPWCGSFLNW |
Ga0334990_0154823_1116_1250 | 3300034068 | Freshwater | MTFPQGTLPRLIQIALAEVGTAETGNNETKYGKHMKADKLPWCGS |
Ga0335010_0056677_2658_2786 | 3300034092 | Freshwater | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKFMKADKLPWC |
Ga0335027_0080971_2399_2524 | 3300034101 | Freshwater | MTFPQGTLPRLIQIALAEVGTAETGNNETKYGKFMKADKLPW |
Ga0335031_0788818_385_531 | 3300034104 | Freshwater | MSSFPQGTLPRLIQVALAEVGTAETGNNETKYGKFMKADKLPWCGSFLN |
Ga0334997_0172789_2_118 | 3300034280 | Freshwater | MTFPQGTLPRLIQVALAEVGTAETGNNETKYGKHMKADK |
⦗Top⦘ |